Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition Ox @XUVEW vnd devicefictitious `@Lv`[`VEW `X@ %s: unknown option %c %s: %c argument missing input compressed with %s; use the -%c option to decompress itbzip2compress7zXZinput compressed with xzInvalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %s/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578TAPE-IUnable to open %sUnable to read from %s-CInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value: %sab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archiveRemoving leading "%.*s" ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlerstdio rpath wpath cpath fattr dpath getpw proc exec tapestdio rpath wpath cpath fattr dpath getpw tapecan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate space for directory access time tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableHard link table out of memorydeferred symlink hardlinkdefered symlink hardlink pathsymlink tabledeferred symlink removaldeferred symlink%s: %sdefered symlink pathdefered symlink valuedefered symlinkFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sDirectory access time reset table ran out of memoryUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00nobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header recordInvalid extended header record lengthExtended header record length %lu is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %s|蚄蚌蚔蚜 \\\\dp褠褨 (08P@HPX`t|裄裌裔補裤裬裴裼8辄X辄轀D辐l(h(usage: ping6 [-dEefHLmnqv] [-c count] [-h hoplimit] [-I sourceaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-V rtable] [-w maxwait] host usage: ping [-DdEefHLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Host UnreachableDestination Port UnreachableDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededFrag reassembly time exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dnxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02xDestination Net UnreachableDestination Protocol Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Router Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d clock_gettime(CLOCK_MONOTONIC)sendmsgping: wrote %s %d chars, ret=%d path MTU for %s is notified. (ignored) LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitsignature mismatch!%d bytes from %s: icmp_seq=%u hlim=%d ttl=%d time=%.3f ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: --- %s ping statistics --- %lld packets transmitted, %lld packets received, %lld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x_pingunable to revoke privsnumber of packets to transmit is %s: %shoplimit is %s: %sillegal timing interval %sonly root may use interval < 1stoo small interval, raised to 0.01preload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sc:dEefHh:I:i:Ll:mNnp:qS:s:V:vw:DEI:LRS:c:defHi:l:np:qs:T:t:V:vw:size of sockaddr mismatchunsupported AF: %dmallocWarning: %s has multiple addresses; using %ssetsockopt IP_MULTICAST_IFbindUDP socketUDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)setsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt(SO_RTABLE)UDP connectgetsockname-f and -i options are incompatibleNo audible output for flood pingsgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)setsockopt(IPV6_RECVRTHDR)setsockopt IPV6_MULTICAST_LOOPIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsrecord routestdio inet dnsstdio inetPING %s (%s --> %s): %d data bytes recvmsgnew path MTU (%d) is notified @@A.PPPPPPPPPPPPPP D%6d %6s usage: %s [-benstuv] [file ...] benstuvrandommalformed link-level addressSIOCSIFLLADDRSIOCDIFPARENTSIOCDVNETIDSIOCS80211JOINSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCSIFMEDIASIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROY%s media mode %smediaopt instance %lld"%.*s"%.*s0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sparent: name too longparent: parent too longSIOCSIFPARENTvnetid: name is too longvnetflowid: name is too longSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sonly one `mode' command may be issuedllprio %s: %sSIOCSIFLLPRIOmtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longnwid and join may not be used at the same timeSIOCS80211NWID encap: vnetid none vnetid any vnetid %lld parent none parent %sSIOCS80211WPAPARMSmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGTRUNKInvalid option for trunk: %sInvalid lacptimeout option for trunk: %sSIOCSTRUNKOPTSInvalid lacpmode option for trunk: %sInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %sSIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen%s: non-contiguous mask trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s lacp_state actor ACTIVITYTIMEOUTAGGREGATIONSYNCCOLLECTINGDISTRIBUTINGDEFAULTEDEXPIRED trunkport %s lacp_state partner trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s invalid vlan tag and device specificationvnetid %s: %sSIOCSVNETIDunknown %s media mode: %sinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sSIOCG80211WPAPARMSinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave HT-MCS%d %uM %uM HT ESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSD RADIO_MEASUREMENTDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT cannot scan, interface is down no permission to scanSIOCG80211ALLNODES none recallocarraySIOCG80211JOINALL join: ieee80211: join nwid chan %u bssid %s %u%% %ddBm nwkey wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep)HIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTSTATICARPRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTINET6_NOPRIVACYMPLSWOLAUTOCONF6INET6_NOSOII rdomain %d metric %lu mtu %lu lladdr %s %cllprio %d status: %s %s: no media types?calloc media: supported media: tunnel: (unset)inet%s %s -> %s:%u ttl copy ttl %dnodfunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPno nwid or join command, guessing nwid to useSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersistpersist:SIOCS80211NWKEY: too many keys.0x%smalloc failedInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6SIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupunveilinterface name '%s' too longrulefile/etc/hosts/etc/servicesdestroy'%s' requires argument'%s' requires 2 arguments12864SIOCDIFADDRSIOCAIFADDR/etc/resolv.confactivepassivefastslowarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidjoin-joinjoinlist-joinlistbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvnetid-vnetidparent-parentvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotolacpmodelacptimeoutanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacysoii-soiipowersavepriorityrtlabelnwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaopt-modeinstanceinstlladdrllprioinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCu10GbaseLRM10GBASE-LRM40GbaseCR440GBASE-CR440GbaseSR440GBASE-SR440GbaseLR440GBASE-LR41000base-KX1000BASE-KX10GbaseKX410GBASE-KX410GbaseKR10GBASE-KR10GbaseCR110GBASE-CR110G-AOC20GbaseKR220GBASE-KR22500baseKX2500BASE-KX2500baseT2500BASE-T5000baseT5000BASE-T1000base-SGMII1000BASE-SGMII10GbaseSFI10GBASE-SFI40GbaseXLPPI40GBASE-XLPPI1000baseCX-SGMII1000BASE-CX-SGMII40GbaseKR440GBASE-KR440G-AOC10GbaseER10GBASE-ER100GbaseCR4100GBASE-CR4100GbaseSR4100GBASE-SR4100GbaseKR4100GBASE-KR4100GbaseLR4100GBASE-LR4100G-AOC56GbaseR456GBASE-R425GbaseCR25GBASE-CR25GbaseKR25GBASE-KR25GbaseSR25GBASE-SR25GbaseLR25GBASE-LR25GbaseER25GBASE-ER25G-AOC50GbaseCR250GBASE-CR250GbaseKR250GBASE-KR2Single-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72HT-MCS0HT-MCS1HT-MCS2HT-MCS3HT-MCS4HT-MCS5HT-MCS6HT-MCS7HT-MCS8HT-MCS9HT-MCS10HT-MCS11HT-MCS12HT-MCS13HT-MCS14HT-MCS15HT-MCS16HT-MCS17HT-MCS18HT-MCS19HT-MCS20HT-MCS21HT-MCS22HT-MCS23HT-MCS24HT-MCS25HT-MCS26HT-MCS27HT-MCS28HT-MCS29HT-MCS30HT-MCS31HT-MCS32HT-MCS33HT-MCS34HT-MCS35HT-MCS36HT-MCS37HT-MCS38HT-MCS39HT-MCS40HT-MCS41HT-MCS42HT-MCS43HT-MCS44HT-MCS45HT-MCS46HT-MCS47HT-MCS48HT-MCS49HT-MCS50HT-MCS51HT-MCS52HT-MCS53HT-MCS54HT-MCS55HT-MCS56HT-MCS57HT-MCS58HT-MCS59HT-MCS60HT-MCS61HT-MCS62HT-MCS63HT-MCS64HT-MCS65HT-MCS66HT-MCS67HT-MCS68HT-MCS69HT-MCS70HT-MCS71HT-MCS72HT-MCS73HT-MCS74HT-MCS75HT-MCS76VHT-MCS0VHT-MCS1VHT-MCS2VHT-MCS3VHT-MCS4VHT-MCS5VHT-MCS6VHT-MCS7VHT-MCS8VHT-MCS9t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfh11n11acmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorhdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupinvalidkeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104BO(PPPPPPPPPPPPPPP釠PPPPXPdPPPlPPPPP釀 4PPPPPPPPPPPP釘P8釬P里hP醤醼(DHPP %s: %s: %s: directory causes a cyclefts_readCOLUMNSstdio rpath getpw1ACFHLRSTacdfghiklmnopqrstux%*llu %*lld total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*lld %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] )6usage: sysctl [-n] name net.inet6.ip6.soiikey=%s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufound骤d驰dusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatseconds