,PP@((ھ0\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx &&''' '0'@&4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H @ : <   @@: LI@@PK/mnt<@`bT @ :    @@: LI@@P^<@`bT U: (kGGA : : :1-: :1-Hv/A: >: : eA, A: : .5: .5B@s0: !: Ĵ: 8CPX`hpx S: : !`: !` h,5: v: : -LI; : ܓ: u*: -LO0D!: ;3: ;3: bZjoOa: : : (sa: W: W: ( 0a: G: G: (!: 4΀: 4΀: (6k!: U: U: (6AsnJ!: $s: $s: (6Չa: 3%: 3%:   a: 6: 6:  %7a: :i: :i:  !: bZ: bZ:  6!: : :  6Bb!:  h:  h:  6˙a: ׄ: ׄ: + ғ*a: t: t: +!'ua: e: e: +"'\S!: !: !: +6 2]!: $s: $s: +6!ٓ^!: 'c: 'c: +6")a: 6=: 6=:  X0Y'a: 98p: 98p:  X1va: : :  X26!: : :  X60g㴛!: : :  X61ln!: р: р:  X62gH!a: >: >: ) @_a: G: G: ) A7a: 8: 8: ) BK!: (: (: ) 6@@!: ": ": ) 6A0 !: % : % : ) 6BVa: 3%: 3%:  !P$Ⰹa: 6=: 6=:  !Q1a: 98p: 98p:  !R0I!: : :  !6PuF!: : :  !6Qͣ#!: w: w:  !6RE6|Ma: ܓ: ܓ: &6`ʧa: >: >: &6aa: 9: 9: &6bu!: 4΀: 4΀: &66`e6!:  /:  /: &66aa: 7n: 7n: rؽT!: :i: :i: 6pm!: 1-: 1-: 6q8(!: ,: ,: 6r} ?!: z9: z9: u*xD!: t: t: exV7! : (: (: +yW{: .}: .}: .}ss00x! : 3%: 3%: 6y?: 9: 9: 9ss1{!:  h:  h:  X|+N!: p: p: pc!: t: t: tAA!: !`: !`: !`r}v!: #F: #F: #Fc#!: *Q: *Q: *Q!: ,: ,: , !: 3B: 3B: 3B c!: 5: 5: 5׷m!: : : !: : : G !: р: р: р;!:  :  :  !: : : &C!: ܓ: ܓ: ܓ?_!: t: t: t!: e: e: e͕w!: )': )': )'(.!: ,: ,: ,.:Y!: 3B: 3B: 3B 0\@!: 5: 5: 5 KWk!: : :  c!: : :  ]&!: р: р: р 1p!:  :  :   (!: : :  ?S%!: ܓ: ܓ: ܓ w!: k : k : k  Ъ!: e: e: e hn7!: $s: $s: $s.N!: 'V: 'V: 'V,C(!: -L: -L: -LI!O!: 0G: 0G: 0G/fa: 98p: 98p: '!: :i: :i: 'n_a: À: À: '!: : : 'n߽Ra: : : '۲!: ': ': 'na:  h:  h: '~_{!:  S+:  S+: 'nT!a:  :  : '!: I: I: 'n0]8a: : : '0!: : : 'n+a:  :  : '{!: >: >: 'nP/a: 9: 9: 'w.!: k : k : 'nĘa: e: e: '_!: (: (: 'n1ca: !: !: ' s!: #F: #F: 'n Va: &6: &6: ' va,!: 'c: 'c: 'n ga: *T: *T: ' _!: ,: ,: 'n Xa: .}: .}: ' k4!: 0G: 0G: 'n Ka: 2: 2: ' Y 9!: 4s: 4s: 'n I.a: 6: 6: '!}l!: 8ـ: 8ـ: 'n6C$a: ;3: ;3: 'O!: À: À: 'nka:  X:  X:  !: N: N:  na: v: v:  (A>!: z9: z9:  n2Na: ܓ: ܓ:   F!:  :  :  nHQa: : :  m" n!: 9: 9:  n9;a: 4΀: 4΀:  4a: : : 'Viv!: Ĵ: Ĵ: 'VnFua: ': ': 'V}S!: X;: X;: 'Vna:  S+:  S+: 'V%!:  X:  X: 'Vna: I: I: 'VT!: v: v: 'Vn00a: f: f: 'V!!: ܓ: ܓ: 'Vn 9a: ׄ: ׄ: 'VSZ!: : : 'Vnq+ra: : : 'V1,!: 4΀: 4΀: 'Vn a: (: (: 'V8M&!: !: !: 'Vnl=M^a: ,: ,: 5Eq!: .}: .