is %s: %sUTCcannot unsetenv TZ-t %s: %sad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Ystdio settime rpath wpathspecified date is outside allowed rangeadjtime???date set by %stoo many argumentsconversion errorusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCMNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportportnfsv2ac@<4$|,Մpddddddհdddddd՜(unused 00000000-0000-0000-0000-000000000000FAT12 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7XENIX / XENIX /usr FAT16S ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended DOSFAT16B ebd0a0a2-b9e5-4433-87c0-68b6b72699c7NTFS ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AIX fs AIX/Coherent OS/2 Bootmgr FAT32 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7 FAT32L ebd0a0a2-b9e5-4433-87c0-68b6b72699c7FAT16L ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended LBAOPUS OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Compaq Diag.OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AST swap Willowtech ThinkPad Recebd0a0a2-b9e5-4433-87c0-68b6b72699c7$NEC DOS 'Win Recoveryde94bba4-06d1-4d40-a16a-bfd50179d6ac Willowsoft 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRaf9b60a0-1431-4f62-bc68-3311714a69adCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX ChromeKernelfe3a2a5d-4f32-41a7-b725-accc3285a309Minix (old) Minix (new) Linux swap 0657fd6d-a4ab-43c4-84e5-0933c84b4f4fLinux files*0fc63daf-8483-4772-8e79-3d69d8477de4OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM e6d6d379-f507-44c2-a23c-238f2a3df928Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bOpenBSD 824cc7a0-36a8-11e3-890a-952519ad3f61NEXTSTEP MacOS X 55465300-0000-11aa-aa11-00306543ecacNetBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bMacOS X boot426f6f74-0000-11aa-aa11-00306543ecacMacOS X HFS+48465300-0000-11aa-aa11-00306543ecacBSDI filesy*BSDI swap Solaris 6a85cf4d-1dd2-11b2-99a6-080020736631CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 42465331-3ba3-10f1-802a-4861696b7521EFI GPT EFI Sys c12a7328-f81f-11d2-ba4b-00a0c93ec93bSpeedStor DOS 3.3+ SecSpeedStor Xenix BBT [oF:_1H?.aI]8ع"(9XSʇ-sf/щt?\!uIs_sCݥ*R+L*Wa˛o,NZ\wK 齸Gr,Ȃ8ZZnTe:R6Wt:W+݈nt$+z;{\B,\,"x.| OE4\HY5^Y3_c )?aӚ:&onm6("lE xNB\Ź8(>/`Нhu*Vl|Ӈ;#T. 4h}Jʛ@MsomT{YȾ( SHGYcM9gkaC# ҭ465aXՕkA/t ]f;env}l%g|!c|.\Ld2"y B+>Z#9XjG5!aBI lRA}A7=td!c/3Gh!SmedE,melRזIݳq7j'X[#.U(&Z`:0vhy_%_a?3Ɠש3 X4H4@h#m*ഗ i?b5fTFy*1/8:,VGf:sV4Izq5 ׻z&C,@ #lǎWQ(Meex1D3:!&F]Hn@PK\oJQriC$`imMAx,BSp%~f{gKPpLo:.Rm:>_-[j Hi<#RyLZ~`FXžYh.R`Żg85~;w4k$PE)0[`-OMTgtLa%*+ ^_fdti$kvxzk"s(mȆer"k&P~}I޿PK I`;:. }m\rFqfghb]߹g`JRP 2&KiAD/>XLQgxZGPm1ynp6Z+6GJr42z#"jr5յv-Ȏ*t궁!ݓw:EƵ. ƏjtiWF e6h_4Iӡ!#*)N8 Z,#e ׏% KumӅ?'/4!uP/h~It8KK!f#S>lހEQt7-$ťhECK-) |OP<{]YæN*~ >\sq~&މw _܈xl  4u=mMejղ9ҏNlE4wBڍDTv +wA.gngton]I7`qor,? Nx0壠(H7gBuN OǝEB"~V0 RZy$ݭd 9s0ꃰJFɠ?G,G?䛳4,i}DG_G |6qXXr8,AS;lX4^*Zcbǃ^Ze0Kt|[㖆-Bb qRwYRO9%O 4ߌQr$3v9m7PAoD<Y鬈)?T$@!p6GMöمYN /eʵWHʍ4)ctRfҿԱ6JH3a:ՠc|u/^jξSuoWmj~㧟.꯵GNbY\I^ nsqP@-WtKgTp0K =Qօ%HNSg*@r?=4_8X ,5oG)3eCX=KEPD]ԃ_%R/ߤ_iz<̲J7uɨlVM)Klry d2F*P)uJo/nnE'St{t8@3t4YH <xY956줄\hk0kY sY/Tɞ䱛[9Tyӗlm܍b|)(VVjC=++Z% 'j,cO- doe=MǼ9n6M{soVNj߿gu({kι87{;gB\Hਖ਼)+kH;@yh6xi9wDCuգzmVdcLliHPZc:q?)\6ZE# :M֋;TBkgmT{S{xP؜?{(+;66^j7jWc 8~/6tgnwyhk ?$ƕD# R&J9uGHT#U!2+tdWXN/)E8_iTt Tk]~\dyrd˿d(vnp*p+3[S*mN֫ e)Gk cv(""P13oUbM"  3O+t [c(yB=O imcT|Ւfm49TfYa҉?i, ҽeu-JXĖԩ14΍?*6a3i MV5eU(dhE/UOVLI䊳W 5qzn:0kfԘFY1WfY.ϵ-PtC;dBycu\zZoGy1 [;9rb;D6$i;&E99/=ټϫ}; 禕MڕAˍ^){iد*rܩiÔk>1d:ȩiE#xS̠í8*+i1 T#'f#;ÜOdt)<n@rr2SI=7SA(q7?dvRQ2#d+8֥?A UA$*oOCbZ"rP5=m}4;dm`bNñ4=e!M ỉ0Vl-dGHI=UsbUU8z5"nb'휝t#5.Nx!'[N3 Ԡ2%$Mڀ*;Ʈ(ɔsۣٗ[ePa)Oq2q?8k8׾ZhRwnlQP7=n|K/<5c8[ OCv+|_lѕ/A2A>yg:]O4as3AсTf2M{5CO sT?s?=i& rҕ-IL9\"on|ޞ(RöKWkFW;ΟB,9O5߈[jOFtan餼Cn=p)=pq' ߒ,F߃&|IفG,3K6Qy!ZJgD( &isf`'r򨁆QV:B(n;AԌб#"%ߞtEmmܴkN^Z$w?T7:LǠ6 %?ausage: %s [-egvy] [-i|-u] [-b #] [-c # -h # -s #] [-f mbrfile] [-l # ] disk -b: specify special boot partition block count; requires -i -chs: specify disk geometry; all three must be specified -e: interactively edit MBR or GPT -f: specify non-standard MBR template -g: initialize disk with GPT; requires -i -i: initialize disk with MBR unless -g is also specified -l: specify LBA block count; cannot be used with -chs -u: update MBR code; preserve partition table -v: print the MBR, the Primary GPT and the Secondary GPT -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [64..%u].iegpuvf:c:h:s:l:b:ystdio rpath wpath disklabel proc execCan't read sector 0!using builtin MBRUnable to read MBR from '%s'Unable to read complete MBR from '%s'Do you wish to write new GPT?Do you wish to write new MBR and partition table?Do you wish to write new MBR?Primary GPT: Not FoundSecondary GPT: MBR:Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.helpCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRselectSelect extended partition table entry MBRSwap two partition entriesprintPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s [n] %s [%llu - %llu]: [%llu] default value too long%s is out of range: %c%s%c %s is invalid: %c%s%c Partition id ('0' to disable) [01 - FF]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. bBytesSectorsKilobytesMMegabytesGigabytesTerabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character deviceDIOCGPDINFOCan't get disk geometry, please use [-chs] or [-l]to specify.Offset: %lld Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12llu:%12.0f%s] %s Choose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d flag value set to 0x%llx. Partition %d marked active. Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBRGPT %s %s MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %lld. error writing MBRWriting GPT.error writing GPTPartition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %lld. could not create guid for partitionPartition %d is disabled. Partition offsetPartition sizePartition namepartition name must be < %d characters Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsgptmbrUnrecognized modifier '%s' Use 'write' to update disk.OpenBSD Area%c%3d: %-36s [%12lld: %12.0f%s] %-36s %-36s #: type [ start: size ] guid name------------------------------------------------------------------------Disk: %s Usable LBA: %llu to %llu [%.0f GUID: .l.l.l.l.l.l.l.l.l.l24242424242424../,24////12424/2424242424/24241/242424242424242424242 00$2400024002424001T1`241l/1t242@11102424242424241242@2(0123456789A:B:CEFGHILRUVabce:f:hilm:noqrsuvwxyinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [-m num] [--binary-files=value] [--context[=num]] [--line-buffered] [--max-count=num] [pattern] [file ...] ^\)\(%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangecontext %sgrep version %u.%u invalid max-count %s: %sbinarywithout-matchtextUnknown binary-files optionwarning: recursive search of stdinCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextcontextdevicesextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesmax-countline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to process--Binary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vusage: mount_msdos [-9ls] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %suser is %s: %sgroup is %s: %ssl9u:g:m:o:stat %smount table fullnot an MSDOS filesystemfilesystem not supported by kernel%s on %s: %sopenusage: %s [-o options] special node o:fsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't set resource limit to max data sizeCan't get resource limit for data size/dev/etc/fstab-b %s-l %s: %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.strdup failedrealloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)Can't stat %s %s is not a character device Can't stat rootCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s5MS7) usage: %s [-dfln] [+linenum | +/pattern] name1 name2 ... %s: unknown option "-%c" out of memory! No previous command to substitute fortcgetpgrpTERMlicohcxnpagensamxsclsosgulosucusugpchocmcdbctiSHELL ...Skipping back ...Skipping %sto file %s --More--(Next file: %s)(%d%%)[Press space to continue, 'q' to quit.][Use q or Q to quit]Line too longNo previous regular expression...skipping Pattern not found Pattern not found "%s" line %lld[Not a file] line %lld...back %d page...skipping %d line ***Back*** [Press 'h' for instructions.] ******** %s: Not a text file ******** *** %s: directory *** stdio rpath ttyMORE:::::::::::::::::::::::::::: Most commands optionally preceded by integer argument k. Defaults in brackets. Star (*) indicates argument becomes new default. ------------------------------------------------------------------------------- Display next k lines of text [current screen size] z Display next k lines of text [current screen size]* Display next k lines of text [1]* d or ctrl-D Scroll k lines [current scroll size, initially 11]* q or Q or Exit from more s Skip forward k lines of text [1] f Skip forward k screenfuls of text [1] b or ctrl-B Skip backwards k screenfuls of