}: 6=n a: 05: 05: 5p!: 2: 2: 6=nia: 5 R: 5 R: 5*!: 6: 6: 6=n'/-a: 98p: 98p: 5F4!: :i: :i: 6=nhڔa: À: À: 5KlB!: : : 6=n߭a: : : 5vx|!: ': ': 6=nTfa:  !:  !: 5כ!:  S+:  S+: 6=n׼Da: N: N: 5!!: I: I: 6=na: : : 5 !: f: f: 6=n2a:  :  : 5x!: ׄ: ׄ: 6=n]Ta: 9: 9: 6=VT!: : : 6=nE2a: e: e: 6=q!:  /:  /: 6=nb@ٝa: ": ": 6=~!: #F: #F: 6=nÃa: &6: &6: 6=7B}!: 'c: 'c: 6=n=mua: *T: *T: 6=f!: ,: ,: 6=n}qa: /q: /q: 6=Bt/!: 0G: 0G: 6=nRa: bZ: bZ:   pJdJ!: : :  n -a: w: w:  ! c!: : :  n!a:  :  :  "!:  :  :  n"ca: 沀: 沀:  #2!: ߀: ߀:  n#CJa: z9: z9:  $XoƐ!: C: C:  n$T^a: W: W:  %F!: p: p:  n%ZjQa: t: t:  &( !: 8: 8:  n&dQa: : :  '!:  U:  U:  n'3a: #*: #*:  (]b!: % : % :  n(pa: (: (:  ) ffL!: )': )':  n)Ga: ,: ,:  * x!: -D: -D:  n*%_b|a: 0G: 0G:  +!: 2b: 2b:  n+Ea: 4s: 4s:  ,) (!: 6=: 6=:  n,a: 8ـ: 8ـ:  -M!: :i: :i:  n-ja: 1-: 1-:  .^y !: : :  n.X:a: ]J: ]J:  /#ZBK   . .. binmdecsbinshare . ..termcap . .. bin dev etckern mntmnt2sbin tmp usr varinstbin install.subinstallupgrade bsd.profile? 4 install.md4bootۀ echo _i=0 resp="X" while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case "X${resp}" in X/*) _mount_points[${_i}]=$resp break ;; Xdone|X) break ;; Xnone) _mount_points[${_i}]= break;; *) echo "mount point must be an absolute path!";; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out _i=0 while test $_i -lt $_npartitions; do if [ -n "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= fi _i=$(( ${_i} + 1 )) done rm -f /tmp/fstab.${DISK} done echo echo "You have configured the following devices and mount points:" echo cat ${FILESYSTEMS} echo echo "============================================================" echo "The next step will overwrite any existing data on:" ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo echo -n "Are you really sure that you're ready to proceed? [n] " getresp "n" case "$resp" in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP, HTTP, or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) donetconfig ;; *) ;; esac if [ "`df /`" = "`df /mnt`" ]; then # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab # XXX We no longer do the following. It is not neccessary. It can be done # XXX after the install is complete. # # echo "The fstab is configured as follows:" # echo # cat /tmp/fstab # cat << \__fstab_config_1 # #You may wish to edit the fstab. You may also wish to take this opportunity to #place NFS mounts in the fstab (this would be especially useful if you plan to #keep '/usr' on an NFS server. #__fstab_config_1 # echo -n "Edit the fstab with ${EDITOR}? [n] " # getresp "n" # case "$resp" in # y*|Y*) # ${EDITOR} /tmp/fstab # ;; # # *) # ;; # esac # # echo munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow "-o async" fi mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done resp= # force one iteration echo echo 'Please enter the initial password that the root account will have.' while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_password}" stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp -n "" stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done md_questions install_sets $THESETS # Copy in configuration information and make devices in target root. echo cd /tmp echo -n "Copying " for file in fstab hostname.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "$file, " cp $file /mnt/etc/$file rm -f $file fi done echo " ...done." if [ -f /etc/dhclient.conf ]; then echo -n "Modifying dhclient.conf..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link." else echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." exit fi echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / remount_fs /tmp/fstab.shadow md_installboot ${ROOTDISK} _encr=`echo ${_password} | /mnt/usr/bin/encrypt -b 7` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 populateusrlocal test -x /mnt/install.site && /mnt/usr/sbin/chroot /mnt /install.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 stallboot ${ROOTDISK} ) populateusrlocal test -x /mnt/upgrade.site && /mnt/usr/sbin/chroot /mnt /upgrade.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0  ɬ  @D, @' "$ሜ+#@  /@Z / "%8 %8 @<@`@g`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h! Р!$   Ŗ ?$   `"!      ؐ        ?@ ?# @! ?a ?@ ?# @ `     | ??"  #\@ #`?# @!  3 @@! -? ?c@  ̀@ ! @ ̀@? ?c@ ! @   @! @     #d#h  Ŕ  ( ? $ ( !    ?#\#`ؔ@ ?# @!   a ?@  ?#  ?FB?? ?# ! 2 ?1@! ,? ?c@  ̀@2 ?@ ̐ ? ?c@ ! @" @! @2 #?:  ?# !  ?/ @! )? ?c@  ̀@ ? @ ̐ ? ?c@ ! @   @! @   #d#h   Ř u ?  ( o  l 䀣 !  #\܆    #d#h`#`  R ?2  " ( L  I  "a8 $ $ $ $  ` ?2 @  !1 `  ?2   h %  "  "!`@9"㿘!€ 㿘!쀢``@?㿘!€ 㿘! ?Service unavailable㿐!쀢     ?1 !P  @ *`:` J " %s: %s not compiled in instbin㿘@.I@ J 2@@F@@G /  @ @`"@W 2   €   a@=j!@!㿘 ?@?Œ`Usage: %s ..., where is one of: %s㿘  c@=@!`@ `@) + @d@  O4@=-#P@@=(cX`@ @= #P@d/ hostnamedmesgexprmvsleep-shshkshsedmkdirmtshutdownstringsrmtipmount_kernfsgetoptmount_mfsnewfsinitsortfsckfsck_ffschrootchflagschownchgrpchmodgzcatgunzipgzipcutcpedhaltrebootffsmount_ffsdhclientftprouteinstallbootslattachmknodrshumountbasenamefgrepegrepgrepnfsmount_nfsmorelessresettsetsumcksumsysctllsifconfigcatpingcpiotarpaxdisklabellnsttyvibuildsyncmountnetstatdfcd9660mount_cd9660dd㿘@!0505,/7/5H/5t@@/5/5/5/5 /6@@/6$skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈 "b"`#"  #쀢 $a%C+) 5 7 / - 3 @ $@א @[ = 2,a @ΐ  L aa8@Ő  ' @6Ϙ x @  "`X@  €$x  $x`@"@ $xx` @ @ x` `@ "` `@~ c!< !"@!   !<$x%c `@b "` " `@Y  %c"  c` % a@H  ? @+ג  2` $ 8 `  @+ƒ`   `$   aX @?