text [1] ' Go to place where previous search started = Display current line number / Search for kth occurrence of regular expression [1] n Search for kth occurrence of last r.e [1] ! or :! Execute in a subshell v Start up /usr/ucb/vi at current line ctrl-L Redraw screen :n Go to kth next file [1] :p Go to kth previous file [1] :f Display current file name and line number . Repeat previous command ------------------------------------------------------------------------------- TERMCAP/usr/share/misc/termcapTERMPATHHOME.termcap /usr/share/misc/termcapOOPS, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+untrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %susage: %1$s -V [-eqz] [-p pubkey] [-t keytype] [-x sigfile] -m message write to %smalloc %zuverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %sverify with .pubincorrect keytype: %s is not %s/etc/signifymust specify pubkeystdio rpath wpath cpath ttyCGSVzc:em:np:qs:t:x:setvbufmust specify sigfile with - message%s.sigpath too longmust specify messageusage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p stdio dpathmkfifoinvalid file mode '%s'forbidden mode: %om:invalid device type '%s'invalid major number '%s'major number too large: '%s'invalid minor number '%s'minor number too large: '%s'major or minor number too large (%lu %lu)-1%s:*:%s:%s:%s:%s:%s usage: pwd_mkdb [-c] [-p | -s] [-d directory] [-u username] file %s.orig/etc/spwd.db%s.tmp/etc/pwd.db%s to %sline too longat line #%dline %d: superuser override in YP inclusionline %d: wheel override in YP inclusionwrite oldcan't find user in master.passwdbasedir too longusername too longcd:psu:v_shadowcannot find `%s' in the group database, aborting%s must be specified as an absolute path%s: unable to set group to %s%s: unable to make group readablestdio rpath wpath cpath getpw fattr flock__YP!close edpclose dpclose oldfclose/etc/passwd/etc/master.passwd6666$6P6868NNNHO OxR\R\ONggegegggf\ggXgf(ggXeeeXeddcceXgfcexgeeggLcdgXffggehgddg geeegXeggXgXcgXggXee@0123456789abcdefUGHRD M@dCmLSB 3@21chPT lF@bnconnectedstaticospfis-isripbgp %zu)> %.*s %s/%u %s cannot get gateway address: %slabel too longprefixlen is not supported with af %dprefixlen %s is %sbad label: %s is %sinvalid table id: %s%s: link %s; %s: inet %s; %s: inet6 %s; priority is %s: %s sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d) mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: destination: %s set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key[rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, mtu: %u, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, source dhcpslaac table %u, ifidx %u, pid: %ld, seq %d, errno %d flags: fmask: use: %8llu mtu: %8u%c expire: %8lld%cStatic Routes:Domain search:Domain Name Servers:, priority %d, table %u, ifidx %u, so_dstso_gateso_maskso_ifpso_ifaso_labelso_srcread from routing socketreadgot message of size %d on %sinternal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T rtable] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablemust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mpls-netmask must follow destination parameter-prefixlen must follow destination parameternetmask missinghost%s %s %s: gateway %sentry in userouting table overflownot in tableno such interface %sstdio dnsExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen donednqtT:vrouting table %dsetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)stdio dns routeaddbfdblackholechangecloningdeldstexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnobfdnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowRTM_INVALIDATE: invalidate cache of L2 routeRTM_BFD: bidirectional forwarding detectionRTM_PROPOSAL: config proposalRTM_CHGADDRATTR: address attributes being changedPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortDestinationProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl-estimateRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40@HX4ph4d444Xx4 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+stdio rpath inet dns ttystdio rpath wpath cpath inet dns ttyCan't allocate memory for URL encoding%%%02xRequesting %s (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s Requesting %s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]80:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s stdio ttyReading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sconnectftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget%s: connect taking too long file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: ftp [-o output] ftp://[user:password@]host[:port]/file[/] ... ftp [-o output] [-w seconds] http://host[:port]/file ... ftp [-o output] file:file ... ftp [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEgateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s-w: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVw:User-Agent: OpenBSD ftpstdio rpath dns tty inet fattrstdio rpath wpath cpath dns tty inet fattrnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiAimage%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundftpXXXXXXXXXXunable to create temporary file: %sLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. @A05|55555555l55555tusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckpermreloadJHI I %sdepartedsocket(PF_ROUTE, SOCK_RAW)write(routefd)%s: sent RTM_PROPOSAL to release leasepoll(routefd)routefd: ERR|HUP|NVALfailed to take charge'%s' is not a regular filec:di:l:L:nrvifisetrtable(%u)socketpair/dev/nullopen(%s)unpriv_ibufconfig_dhcpno such user: _dhcp%s.%s/var/db/dhclient.leasespath_lease_db/etc/resolv.conf.tailfstat(%s)%s contentsread(%s)got no data from %sshort read of %sfopen(%s)bpf input buffer/var/empty/chroot(%s)setresgidsetgroupssetresuidstdio inet dns route procstdio inet dns route/etc/dhclient.confreject addressexpecting comma delimited list of option names.expecting colon delimited list of hex octets.expecting option name.%s: bad format %c in parse_option_paramoption data buffer overflowoption datassid > 32 bytesexpecting lease declaration.expecting leaseexpecting '{'.unterminated lease.expecting statement.expecting string.unterminated interface declaration.default lease length%s: imsg_compose(IMSG_HUP)%s: msgbuf_write(unpriv_ibuf)too many receive_packet failures%s: discarding packet with hlen == %u%s: discarding packet with chaddr == %s%s: discarding packet with XID != %u (%u)%s: discarding packet from address on reject list (%s)%s: discarding packet with client-identifier %s'src%s: discarding DHCP packet of unknown type (%d)%s: discarding packet which is neither DHCP nor BOOTP%s: poll(bfdesc, routefd, unpriv_ibuf)%s: bfdesc: ERR|HUP|NVAL%s: routefd: ERR|HUP|NVAL%s: unpriv_ibuf: ERR|HUP|NVAL%s: read(bfdesc)%s: writev(%s)%s, writev(%s): %zd of %u bytes%s: sendmsg(%s)%s, sendmsg(%s): %zd of %u bytesBIOCVERSIONkernel BPF version out of range - recompile dhclientBIOCIMMEDIATEBIOCSFILDROPBIOCGBLENBIOCSETFBIOCSETWFBIOCLOCKsocket(AF_INET, SOCK_RAW)setsockopt(IP_HDRINCL)/dev/bpfopen(/dev/bpf)BIOCSETIFcScoption-%d%s: truncated pointer in DHCP Domain Search option%s: invalid forward pointer in DHCP Domain Search option compression%s: truncated label in DHCP Domain Search option%s: domain search list too long%s: truncated DHCP Domain Search option/%d "'$`\%s: option %s (%d) larger than buffer%s: option %s has no length fieldoption %s%s: pretty_print_option: bad code %d%s: %s: excess information in format string: %s%s: %s: no size indicator before A in format string: %s%s: %s: garbage in format string: %s%s: %s: expecting at least %d bytes; got %d%s: %s: expecting only %d bytes: got %d%s: %s: expecting %d bytes: got %d%hutruefalse%s: unexpected format code %cpadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-serversboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlBpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifiernisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classrelay-agent-informationnds-serversnds-tree-namends-contextdomain-searchclassless-static-routesCIAtftp-config-filevoip-configuration-serverclassless-ms-static-routesautoproxy-scriptoption-endeof in string constantstring constant too longtoken larger than internal bufferappendbackoff-cutoffbootpepochfixed-addressignoreinitial-intervallink-timeoutnext-serverprependrebindrenewrequestrequireretryselect-timeoutsendserver-namessidsupersedetimeoutfatal in %s: %s%s%sfatal in %s%s%ssearch %.*s domainnamenameserver %s nameserver# Generated by %s dhclient resolv.conf courtesy lineresolv.conf contents%s: imsg_compose(IMSG_SET_RESOLV_CONF)%s: imsg_compose(IMSG_WRITE_RESOLV_CONF)%s: imsg_compose(IMSG_DELETE_ADDRESS)%s: imsg_compose(IMSG_ADD_ROUTE)%s: mtu size %u < 68: ignored%s: imsg_compose(IMSG_SET_MTU)start time%s: writev(RTM_GET) - no default route%s: writev(RTM_GET)current time%s: poll(routefd)%s: read(RTM_GET)%s: read(RTM_GET): 0 bytes%s: read(RTM_GET): %s%s: open(%s)%s: write(%s)%s: write(%s): %zd of %zu bytes%s: imsg_compose(IMSG_FLUSH_ROUTES)%s: SIOCAIFADDR %s%s: SIOCDIFADDR %s%s: SIOCSIFMTU %d%s: imsg_compose(IMSG_SET_ADDRESS)%s: add route %s/%s via %ssysctl size of routes:routes buf realloc:sysctl retrieval of routes:%s: get_routes - %s (msize=%zu)%s: write(RTM_DELETE)%s: write(RTM_DELETE): %zd of %u bytes%s: %d bad IP checksums seen in %d packets%s: ip length %hu disagrees with bytes received %d%s: %d udp packets in %d too long - dropped%s: accepting packet with data after udp payload%s: %d bad udp checksums in %d packets%s: %s line %d: %s%s: %s^expecting integer between %lld and %lldoffexpecting boolean.expecting IPv4 address.expecting IPv4 CIDR block.unvis string %sexpecting semicolon.%s: unknown interfaceimsg_get%s: bad IMSG_DELETE_ADDRESS%s: bad IMSG_SET_ADDRESS%s: bad IMSG_FLUSH_ROUTES%s: bad IMSG_ADD_ROUTE%s: bad IMSG_SET_MTU%s: bad IMSG_SET_RESOLV_CONF%s: resolv_conf%s: bad IMSG_WRITE_RESOLV_CONF%s: bad IMSG_HUP%s: received unknown message, code %uusage: %s [-] [-s] [-p string] [file] cannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot seek temp filecannot write temp filecannot read temp filep unexpected end-of-file& no previous commandinvalid pattern delimiter%d \  \$abfnrtv\$cannot read stdincannot open output filecannot write filecannot close output filecannot open input filecannot read input filenewline inserted newline appended cannot close input fileed.hup/ed.hupno current filenameno commandinvalid filenamefilename too longnumber out of rangeno matchinvalid mark characterinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandstdio rpath wpath cpath proc exec ttycrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s no previous patternunbalanced brackets ([])trailing backslash (\)nothing to undo%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s -> %s %s is a directory (not copied).HLPRfiprvstdio rpath wpath cpath fattrthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fipv] [-R [-H | -L | -P]] source target %s [-fipv] [-R [-H | -L | -P]] source ... directory update times: %schown: %schmod: %schflags: %soverwrite %s? unlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %sp< h<<<<<<<<$4| D P < \P     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScsVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimens: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorstdio rpath wpath cpath fattr chownzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version8Xllowner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.stdio rpath fattrinvalid flags: %sinvalid flag: %s usage: growfs [-Nqy] [-s size] special rdfs: attempting to read negative block numberrdfs: seek error: %jdrdfs: read error: %jdwtfs: seek error: %ldwtfs: write error: %ldisblock bad fs_frag %d setblock bad fs_frag %dclrblock bad fs_frag %dpanic: cannot allocate I/O bufferpanic: cylinder group too bigcalloc failedgrowfs: %.1fMB (%jd sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. with soft updatessuper-block backups (for fsck -b #) at: %lld%spanic: not enough spaceacg: bad magic numbererror: cylinder group ran out of spaceinternal error: couldn't find promised block in cgbad inode number %llu to ginodeerror: %jd refs found for block %jd.Nqs:vy%s: fstat()DIOCGDINFOstdio disklabel%s: invalid partition number %upartition is unavailablecan only grow ffs partitionsfilesystem not clean - run fsckthere is not enough space (%llu < %lld)we are not growing (%jd->%jd)active snapshot found in filesystem please remove all snapshots before using growfsWe strongly recommend you to make a backup before growing the Filesystem Did you backup your data (Yes/No) ? Yes Nothing done new filesystem size is: %jd frags No memory for last sector test writeWarning: %jd sector(s) cannot be allocated. not enough new spaceDIOCWDINFO failedsuperblock not recognizedusage: %s [-g group,group,...] [-u user] newroot [command] g:u:no such user `%s'unable to get login class for `%s'too many supplementary groups providedno such group `%s'setusercontextsetuidظ0,0dLL @ returning to single-user after filesystem check ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRFILELINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%lld %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu bad inode number %llu to ginode I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****-%c flag requires a %s usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem Alternate super block location: %lld conversion levelcannot do level %d conversion bad mode to -m: %o ** lost+found creation mode %o dfpnNyYb:c:m:BADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.cannot alloc %zu bytes for inoinfoPARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %lld bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llutoo many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'phase 2, directory %d/%dphase 2, parent directory %d/%dBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu phase 3, directory %d/%ldZERO LENGTHBAD/DUPphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: CANNOT READ DISKLABEL %s: NOT LABELED AS A BSD FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKsuperblock mismatchesoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATECan't open %s: %s stdio rpath wpath getpw tty disklabelCan't stat %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock stdio rpath getpw ttyLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %lld clean = %d ** F%sile system is clean; not checking ** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangebad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %lldProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld),PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool    insert %d: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %sasprintfcan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid actioncan't exec %s for %s %s: %mPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingautobootdaemoncan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modeinit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsyy}}}yz<}}}}}}}}}}}}}zLz}z{ {D{{}}}{}|0}|}|}\usage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelcan't get physmeminsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special deviceempty partition name supplied%s: can't figure out file system partitionstdio disklabel tty%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% isblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder group%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBcannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: doas [-u user] command [args] root onlyu:no passwd entry for targetfailed to change user%s: command not foundunknown user<<Ɉ<$d<<ɀusage: %s [-dfiPRrv] file ... "/" may not be removed"." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrvstdio rpath wpath cpath getpwstdio rpath cpath getpwusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote supporttape name too long for protocol%s: unknown command%s: illegal countblocksizebsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pstdio rpath cpath fattrL |PH#X#t#t#t#t#t#tl#t#t p#t#t#t#t#t #t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t#t|!h #t#tT#t#t#t#tl|!P#t#t!p""#t!hwhitespace after %sundefined label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of ranges command w flagbad flag in substitute command: '%c'unterminated transform source stringunterminated transform target stringUnexpected character after backslashRepeated character in source stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'-i may not be used with stdinrename()%s: %s %sin-place editing onlyworks for regular files%s/sedXXXXXXXXXX ..."usage: sed [-aEnru] [-i[extension]] command [file ...] sed [-aEnru] [-e command] [-f command_file] [-i[extension]] [file ...] Eae:f:i::nrupledge: %sstdio wpath cpathstdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvDDEEFFRV V V V V V V QQV SV STV V V U8beTeTeTeTeTeTeTeTeT```eTeTeTeTd ah)6_slaacdenginestdio recvfdIF_DOWNIF_DELAYIF_PROBEIF_IDLENOT_CONFIGUREDSENTCONFIGUREDNEARLY_EXPIREDWITHDRAWNDUPLICATEDLowMediumHighslaacd:stdio unix routefrontendstdio unix recvfd routeff02::2%s: %lld %dstdio wroute-E-F-d-vusage: %s [-dv] [-s socket] dEFs:vneed root privilegesunknown user %sstdio sendfd wroute`c_getoptsc_whence <hHhptTx0-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$c_ulimitx_file_globstssssvss w,Lx ` 4T|shcomexechereindbteste_errorP Pd 8PՐxֈ֘< ,֨ 8PՐxֈ֘h ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():remove_jobj_set_asyncj_waitjwaitlastexchildj_changej_suspendcheck_jobCCCHPHPFFG HNS`p\$\|^\_]aab_^VVW,X8X\\]p]x]p]shellincludeIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }parse_args´ļshf_snprintfshf_writeshf_emptybufshf_putcharshf_ungetcshf_getcharshf_fillbufshf_getseshf_readshf_flushshf_sopenshf_reopenshf_fdopen]]<>!let||&&()setexecsig||LL8xx00DXtpx,Hhp   < \ !x" ##" $,###$#((|((((l(wdscantty_init11\12(111112(2(2(2(2(2(111>`>A>AA8A`A?@@D@@l@?(B$?HBPFGlGGGG(GGPGGGGGGGGsetstr@(#)PD KSH v5.2.14 99/07/13.2unable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifier%s: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvVbuiltin not handled by %s is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directorybad substitutionCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shelltime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%02lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numbertrap -- bad signal %sprsu,REPLYrwxugo%#3.3o bad numberaugo=+-rwxugoXsbad masknothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited %lli unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %sHSat#f#c#d#s#l#m#n#p#usage: ulimit [-acdfHlmnpSst] [value]%s: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS!"#$&'()*:;<=>?[\]`{|}\+@!;|&()`FPATHcomplete_%.*s_%dcomplete_%.*s%s: substitute errorLINES nothing to yank yank something firstduplicate binding for %s%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historyclear-screencomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeoteot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandtranspose-charsexchange-point-and-markyankcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %shere document missingcan't %s temporary file %s: %s%s: yylexerror writing %s: %sPS4%s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %s_builtin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: %s (offset %d)-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :no history (yet)HISTFILEignoredupsignorespace%s: not in history%s: invalid rangehistory function called recursivelyhistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%s%s: job not found (%s)notify%s: job not started%s: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs %s: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitfor%s: no last job%s: not startedjw:waitlast%s: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try againchild%s: execute() returned[%d]jw:last proc%s: getpgrp() failed: %s%s: tcgetpgrp() failed: %s%s: setpgid() failed: %s%s: tcsetpgrp() failed: %swarning: won't have full job control%s: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_%s: %dUse `exit' to leave ksh rshrkshrpdkshpdrkshstdio rpath wpath cpath fattr flock getpw proc exec tty/shSH_VERSIONPPIDUSER$ \h\$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-x-irOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -tstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -slogin=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings %co %s%s: bad option%s: `%c'allexportbraceexpandbgnicecsh-historyerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedrestrictedtrackallverbosextracealnumalphablankcntrldigitgraphlowerpunctupperxdigit%s: no fd%s: flags %x%s: nbytes %d0123456789abcdef(null %s)%s: bsize %d%s: flags 0x%x%s: buf %lx, bsize %d%s: missing read/write%s: bad shf/buf/bsizeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildofunction{}[[&&||;;((|&too many vars%s: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIG%s: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T! %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptor%s: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %lli out of range%s: is read only%s: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTCONTROLHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOusage: %s [-b rounds] [-c class] [-p | string] blowfish,%spref too longunable to get login class `%s'localciphercan't generate hash/etc/login.confrounds is %s: %spb:c:Enter string: readpassphraseusage: %s seconds seconds is invalid: %sseconds is too large: %susage: %s [-fiv] source target %s [-fiv] source ... directory cp failedrm failed%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %sifv%s: destination pathname too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory usage: %s [-s] [-M core] [-N system] sM:N:KERN_CONSBUFSIZEKERN_MSGBUFSIZEsysctl: %scouldn't allocate space for buffer dataKERN_CONSBUFKERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostnameB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGXj ggʧ;l٫Ak[~!yB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj gg= 0 && n <= 15n >= 0 && n <= 901234567890123456789ABCDEF0123456789abcdef0123456789abcdefUU|U|U|U|U|U|UUUUUUUUU|U|U|U|U|U|UUUUUUUUUUPOSIX_V6_LP64_OFF64 POSIX_V6_LPBIG_OFFBIGPOSIX_V7_LP64_OFF64 POSIX_V7_LPBIG_OFFBIG-lpthreadsst tt,t,tDtDtDtDtDtDtDtXtXtXtXtXtXtXtptptptptptptptptptptptpttttttttttttttttttut^[Yy]^[Nn]yesSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p {|{}}H}\}}<Ҳ؉9I#ը32D=%[όh(doCinityan@?AA?5?55?5(H4H(tblowfish,8blowfishbcryptOrpheanBeholderScryDoubt6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpassword1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashzeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***hh\P??҇coCa?Ɗ(`ȳ?DPy<-}?DUGZ2@$@@0123456789abcdefBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks/var/run/dev.db/etc/ttyssecurertsctssoftcarwindowCCCD0DHCCD0123456789abcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~/etc/protocolsSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGSTOPTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHINFOUSR1USR2THRtolowertoupperexecvp: : path too long unknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sxxsw%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueth\PD8, argument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknowncannot stat %s: %m%s: not a regular file%s: not owned by root%s: writable by non-root%s: getting capability %s: %m%s: unexpected error with capability %sinfinity%s:%s=%s: invalid size%s:%s=%s: invalid number%s:%s=%s: invalid times/keyskeyauthmalloc: %mpasswdstrdup: %m%s:%d malloc: %m/usr/src/lib/libc/gen/login_cap.c%s:%d strdup: %m%s: couldn't resolve 'tc'%s: unknown class%s: getting class information: %m%s: 'tc' reference loop%s: unexpected cgetent error%s-curcurrent resource limit name too large%s-maxmax resource limit name too largegetting resource limit: %m%s: setting resource limit %s: %m%s: setpriority: %mumasksetresgid(%u,%u,%u): %minitgroups(%s,%u): %msetlogin(%s) failure: %msetresuid(%u,%u,%u): %msetenvcould not set user environment: %mcould not set PATH: %mcputimefilesizedatasizestacksizememoryusememorylockedmaxprocopenfilescoredumpsize%s.dbtc|:/var/run/ypbind.lockunix.%u@%s/etc/netidnetid.bynametoo smallyp_next: clnt_callyp_match: clnt_callijijijiiiii%s/%s.%d/var/yp/bindingclnttcp_createclntudp_createfcntl: F_SETFDu?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_rsyslog%s: unknown facility/priority: %x<%d>[%ld]DDd4(Unknown signal: Unknown error: `Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedCannot allocate memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC program not availableProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedBad messageState not recoverablePrevious owner diedProtocol errorHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTst_hash/usr/src/lib/libc/gen/pwcache.cname != NULLassertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d US-ASCII/etc/shells# /bin/csh/bin/ksh,/666666666766 ((((( AAAAAABBBBBB malloc() warning: unknown char in MALLOC_OPTIONS %s(%d) in %s(): recursive call (double free?)chunk canary corrupted %p %#tx@%#zx%schunk info corruptedmodified chunk-pointer %pchunk is already free %pinternal struct corruptmap roundmalloc cachemunmap roundmunmap %pmalloc cache overflowregions_total not 2^xbogus pointer (double free?) %precorded size %hu < %zuchunk size %zu < %zurecorded size %zu < %zubogus pointer %pbogus moved pointer %pguard sizemprotectdouble free %pbogus pointer in validate_junk %puse after free %pfree() called before allocationfreefreezero() called before allocationfreezero/etc/malloc.confMALLOC_OPTIONScfgjCFGJmalloc init mmap failedposix_memalignmapalign bad alignmentmapalign roundrealloc internal inconsistencyrecorded old size %hu != %zurecorded old size %zu != %zu~h~~~~h@HPX`<a.outmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %Y%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s &(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&(&( p! &(&(&(&(&(&(  , !#$X$$&(&(&(&(&(&(H&(!&(`p&(&( 4 #$P$h$%4-0%2d%Y-%m-%d%03d%H:%M%e-%b-%Y+%04d%a %b %e %T %Y%$sniglet^&__`_h_p_x___ !#&(*-/14<VABCDEFCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ}: backwards memcpy<10>%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size "@""""@@"0"t""  l@@"0" 0 ##%%!x%%%%%%%%%&;@@;@h ;p;p ;p ; `; @ ; $<< <9<<-<<<< << "< < <<<=>>>????? ?(?0?8 ?@ ?H#?P3?X#?`3?h2?p3?x3?#?@?@?@?@??????????@@@@@ @(@0 @8 @@@@H@@P@X@`@h@p@x@@@@@@@@@@@@@ @ AAAAA A0A@AHAPAXA`AhApAxAAAAAAA@A@A@A@A B B B B0B8B@BHBPBXB`@Bh@BpBxB B BC$BCBC$BCBBBBBBCCCCC C(C0 C8 C@CHCPCXC`@Ch@CpCxCCCC nhmmmmmmnnnn c n(n0n8n@nHnP+PmmnXn`SSSSSSS+x-SS%PSSS+PSSc mPmXm`mhc0mpmxmmmmmmmm mhd c((08mP`mP@mxmHPH(08HPX%hـpx  ( 0 @ H X ` p x   (0@PXhx(8HXhx6  !! "0"@#P#`$p$%%&&''((8 )()8*H*X+h+x,,--9..//00(181H4X4h5x572233 (08@ H P X ` hpx !("8#H$X%h&x'()*+,-./01(283H4X5h6x789:;<=>?@A(B8CHDXEhFxGHIJKLMNOPQ(R8SHTXUhVxWXYZ[\]^_`a(b8cHdXehfxghi      0x @p (8@PX hGpppc (ــ (08%%!x%%%%%%%%%0/&(08-H -@PX,,h p@x-x---H 6H0H8HHAHXBHhCHpDHxEHFHGHHGU VGaHb"cHeHPfHhHiHLIlI mI0nI@qIHqIPrI`sIpvIwIxIu%%!x%%%%%%%%%&0 @%%!x%%%%%%%%%Gpppc (%%!x%%%%%%%%%0h 0 @&p/1HSP`Ppxxxxxxxxx 0@P`p``(0@`Xp`````(8P`hxxxxxx x8P`x(@Xhxxxxxxxxxx0xXhxx8PtH")q' 0 &(K8#@r$HPX`hx  (!S(8H`pSmmmmmmnnnn c n(n0n8n@nHnP+PmmnXn`2028',p5;Ӡ?x6xt6f6c6d6s6l6m7np ۤ8 8 8 8 (8 8 "8 <8 9 9( 9@ 9P d9X 9h d-` P9p T L9 9 80 #9  9 9 9 t9 9 9 : (:  :0 $:@ `:P :` :h :x : : : (: h: %: ܜ; ,;  ;0 `;H ;P ;` ,;p `; ; '; ;m>3H>HQK(aK8KHcKPK`eKhKpKiKkKlKX8mKC0nKfKKCPbKuKKKpLr sLhL(vL0x"NNN N(N0 N8 M 7 N@ NHNPq0ONXNh{Np};NxNNNNN:` '''''7RR(R( ? R8 e e G RHRXRhRpRxRPX nhSSSSSSS+x-SS%PSSS+PSSk(X7@PlDX`rprxrL(rrrrrrrrrrrrrssss s(s0s8s@sHsPsXs`shspsxsss0sssssssssstt t0u`up (08@HPX`hpxPX nh(0xX"P"8Phx 0H`(Hhp0H`x(P`p(@P`(H`8Pp(H` 0H`x0Hh0HXp(@PXhpP(8Phx 8Phsss s(s0s8s@sHsPsXs`shspsxsss0sssssssrrrrrrrrrrrrrst tssSSSSSSSSS(tLL `(X0@XPX`xhxpx 4x۸@ T(40D@DP`Xp,t||||`X`@H(H8HoH@HHHPX`HpHxHH  @HT  h0 !h i@iVV ذ!t iiVZшѐјѠT1 a<1 ~ 1 uA u1 g1 1 S1 ]41 V1 ^8  u1 |d1 gc uX1 g2 _82 ph2  \2( \ Q4 4 @4 4 4  p40 4@ p4H t4P 4X @4` 4p 4x |4 d4 4 4 `4 4 @4 4 44 d4 `F@FPF``(x((وŠ٘xp8|@ ٠   !(!H!!h!!!ـ" "(=  "@"`"h"##(#P4#p#######$$ $($@$X$$%%0%@%P%X%&&& &@&`'@'P@'X''K'''((&(((0(8(Pdh(X(h((((())()898)`9)))))*(*8*h*****:(*+++(+@+HS+P!+`+h+p+x++++,p,x,,C,%kA8,,,,,,,,---- -(-0-8-H-P-X-h-x----------.... .(.0.8.@T.P.`^x.h&.p......./</!x//(/H%/P/X/h////Ϙ01(1@1X1`c1h1pl`1x1303H3X3h4444455}5(585P5`5p5559@551pq55666@6`6666o7707`7h7p77788H8x88889989X999::H::::::::;;; ;(;Hn;PoP;X;h;;<< <(>>>>(@p>8&0&2CCCCCCDD BHB8AAAAXAhAABABXBhBxBBD(BD8@8@h@H@X@x@@@@??@(@@D@CCHC(ChCXC8CCDH? >>>??0?@?????DPDXDhDpDDDDDDEEE E0E@EEEEEE^^_@_x_```@``aa a8aPahaaaab0b`bbb~ccc c(c0 c8Tc`chcpcccccHcdd(d8cdHdPd`dpddddddede0(eXeeeeeeeefPfxfffgg g8g@gHgXg`ghgpgggggghhh h8hPhhhxhhhhhhii8i@iHipixiiiiiiiiiiiijjjj(j`jxjl@lPlplllllmm8FnpmnnnoophoxootthtP'pt&P&Xttuu u0u@uxuuLu(vv v@vvw TwHwwwx(xhmhxPXxxxxxyy0yHyXyyyzz zPzpzzzX{{{H{`{{|h|(||r}} }h}}}~~0~@~~~@@(H@X 8PxHxx@x8P8P`hxX PHx(PPp.P 0@nhxi08Ph8`0X@Ppx Hwpv~d..8`@X2(PxHp@x@`x0`Hh(@`8X/” pHhl (0Hh0Hh4xp@HP߈hܸ `0`Hh@Hx0`(`(08h0XX8`8` @`0p8X HhP89\/@/H:08`8X(EHP8D` @5hpx(@0`pàH` @xX˜° @PÈø@PhxĈĘĸ 0@PŘŸY88`xƐƠư8`LjǨ HpȐȠ0pɘɨɸ(@`h/ʐʸ/Ph(@ː˨@H`̸̠̀P̀͸xPH(hΐΨ @ψϨh8Ри(8HpѰ0Hh҈ϠҨ0h`ЀxӈӘӨӰP԰Ը @P`pՀՐՠհQ٠R(8(xHPXp`ր֐ 0H`pאװ0Hp؀ؐؠذظ0`pxو٘٨ٸHϐ (8Xڈژ(8RH`xۀۈRۘ۰@(0xܠ(`݀ݘݰِ 8Xހް  8X`h߈߸Hhpx08 @0Xp (0@HXhxx 089x@PX`px @P(@HXx(@Xh 08HXhx(HXhx( (@`hp>?PEOPHQU 0[THPX`pa@0`i@xi@HP`xZ@X[[[0[P 8Ph14484X4x`444455(5P5p5555566 606X[[9(<\ 909P@9h9999:::0\H:::::;; ;0;p;0\\;;;<@<<== `=0=P=h====>>8>H>X>>>>>??0?X?x????@@@@@h@@@@@@AA A0A@AHAPApd1AAAABBB`BBCCFFF0F8GGG?xӠGhC0G8GPG`GxGGGG EGHPIIIIGpIJJ(JHJJpJJJK0KHKXKhKxKKKKKKLL $L(L0 LHLXLL`LL1jh$LLLMMx%`2`M1|MMMMM6N N(N8NXNhNNNN;NNOO8O`OOOIPP PHPXP`PhPpPxPPPPhPPAPPPPPXPPPPPQQPQQQ Q0Q8QXQhQxQQQQQRRR0R@RXXRhRRRRRSSS S0OWWWWWX0p \\\]]8]X]`]x]]]^^0^HAA^X^p^^0^^^^^(__0_H_P_x__d4PpXX [0`X[\0__`` `0`8`P`h````a`p٠a@aHa`aaaaaaabb8b`ObpbbbbbccHchccccccddg0gpgggggggd0ghh h@hXhhhhhhhhii i0i@iPihiiijjj0jHj`jxjjjjjkk k@kpkdhkkkkkll bl0l@lHlPlhlllllmm(m0m8m@mHmPm`mhmmmmmnnn0nHnnndoo(o@oXooooop(p8p@pPp`pppXppppqqq0q8q@qXqxqfuuuuuuuuuvvv(v8fv@vHvPv`vpvxvvvvvvvwwwwPw`wpwxwwwwwwwHpxxxx x(x8xHx`zz{{{{8{X{h{x{{{||8|`|||VL|}} }0yP}@}H}hUT}}}}~ ~H~X~p~~~~~~~~ 8HhV| @HXhxhq0HXx hzp8p(@H`8P 0@`(8HDX`p8P`xP`h%px8PX@HXF:h8h z@PAXhx 8 `pxHXHP0P @P`xhx L(0PXh8P`p(H`px(8HP`@`p0`(8HXh(@Xh(Xr( 8h( 0Xh (0HPhx(8HXh0(@h0Xp(X8`@P 0@Xh @ehicpx5EP5E0h  (( p`xt@8Xp8Xh 0@`0Hh0` p(@x`pP(@`p8(0HPh 8Ph0 (P@ T$Xp|;0@h(8` X0HXhx8pͨ0hxΘθ(8XψϨϸ8PhР8XpxTPR`o`|dpÀX@ʾ~ @x0ӈҐ P HxԐԨh$ #H !$xոp8@h$ Xp֘!  "0X 0@Ppאװp Hxِ٨(PxT`ڐڠI>KJ0HX`hpxވޠ޸ 0`߀ߐ(P@XpUx$(Hh0Xhpxhx08Hx @hPh0H`8HPp 0@XpR @`ڰ0(@Ph 8H0@Xph8HPp0@ H`#ɔ 8hې(Ph#X(0@P#x$pی8Xx`(P`8`(X(@h۠ @`p40@Px@ 8Hh P[`x`l Ppp| 0h8pp (@X`hp$P(@X(@10`x8 PpH0@h ( U h    0     `     @      8 P      8 p  `      P8A(X`x$ X TP$@ h L$($ ($@H lXp(x @(8X$8$0`(Px P @h$$ $H$` 4  P$$0 $@p p08P F8`+,,,8,P,p,,,x, [|-0-`-p(-------...(.@.p............//// //(/0/8/X/p////////000(000H0X0h80p0x000000011(1H1`1h>H2@2`2222 22 2222333 303PJ 3`3p33R33333333330  445550 $5P (5p   T 45555555566(6@0  t6hp6pH7787 7@7H  D |7P 7X7p77   ڐ$)($    ` P    7  T     $  4 $97 $90   ` 7    T  ݸ7 (  " <  ۤ   (   ,    (    ` d  P   $ ` L # d     t  h ( % ܜ ,   '7888("P  80 p 8@ T8X 8p; *  08 1t;;;;;<<0<8 >P>p>!0>!@>"`>>??0?H <  D ` L ?p h?!h? ,??????@@@@G8@`@h@ @@@:@@AA@AXAx AAAAABB B0 <BHB`B$:BBBBBBBBCCCC0C8$@  ,CP0 CX$PCpC CCCCCCC$`CDD @ ˄DD@DhD DD$hDD  D$EEE$$pE0E8EPDEXEh$EEEE$t$F$F0 FFFFF 0FFF$ x ( L%  %xF %FGG $;XG( 6 7G@%GH%GhGpGxGGGG%%G`GGO`GGHHHHHXHhH C"hJJ(J0J8J@JH$;J`JxJJJJJ `J$;J$;J kKKK& xL'` }X&LL&'& LL''0'  P'@L'PL'pM&MM0'' 'MHMXMhMM D M H    $<$<  H h |' d d @ M7M MM , HN'N$<  NNNNO((`O* P() O@OHOXOhOpOxNNOONxOOOOOOOOOOOPPPP(P0P@N@NHPHPPPXOP`PhPpPxPPPP h )PPPPPPPPPQQ0*$p4 >   $<`ڠx &8X z }@ ;-t@tΰ [ X4px E0+@(`D`  T\@Oh =Xp@ x@ Ayi@ |`ݠ fDg O\0HA4p<  S( (|pPhe,l P 0P pL@ \ L1 l |  7 P QHx{Px~P 1HLp,|Pݨ0(t  ={Pd  \Y(@ D)0$>h4 H $>HpW8T <T\+T}$< (^ L9(^h؀| //  t%Sp 5G,t,x  &@n0E  g 8PTԤ3(n0 \ "09d$A*x| L݄ ~ ɄHxT  :0kP`0`q \ `p 8Ӏ-hd  @ X @< LOx0xX%D M<ATH@T(; ۄ @\p|Pdˌp ]\@4ߨհް $ " ǤiYpy ,؀ H `THZ$ $= di  i(@0Xh  ,0 |޸] Kp(50 fZh- ^  P\WdO$l p X OD$@l|L   [v @ mhHtx \ D` p߬ XpdPu &{F(@O@P /<H$=8$ATcp d$=ƀ{p X`3  T" O)4-  HDL  _Ő( 'g8Մ ހ LT ppI Z`B 3@ P "0> l@G8,0pb0(D x 5(9 / ̔4` D|h0 5 hqp$DXU$݀$P  ($`8+T=h0`  ApsXϠ р,ʈq U` `-@soP$AH  ͨ Fx.$5 T  Od$H  @GP(d%D'q}0p XwtdhLp  t8<@X p`#J* ۰$A0  ٠ Sp  Pxz@kpT(l 5wxs 8[` ۀ`PN@nPq$` 1 .@ xzZx8q h <߰ސ p$&Ax؈    6|2H@ ݘTZ t 8BxLrk` N4xXl'xDrT ּ$A`` n W d<|  Xٰ  \wa@Xoؠ, P `$`*pF40, `$Ԭ,v4hͤM@dx h Z@ 2|P PLH (6L ޘ`P2p x_LpQ(PG Xic$>(l@\-h0% z0 0R    l Ԡ H O,π Q,8֠x RP( 0Q8m0p*)$=OpL`kt 0` \p  dhx p2p 7L%@!P0 @xt PH X@H LM'  tlp ^& |(@D 79jsp%sXDhx 7\4H4l|@ 88x (X, PQ` @PH\tNPDWXLh el Hd   " 8 M X$(g DPL j O4 9pќplH `@PDth4T   äp^ X s\e@ O`D   'H j4H X s?/0ӰtP0 QtŌx{!0d <D`|$X <8dPZ 7  i``G@@P $|+[t: h׌& psP0@l\  l< x` Y\ A VtAY0zp  Z   t ?U<0`Al`$ XP, P 8ߠ;( C0J {<` 8J=0@  bllENp* <$>pf`c\Xp[tP0x( 0z~( L`  |P 1 p P8 @h0<pވP  ( Ϝ hfP݌ Q p<̀0 (}X и8/t|@ e hh58 J${|xPtWL$ h:DݸTިzݐ[$ `?   Y0 U|^d0,pD{@ Mp P0`dT TV`0p(@ & * 8<L  E\ :X,pp: pp 4tHP1xP|p _  6      T0  d T1;'2t+pH8v{T %  4 ;fP hMPH$(  H#p$#0gA(<8 U?@9,5ƸP8d 8ADuX 4  /L)R<P4 T* +8D9Bd #lN  ||n^L4) XPTdXߌK8Yd  `ޠ ;T 5Vdߘ4 a`1$@ Pl zhjXp= d tH@'(\ T TH8Xe uqPhPHw`hzvP{P 0xp X+0@ ph\p @\ +J,y<  `'0* Րɘ<h RLBLS DbPLSL@{PLJM X(pPp DH@ 1Dsޔ  $ h@ @PY( PXH ¨  d06|L+DѨh"`@F% cTT?$ aVdߤ@\H@D*  $p;|t'4Y `Z.D& x|l % qxʸ0 `L u`@ߐ\¨ Pd4xWK "X$X "M t 08@ Ap0 ` 48b$tp 0 ĴEL @=X @ 6: h V it Tk '$+hPLal < (|p&` +0$> 2p@ jH%nXH\T΀J`x4@W` 9|0@_ gX H |0;T @3`4h 8 ބRhn0 1>t~Ohq PP _$> D@Y@\ @h8x8 4 |  `(>$%p\@&0TjtC>t@ Д  |D0@;<Pt! (@݈hǰY`O$wV(  7@ H $d0g  |% P ]P" ߀  Z*t  l \ O 8PR\ 8 G  p p`9]lTPpD "| & H  pp @e < h <'* L \ p O( d  -$&%p'-4*d  @    bd  `P$d0dd!`dHPdd n(ذdeee,ee0SeHeXxehex8`edee$ %% '(((T( 4@E,K$d@ff5f? fffgg a@g0$gXgpgxggEd= ggeeeedhggShT h h0h@h`hhhPhhpdJ0``hchhii 'iHiiixujxjijHi`t,xx<vljpi piD(jjjkjkk(7DϠ|k0D`XkkkPcIkk@kkh,$h`lkxll l0 $hp$hx$hXA`Pl@lHlP"lXl`lhlplxl$il$hlHmm mӀ,``Pm۰ $j%vxn8nPnnxn(nnnnp _n `\ Z(p $j0Ќopppp8% /.hA`p0 $k@Ct@tFtPINg4@^|me^ttbhÐt`n@ouvtrqPk|Qp_uhPl8uP{v uvpt$kuv$kzvv}@@$k80T|hXtPx`@@pP d@Ϙjg|flu@ ]0 ] X$kP `:hx$t$t($t  ` $u0p0?$u tPP(\$v@P ",W X 33/) :t$v${M$zM${%uXX@YP${e@^`^fPbf nh0 o rhPRz{Ph@Lm+p${j% (%/H!x"`\$$ $0€X$`0@+x+,P @(Hp Hhx(HpcɐS (Ph08`(0L8`<   t }8$(8H s\ %ux90ɰh8  0@-$ 0P?<PXh.8$ATMpLPRSWTXUdZU,_\c @@rHpvPPx`$$`/P`0  $8P`ِ { yl0pʀ0p$$0$  c Xp,( 8 DH PXh P40@dP` L<"l  `0 (8,P$\`xJ<0L` ؐb%@Pwyz`x%@ ـ{@x%A0%B(%K%L@0%_%A8%Apl  8<,<Hx (|%dxؼ$%d%cHh8%dpߜ%chD%cPĸ,H08`%d%dpHLd522t€x˜t0=`t : °'¸(.`$<-#, p% H H\802 3%vf^> j?ø==hbexÈ%e0%eĔİ %n(4@x$ H l!{)6Phǐe nq&p0٠x]g@6T+x%ذ0}jW doq&0r0*7m07@,D`W`GqHvKk ev/xP* $P`HP|?<w&h>t|~0@wgpd``P2y`v/@8 \O.x.8@lD@h PP `1x{{0bPhw6]VA Jy0`vPHw@@c4 p{P2u,P6dwkP Uh ΀ |8 pez4A+HPh}0~0C0??3e@?pPDLJdPX(PCA4P ܀}F(z@-?` h0@PpݠU% 'p@PӰeqϠU@΀ py0d| Dyh3 `zPa`C*7HYTp`H5vIP am1@@/t@h@2U`2td?G?zpF\/@x[L4 ~ٰiǐ4h0D%x0s$PA4Acpɘq+pA7p{Pd`.C%v{@nؠ@@~`z06% `]kRP(`pPxP@Z x%)/@l@P+KP0@HZ!DpV }}@J{P5Oo m0qPpkpk<' XHP.jTX`%p,0x,0,07pL0l nnm(PXXWPWPo8:pciqp  (P0P8P@ HXh#pDxD`P0P`p0Lߐp ـ ـ ـ  8 (<p  8 5 @  H @ P  X  ` p h  p  x N  N  N  p  !  %`  D   I@8unblock and -DNO_CONV?(  `\ Z( _p(@ ] X ]@00 0(S0@S0PS0hS0S00000000 0000 0S0!x@0S011SS111м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:>P\>Xt>`t>h>pp>x>>=X> >>>=xl>>X>>>>l_(/tmp/EdDk.aXXXXXXXXXXc mPmXm`mhc0mpmxmmmmmmmmmmmmmmnnnn c n(n0n8n@nHnP+PmmnXn` .h m  @  (@ %#@.h m `N@_.hm@d.h    (NPذO7ذAD8Q(EذF`7ذ:D8Qdd8. Ad0X%@HPX`hpVV0VPV@VZ(Z`ZD.x g0g@gPg`gpgH Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU6ǔ6h@66֔66<7cը707P@7X7pL7x&77T7mĠ88 ʜ8(8P8X8x8<88Ȭ8:@:H:P:X:h:p @::11 P^ S@p   priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEXMASK_PRESENT CLONING MULTICAST LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDCACHEDMPATHMPLSLOCALBROADCASTCONNECTEDBFDUPBROADCASTDEBUGLOOPBACKPTPSTATICARPRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL BFD DNSSTATICSEARCHqqgqqqgpq q % q < qqrp8rtxrOذ0r Hr(r00 r88 rH!o"rP#$%%&r`'rh(rp)g*+r,-(.r/r0r1r2r3g4r5r6r7r8r9r:g;m<Srss0sXspssSSSst tPttttu uPup<NOOP .h (G0cS( 0(EHC P E(  0(EHDHCH@S ... ...50000 +\ .H  &  $ $   (@@@......%%!x%%%%%%%%%0h 0 @&/ (0<8 < @HPX`"hxmh{}abcdDgGhHilnNpPqrs tw xy !:#=$x$ (8HXhpx PL840L@4xLH4LP5LX5HL`5Lh58 6 Lp6h6Lx6L7@H>HHHQW00HHGHIHHHI(I8IHI`IxIIIIIII L(o8II J H h JJ@Sxx:xx:xx:xx:xx:xx0000000000000000 /etcc mPmXm`mhc0mpmxmmmmmmmmmmmmmmnnnn c n(n0n8n@nHnP+PmmnXn`kh)0)P455L8SL@SLHbSLPSLXxSL`@SLhS8 SLp SHSLxPSLpSS   :`      0 @HPX`hpx !"#($8%H&X'h()*+,--..//01234 5(60788@9H:P;`<p=>?@[\\]^^0_@_P``{p{|}}~(HXx @P p    8H`pS$kq?L840L@4xLH4LP5LX5HL`5Lh58 6 Lp6h6Lx6L7@?SD֠< I|DDPDED[SXZ\_\`Q ]dʐRuneCT10NONEBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~`L8L@LHLPLXL`Lh8 Lp @LxLePKKKP$LW VW@WdW]Za|a`|_^_$_^$^D^`|_^_$_^$pٰP%_HP%` P%aٰۘۘ%A۰ %e34($ؐ@p @ ` 000@P@   tȐ` 0  ̐ 00l00@?PȐ(X P?@4P P! "( "@$8?@% & &`(`+T?P,0 ,p- -h0.D@/L2H7p 708P989 :(0:0GP0J L0 Lp0MԐN?PO$0OԐ PT0Q R<PS]lP^h cpl l`lPn nPn noPopPqqP@ `>?`E`HOOPHQ0R`T?@UVdpXp[Tp\T`a@acА dd`ePgH0gPi i@ iiqp qqPs sy`А`D?P `@8| T00  0 h?@0000ȐP(0 А0А0P ?p@04 0@`@x0?P@D0`@0LPĠǔȬԐ0ʜ T0̔P<@π@ը ֔0dP@8?`\ Ȑp8P P ꐐ P |000 h`0 P L0Ԑ 00|0   h0 0 ؐ  x`$@P @000@p`?PА @(P p`"?P# $0$0%`*t1|P2`0334484 45L 56Đ07`8\`8`9 90;`;t;0<D DPDD̐G@G HHԐ0IJ,J`M0OdO Q(PR`WX X0Z$0[[t@b$ c0f0gjX0kp0ppuX wtX0l00X @` 0?@P0 P`0d(?@4@ pȐ LTlԐ ?@?T0@Ȑ4t$d\\Dĸd@`P0X ϸ#8 ԬՄ؀` ٠ P ߐ@ H h`АP4`㜐 @@ ``0 p P0@0d@@  t0\@@ x  P00?@h@X$ $ %D@&/t3p899d::l:ؐ;|@>$@? @Al0BLPD̐@EL0Fx GԐHpH@KNPO4PP` PQ`PQRR\ S?@TX0UT0VLVplyPy y zp {0~H0<   $`dPD Tp`P  x `  ДPԤ 0׌0ؠ@$0`t0  甐0̐pp,h0$@H L p `T?P0 p   <00ܐ    0 PܐP?pPPT@ А ܐ@dp0p"0%0'@)4@*@+0-ܐ0//@12p`3?`5`:XP;Ȑ@<pAp Bd?PD E ?`H H I J@L40M Np@OА0Pt0Q@TW`Y@d0 d`gpim@p<0q̐Pwt@x`zP}}ؐ~P0~Đ0Đ`4PP0PX@$P@`Tp̐@Pp0@TtP0 H0P|̐@`p`Ԑ`8P0p`АpDphD?pt0p@  08P`̐|pp PtА@Ő@x?p`ͤ \0АPp Ӏ L?`@`p؈?`P@ ߐ D ࠐ@ᴐ ┐( h0L0x D``|``p\ @ 0 <    T     p0$@8P$``|0P`#d?@$`OhV[@fP`kp0l\@oP0p q  qwp|` |ȐPL    P @0(@|@@0( P HED@T @Đ?@TP0`x`0x0|Ȑ0LP, ؐ h@4@d00tPpؔؼ,ـ 0p00 䠐 $X瘐0h0$P쨐p-t 8 89(< <=0>Đ ? 0B|C,J0K L$0MT@U<Ux?@W`YZ ZZ \\0^ _ _`0cTe 0g0hxlrT0t,u`{@p``P??@0t̐  P@`p 0ƀƸT Ȑ ̐ɔ0̐`,`ˌ` T0ؐ`Dΰ@Ѩ $`X?0`켐 D`$А?@d0( 4 АP`0?PT`400     h       А      4   \    D  $ h     d    Ԑ  8p Đ  L0 @   p Ȑ` 8  0 @ Ԑ  ` $0 $P #l  $0 &  'H  (P +\P .Hp 1D 1 5  5 6 ` 8?P 9p 9Аp :0 ;T0 <8  <  Kp LT M< N4?@ O,  O  P?@ U V0 Y\  Z0 \p g     ?P @   Ȑ@ `@ Đ@ |  ` P`    P ؐ@ ܐ   X  А?` p   T P  @0 ` L0 l0 \ @0 X | А  4  ä` Ǥ p ؐp ͨ  Έ 0 ϰ   @@  ? @  耐    D 鄐0 (0 괐  0  렐    쀐0 0 픐    P L@ 0 ?` `  @   8  ` ? p p T 0 x  Ԑ  0 Ȑ 0 t `   D @ t@ @ | 0 P "p "А # ) *  + / 0 0 0L` 40 5 ? 7L 7 7 : ;Ȑ0 ?0 A D@ EԐ F8 G H N  O O( O  O  Pl0 Q, Q0 SP V   V?P [|  \  ]40 ^0 _8P a< g ph` uX u u |d  ~  @ p   t0 dp  Ȑ  d d0 @ 0 0   p0 ` ؐ0 @ 4 |0  0 Ȑ  0 $0 А0   ( ؐP T  ? 0 tP ?@   P h  0 @   ?@ D?P | Ĵ0 и@ рp Ӑ   ԌP  H@  00 ܐ  ڐ 0 t ۤ  ܜ  @ ݸ@ 0  Ⱀ  ؐ0 T 䌐  0  T   `0 P  輐    , ` 픐 Ȑ ,   ؐ    ( `    $0 L ̐  d  ܐ h  4      ` 0  А  0 P `    Ԑ   <  P P   ( d  ܐ  T  ?@ (0 (?@ `       p  @ (p " #ܐ  $А % '  (?@ *  /<p 08@ 1t 4?@ 5 T@ U|P VtP X0 XА@ Y  ZP  Z [ ^ @ ^0 _Đ@ `?@ d0 e?@ fԐ  gh gԐ` jp   h 0 А  <0  DP ` L0 h@ `p $P   ,   ,0  T  P ̐@ @   P @ 0 0   0>>??<?p? @ @ A 0A@CԐ@0E, Eؐ F\0G G H`K M,OPS`T  TTV0WȐ0XH0Y ZА`\ ``0aؐ b cpd`gjjn0?pq0r0 s0st0uvDvlvvw@wwx x< x0{P0|H |0~X0t 0,0?P@x` А?PhXȐ0L0X `Ԑ0А`pX D PP |@@  0X04`````ȐpD`?@ 80Hؐ P0, , XPD0̐ p @ 0P@H ` 0d 0`` h PӀp`PP,ppp@ P  p0 p      p  `  0`?@@А?PpPP`pP P ?""#0$ $P@% %p0% & &0`&''X''(@0) P* *p`- -- .@/1D8P;>p0? ? @@ @@A` AC0 CCDL@H ILPM`N Q Qp R0eА fܐ`ghPl80lĐ0m@npqpsTtuyz@z {0P{ؐ|p}PD?P00?Pt?\?@X@@A ATAPA@B Dt?@G H HIlJJK`K LL M@ MMTĐU U`U@V WWPW W X@0YYP YАZ`]\] ^(^` ^̐ __L __``L```aaPaaab 0bĐc c0dD d e@ffPg gP ggАPh00i@jtpn no rrstvw@x y y z0z z{ؐ P`0P (0 \?P 4 А@0 `xp ?@ 0@   А 0 ؐ00 Đ̐0p0 @h``0@p    €X0$ɘ@` h0 P Ϡ0Pp` @Ӱ  P Ԡ< ܐ`֠ p4Dp`p܀ А P ݠ ހ?@ P   @␐P А䌐Ԑ Lꠐ@@@@`?@@<p00 0̐0     | А @ P  Lp` %  % &0'?@)+p`. / /2t4 55 6P6 77@78  8t090?`?? AAT0CCDPDDDE F(I|L0MpP@P Q QR RSX S T0U,Ud0W@X0Y00Y@ZܐP[Ԑ0\@]d ]ȐP_\ `0a a``bP@c cpc d` de ep@f`@h0?Pj k kP k k l@lm0mPp pLppqPqXqqqPrH%vPvw@x` xx y0zpPz {@{p {0||Ԑp~~  p @?@D  @@  PPĐ0 ` 0p `P0 @0 pP@ǐ@p`@ ΀0Ќ  `ѼP<P@ Ԥ  դ?@ @ ؠ  @ ِ Ԑ ȐА pPА `@0 䀐 `<x0``p @쬐 퀐?P`    P@p   @0Pp  `   D    `    P  ,p4 <PdpPP0Lp!D0"l`$\p+@,0`4@6?̐@A4pHP HPIPJ<JJK KPKKKLLO P$ PVАW W@WdWWPXZ  Z [ \X\ ] ]^$^D^^_$___ `| a a| b?PddP d d e@ e epg@ g@hh@0h0iijX0j0k0lD0l0m0n00n0n0oo pؐ@q0r0s@tu,@vlv?Pw xPy y`Pz` z { { {0|0 P @@00h?@0h ?@ P 0 `0$0 p@ 4p D l PL0T@А @  P   @?@  А@ H8Ԑ@ |0<$,<@ĸǜ LPxؼ 00hڠ @ؐ@ߜL ༐ D Ԑ0㰐 , 䜐PȐ0`t?`D L@Đ0dP@0@ P` p  Pؐ <0p 0  ` @ , Ȑ   `̐PH` l P!@#$ $@%p**+-.`.0/P / /0 1@?@2 2 2А@3 3 4@== > ?C^^|^_@`@bbh`ef fg|0h0jjk|l@m n@0o?`qP0r@t@u u0v?@xy0z0{P }0@}}~0 ~ ~ @  @` $`Pp`x080\`H@H0АP.shstrtab.init.text.fini.note.openbsd.ident.MIPS.options.rodata.eh_frame.openbsd.randomdata.ctors.dtors.jcr.data.rel.ro.got.data.sbss.bss.pdr pp4@@4tt1p yh?GŠŠQXX exxlووs٘٘x٠٠jDPDP;]    x@@ n . ..MAKEDEVoctcf0aroctcf0aoctcf0broctcf0boctcf0croctcf0coctcf0droctcf0doctcf0eroctcf0eoctcf0froctcf0f octcf0g!roctcf0g"octcf0h#roctcf0h$octcf0i%roctcf0i&octcf0j'roctcf0j(octcf0k)roctcf0k*octcf0l+roctcf0l,octcf0m-roctcf0m.octcf0n/roctcf0n0octcf0o1roctcf0o2octcf0p3roctcf0p4diskmap5 bio6ttyp07ptyp08ttyp19ptyp1:ttyp2;ptyp2<ttyp3=ptyp3>ttyp4?ptyp4@ttyp5Aptyp5Bttyp6Cptyp6Dttyp7Eptyp7Fttyp8Gptyp8Httyp9Iptyp9JttypaKptypaLttypbMptypbNttypcOptypcPttypdQptypdRttypeSptypeTttypfUptypfVttypgWptypgXttyphYptyphZttypi[ptypi\ttypj]ptypj^ttypk_ptypk`ttyplaptyplbttypmcptypmdttypneptypnfttypogptypohttyppiptyppjttypqkptypqlttyprmptyprnttypsoptypspttyptqptyptrttypusptyputttypvuptypvvttypwwptypwxttypxyptypxzttypy{ptypy|ttypz}ptypz~ttypAptypAttypBptypBttypCptypCttypDptypDttypEptypEttypFptypFttypGptypGttypHptypHttypIptypIttypJptypJttypKptypKttypLptypLttypMptypMttypNptypNttypOptypOttypPptypPttypQptypQttypRptypRttypSptypSttypTptypTttypUptypUttypVptypVttypWptypWttypXptypXttypYptypYttypZptypZrd0arrd0ard0crrd0ccd0arcd0acd0crcd0ccd1arcd1acd1crcd1crst0nrst0erst0enrst0rst1nrst1erst1enrst1wd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0grwd0gwd0hrwd0hwd0irwd0iwd0jrwd0jwd0krwd0kwd0lrwd0lwd0mrwd0mwd0nrwd0nwd0orwd0owd0prwd0pwd1arwd1awd1brwd1bwd1crwd1cwd1drwd1dwd1erwd1ewd1frwd1fwd1grwd1gwd1hrwd1hwd1irwd1iwd1jrwd1jwd1krwd1kwd1lrwd1lwd1mrwd1mwd1nrwd1nwd1orwd1owd1prwd1pwd2arwd2awd2b rwd2b wd2c rwd2c wd2d rwd2dwd2erwd2ewd2frwd2fwd2grwd2gwd2hrwd2hwd2irwd2iwd2jrwd2jwd2krwd2kwd2lrwd2lwd2mrwd2m wd2n!rwd2n"wd2o#rwd2o$wd2p%rwd2p&wd3a'rwd3a(wd3b)rwd3b*wd3c+rwd3c,wd3d-rwd3d.wd3e/rwd3e0wd3f1rwd3f2wd3g3rwd3g4wd3h5rwd3h6wd3i7rwd3i8wd3j9rwd3j:wd3k;rwd3k<wd3l=rwd3l>wd3m?rwd3m@wd3nArwd3nBwd3oCrwd3oDwd3pErwd3pFwd4aGrwd4aHwd4bIrwd4bJwd4cKrwd4cLwd4dMrwd4dNwd4eOrwd4ePwd4fQrwd4fRwd4gSrwd4gTwd4hUrwd4hVwd4iWrwd4iXwd4jYrwd4jZwd4k[rwd4k\wd4l]rwd4l^wd4m_rwd4m`wd4narwd4nbwd4ocrwd4odwd4perwd4pfsd0agrsd0ahsd0birsd0bjsd0ckrsd0clsd0dmrsd0dnsd0eorsd0epsd0fqrsd0frsd0gsrsd0gtsd0hursd0hvsd0iwrsd0ixsd0jyrsd0jzsd0k{rsd0k|sd0l}rsd0l~sd0mrsd0msd0nrsd0nsd0orsd0osd0prsd0psd1arsd1asd1brsd1bsd1crsd1csd1drsd1dsd1ersd1esd1frsd1fsd1grsd1gsd1hrsd1hsd1irsd1isd1jrsd1jsd1krsd1ksd1lrsd1lsd1mrsd1msd1nrsd1nsd1orsd1osd1prsd1psd2arsd2asd2brsd2bsd2crsd2csd2drsd2dsd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2jrsd2jsd2krsd2ksd2lrsd2lsd2mrsd2msd2nrsd2nsd2orsd2osd2prsd2psd3arsd3asd3brsd3bsd3crsd3csd3drsd3dsd3ersd3esd3frsd3fsd3grsd3gsd3hrsd3hsd3irsd3isd3jrsd3jsd3krsd3ksd3lrsd3lsd3mrsd3msd3nrsd3nsd3orsd3osd3prsd3psd4arsd4asd4brsd4bsd4crsd4csd4drsd4dsd4ersd4esd4frsd4fsd4grsd4gsd4hrsd4hsd4irsd4isd4jrsd4jsd4krsd4ksd4lrsd4lsd4mrsd4msd4nrsd4nsd4orsd4osd4prsd4ptty00cua00tty01 cua01 bpf bpf0 console#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { : ${mklist[0]:=";mknod"} mklist[${#mklist[*]}]=" -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 35 0 640 kmem M klog c 6 0 600 M openprom c 20 0 600 ;; switch*) M switch$U c 75 $U 600 ;; vscsi*) M vscsi$U c 69 $U 600 ;; video*) M video$U c 45 $U 600 MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; uk*) M uk$U c 32 $U 640 operator ;; tap*) M tap$U c 74 $U 600 ;; tun*) M tun$U c 13 $U 600 ;; *random) M urandom c 33 0 644 RMlist[${#RMlist[*]}]=random MKlist[${#MKlist[*]}]=";ln -s urandom random" ;; pppx*) M pppx$U c 71 $U 600 ;; pf*) M pf c 31 0 600 ;; pci*) M pci$U c 29 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; hotplug) M hotplug c 67 $U 400 ;; fuse) M fuse$U c 53 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 70 0 640 operator ;; bpf) M bpf c 12 0 600 M bpf0 c 12 0 600 ;; bio) M bio c 49 0 600 ;; audio*) M audio$U c 44 $U M mixer$U c 44 $(($U+16)) M audioctl$U c 44 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 61 $U 660 ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 usb0 usb1 usb2 usb3 usb4 usb5 usb6 R usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 66 $o 660 dialer root M cuaU$U c 66 $(($o+128)) 660 dialer root ;; wsmouse[0-9]*) M wsmouse$U c 27 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 28 0 600 M wskbd c 28 1 600 ;; wskbd[0-9]*) M wskbd$U c 26 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 25 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 25 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 52 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 17 $o 660 dialer root M cua$U c 17 $(($o+128)) 660 dialer root ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}rst$U c 10 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 36 $U 660 operator ;; vnd*) dodisk vnd $U 2 11 $U 0 ;; rd*) dodisk2 rd $U 8 22 $U 0 ;; cd*) dodisk2 cd $U 3 8 $U 0 ;; local) test -s $T.local && sh $T.local ;; ramdisk) R octcf0 diskmap bio pty0 rd0 cd0 cd1 st0 st1 wd0 wd1 wd2 wd3 R wd4 sd0 sd1 sd2 sd3 sd4 tty00 tty01 bpf std ;; all) R switch0 switch1 switch2 switch3 octcf0 vnd0 vnd1 vnd2 vnd3 R sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tap0 R tap1 tap2 tap3 tun0 tun1 tun2 tun3 bio pty0 pty1 pty2 R diskmap vscsi0 ch0 audio0 audio1 audio2 bpf fuse pppx R hotplug ptm local wscons pci0 pci1 pci2 pci3 uall video0 R video1 uk0 random tty00 tty01 tty02 tty03 tty04 tty05 tty06 R tty07 tty08 tty09 tty0a tty0b pf wd0 wd1 wd2 wd3 std st0 st1 R fd ;; octcf*|wd*|sd*) case $i in octcf*) dodisk octcf $U 15 15 $U 0;; wd*) dodisk wd $U 4 18 $U 0;; sd*) dodisk sd $U 0 9 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin build:*:21:21:base and xenocara build:/var/empty:/bin/ksh _ping:*:51:51:ping privdrop user:/var/empty:/sbin/nologin _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin _sndio:*:99:99:sndio privsep:/var/empty:/sbin/nologin _file:*:104:104:file privsep:/var/empty:/sbin/nologin _slaacd:*:115:115:SLAAC Daemon:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin  ... . ..$openbsd-64-base.puba  !n} ZU]C]_ping*33ping privdrop user/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3Mbuild*base and xenocara build/var/empty/bin/ksh3_slaacd*ssSLAAC Daemon/var/empty/sbin/nologin1_slaacd_file*hhfile privsep/var/empty/sbin/nologin1_fileID_dhcp*MMDHCP programs/var/empty/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3build*base and xenocara build/var/empty/bin/ksh1buildZLZ_sndio*ccsndio privsep/var/empty/sbin/nologin2bin*Binaries Commands and Source//sbin/nologin1binid"_file*hhfile privsep/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_file*hhfile privsep/var/empty/sbin/nologin3hrootdaemonCharlie &/root/bin/ksh3MH_slaacd*ssSLAAC Daemon/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobodyf] rm$ nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2 operator*System &/operator/sbin/nologin2operator*System &/operator/sbin/nologin3_sndio*ccsndio privsep/var/empty/sbin/nologin1_sndiooperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root TOZU bin*Binaries Commands and Source//sbin/nologin2_slaacd*ssSLAAC Daemon/var/empty/sbin/nologin3s_sndio*ccsndio privsep/var/empty/sbin/nologin3c_ping*33ping privdrop user/var/empty/sbin/nologin33bin*Binaries Commands and Source//sbin/nologin3_ping*33ping privdrop user/var/empty/sbin/nologin1_pingXJXbuild*base and xenocara build/var/empty/bin/ksh2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpa  !n} ZU]C]_ping*33ping privdrop user/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3Mbuild*base and xenocara build/var/empty/bin/ksh3_slaacd*ssSLAAC Daemon/var/empty/sbin/nologin1_slaacd_file*hhfile privsep/var/empty/sbin/nologin1_fileID_dhcp*MMDHCP programs/var/empty/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3build*base and xenocara build/var/empty/bin/ksh1buildZLZ_sndio*ccsndio privsep/var/empty/sbin/nologin2bin*Binaries Commands and Source//sbin/nologin1binhc _file*hhfile privsep/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/kshs2_file*hhfile privsep/var/empty/sbin/nologin3hrootdaemonCharlie &/root/bin/kshs3MH_slaacd*ssSLAAC Daemon/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobodye\ ql# nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2 operator*System &/operator/sbin/nologin2operator*System &/operator/sbin/nologin3_sndio*ccsndio privsep/var/empty/sbin/nologin1_sndiooperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root TOZU bin*Binaries Commands and Source//sbin/nologin2_slaacd*ssSLAAC Daemon/var/empty/sbin/nologin3s_sndio*ccsndio privsep/var/empty/sbin/nologin3c_ping*33ping privdrop user/var/empty/sbin/nologin33bin*Binaries Commands and Source//sbin/nologin3_ping*33ping privdrop user/var/empty/sbin/nologin1_pingXJXbuild*base and xenocara build/var/empty/bin/ksh2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpuntrusted comment: openbsd 6.4 base public key RWQq6XmS4eDAcQW4KsT5Ka0KwTQp2JMOP9V/DR4HTVOL5Bc0D7LeuPwA  ... ... ... . ..chowndhclient disklabeldmesgfdiskfsckfsck_ffsgrowfsifconfiginitmknodmount mount_cd9660 mount_ffs mount_msdos mount_nfs mount_udfnewfs newfs_msdospingping6reboothaltrouteslaacdsysctlumount ... . ..% bin&mdec'sbin(share% . ..doasencrypt ftpgrepegrepfgrepgzipgunzipgzcatmoreless sed0signify& . ..' . ..chrootpwd_mkdb( . ..)keymaps*misc) .(..* .( ..+termcap . .., db-empty. tmp/ run0tzlist, . ..- . .. dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E<\E>\E[?3;4;5l\E[?7;8h\E[r:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Nelson America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Punta_Arenas America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Troll Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Atyrau Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Barnaul Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Chita Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Famagusta Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Srednekolymsk Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Tomsk Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yangon Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Astrakhan Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Kirov Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Saratov Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Ulyanovsk Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Bougainville Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Nelson posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Punta_Arenas posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Troll posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Atyrau posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Barnaul posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Chita posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Famagusta posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Srednekolymsk posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Tomsk posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yangon posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Astrakhan posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Kirov posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Saratov posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Ulyanovsk posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Bougainville posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Nelson right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Punta_Arenas right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Troll right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Atyrau right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Barnaul right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Chita right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Famagusta right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Srednekolymsk right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Tomsk right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yangon right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Astrakhan right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Kirov right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Saratov right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Ulyanovsk right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Bougainville right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu . . ../ . ..