㿘@@㿘@"b "㿘@"b㿘@쀢 "bH@ 㿘@"b(㿘#x`@"b  (㿘#x`@"c 㿘@:㿘@:07 &77 '7 (7777p #7` $7X %7P7H7@7870unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 ,'D) % !' # 1D@#'@  @5V @> x`"`c@5 ` `"x&#|D ߐD㿘@@%s%s: illegal numeric value%s: %s㿐@ ?2!`@: 2J!`@ `k`m`b". `w . . . 8 'J`x 4쀢``*2 @V"!!!@ʐ "@ !`@ 㿐 @    !`@ڐ 2K!`@  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @" 'J`x 4#쀢`%`*2  @, @!!!@H "@@ !`@; 㿘#|쀣 b  "@    *b``$   $ @   $`$` 㿘!?`$)"  "     """ "  "@`"@ ""?"`"`%"# "@ "P '`@8#|    +@ `  0 +@`    "`*`"` " "`?"` |   @_O" *#` " "` %` "  "`? "`  "` ? %"`#`` ` $` $`@: ` `"" @ " 㿘"` %!P#` "@ "@_ٔ c| `` `   ! "@^" " "㿘#|+쀢b ??   @? ?,@ b@ <b#   @?*" ?   " " " @_@$$ $*@` $@  @ " % b   b@_c"@ b  $ %s: short input record㿘b  2  @'"xb  %   b ? *b "?b $  `@_.``@$`$` `"* "㿘@'@53`@\ `@\ @2#<b(@Wb(??&b(@@^4 stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘"   #$  $ @,3 $  `@] @"(`   `@ #   8 $ $ ')cx# "& @,! $ #x" & @+! $ `$ ` ` @`@#x @2`` @Z ? $`@@ $! "@*"@Y@  $`"@Y@ $`P@ `$"`$ ` " @  $@#x@#x  #x   @)ǔ     @~ #x"@L쀊`!&b x| *  +@ ( 5x x| *  +@ ( $x x  *  +  x x  *  +  x |p@ @T_` h `@e <     a@[     @\Y ?   "!`  & 㿘 )b#"P/1"H"P` #x -쀊` @\` @\`  @[f  h$ 6. x$2   @   @\@I  x      @\ @x @Hx``$` "P@  $`%"P  x $ "P@  $ %"P $  $  $ ` %`x` `@w&`$`@@ `"`` %``@*5`` 〒@€$`x㿘c @^!<@  䀢@#x !#`#@  " @\  #@\ #`"`# `@ %s: end of device%s: short write on character device%s: short write on tape device㿘# #``#35/+-  ?# #`   2 `` "@v`#` "$` @@ZU bP "@ !` @ bP  > B; Ǥ@2   # #  " &   #   #@\X"@ #  & %u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld secs (%qd bytes/sec) @Ɛ bP` " ' '``` P#\ d@ @[ @YԒ`""" d@ l@[ @YP """ d@ V@Z @YP !<`#@$ʒ#\#` d@ =@Z֐@Y 㿘! "!$!㿘@Z %sskip reached end of input㿘b 2   @'1     @Z7 ?CAa@&  9 +-@Yi  "  &!D?D? b( ?"b(@ː #xd @La9 a@ 㿐#      @&֔      @Yܖ ?vt a@ː   $  '7a@Y' c a@    X $ Tc c@X  4A6  a@   7 'a@X? a@  D 4c, $ (cc @X    a@v  D 4c $ c0  D4c $c㿘@`VUUUUUUUUUUU Uupdateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %s @#: '+) "'%/5 0* c@€    !@ @w@-??ሓ* & @ @h@?` '' ' '''@В  "!`-b @~p bH@ @YB VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVusage: mount_cd9660 [-egjR] [-o options] special node 㿘`@1!@X ,-o %s: option not supported㿘@-  @D 1' n L  o  @  = 2*`"@0 2   @2    &*@&`@}  @ؠ 2L@U0㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@"5%!';/-+ ")+9 $&* h@€ $ $# $ܐ $#$ؐ 'cА %Ԑ "cP b@@}f @a@L@+Ɣ"0?Ґ?!ܑ*@` & cȀ @Ȑh@4@r  2@b@r  !@ Y@0@ `R' @@&%  @@ @@"=`< @ @2 @@@@ 2-`%a@͒@ !cЀ  @@@w`@z D 2 ab@@iD` @@n"`@  @`  @W 4?a` $ Ȁ @˔0@d@W [[[[[[[[[[[[[[[[[[[[[[[[[X[h[[t[[[[[[[[[㿐@qg  @6  @+ ` T@! 㿘 P  c`?  #@     2c@ empty type list㿘 N  nc@|L  N  o "c "# %  @  , ` @Sd*  $P @` $@ , `$@  @  , 2*@, $@㿘#Д` P` #Ԁ` @pג ., ' D#Ѐ @"!s #Ԁ`@U! T@a!!&X' 4 ` hB) p xB  B  B  ࠁ B : 0B %5.0f%cBKMGTPE %5.1f%c㿐?? B@ސ#0  # J  #@ђ 0# J  #(@ɒ 㿐 '  B B? ' B?  D?%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s 㿐  @ `#   " F `  h@6 @L@K  @L@KT ` @ @Lt@Kɐ @Ll@K@` @ @L`@L]  @LX@K, @8 x' `ȍB'`ЅD?@  @ c܀ (   `"@ ' ȍB'``ȉBЉ B?@  @ @  @ T Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐#؀`#H@U'#Px@#` #$'@T'@ry#x@#܀`"@#@#؀` !1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5d%% %s 㿈#` $!"@T!x@H`l T  " ,` d* @KK* @;[@@Tu!P` @6 @K7@J  @K-@J ` @6 @K!@K #\@K@I#\  @  @K @K  #` @K@I#`#h#d@a!ᨁ㿘@"s @"?@\ @  @  ?  df: %qd: %s 㿘 @S@R” "!!`   @2@,  usage: df [-hiklnP] [-t type] [file | file_system ...] 㿘`@,ؐ!@S ffs㿘#А  F\!T@"&<?4&0&(& 8@IA̘ d &<(#  ; @ <  @v d$"@&@I,,?&Ȑ&& ;&$ !(T@Tk Z@Tg Za0D@a .S lfs㿘#cА f c!b@"&F?  d& &   "@ 2 &    $"@ 2 & T @H" @Ib d& $ 8 &  " : && (& d@H $&& &$ߐ "pT@T Z@T  ZbxD@ .S ext2fs㿘-А $ $  ;`8#S@I?`L (&C?`$*&`4 * &@I`(``` $@I4 ?@H`@Hz$& ` &`"@ &&`& &&$ #T@S Z@S ZcD@ .S 㿘@*ɔ$OpenBSD: if.c,v 1.21 2000/10/23 19:17:08 mickey Exp $ifnet: symbol not defined %-7.7s %-5.5s %-11.11s %-17.17s %8.8s %5.5s %8.8s %5.5sNameMtuNetworkAddressIpktsIerrsOpktsOerrs %5sColl %sTimeDrop%-7.7s %-5ld %-11.11s none%-15.15s %-17.17s %-*.*s %25s %-17.17s %25s %-*.*s %xHipx:%-8s%-17s atlk:%-12s%-12s ns:%-8s (%d)%x%c%8lu %5lu %8lu %5lu %5lu %3dx`@ِ!0& "@0 @,Ô  08@b#\#`#d" b(@!bP@"H#`  "X@b`:`p  "X@bh ``?"`  * % @앐 `٢ `%P@,w Ϡxd@9~ "#T/`T@ ` @` *,@`,@\"p@`x`!"@W""@Sx/@,A  " ``* ,*` €!"@6""@>#8`  @Qp  @Qk ! @"@>48` @QZ  @QU  "@a %/ !#!P@+ $@>Pb@"d P`? ?  '#8` $`$`,` ,` @>8` @Q  @Q ! @Ő"@?88` @Q  @Q  "@a /0 #% @+ ,( @o .8`  @P  @PېؒbЖ @  ? `* * @' `* `* `* @@A@j"!#@@A!# @D4@\!# @D,2?`# `*` '7 @@AҐ@># !#@?ېc0@3" ```2 ` `! "@C@@"/G/  @ `@#8 @ @ /@ 8L@ "8 ? #@ @ `  .@? " ?  `?`$``@  * % @ ?H@`W@͐#h`p @Ɛ#h ` ?"` * % @ `.`Qvzv(zzzyzzzzzzzzzy`zzzzzzxwD(%s)%s: %s: unknown interface input %-6.6s output input (Total) output%8.8s %5.5s %8.8s %5.5s %5.5s packetserrscolls%5.5s drops %8.8s %5.5s %8.8s %5.5s %5.5s %5.5s%8ld %5ld %8ld %5ld %5ld %5d %8d %5d %8d %5d %5d'DH@*<  "#T5Ha 'DxP D)d'9P5 -:+;@-   @ԖT`"`(@] "`(@ T @*  2 " 8cT!@(h`@Ow @Mؐ #D@w*`@!$ *` *  *  *  :   p @@`!o@ `&`&`&`&`&` &`$`(@*&```?"`` * %`@ː !8(0a@p`@@H!$ *` *  *  *  :   P @ p ap@H``?"`` * %`@鉐 @Cǐ` D`$ $ $ $ $ $ $I!@)f C @`x" `" `# `#@ ` @Z p`a`$@R" &`&`&`&`&` &`$  $ `  $ `  $ `  $ `   $ `$ $@T$ $`( @ !$ *` *  *  *  :  a "  "  #  #@   @ p`a $$@" ``?#`  $ $ $ $  $ $ $ $ $$ $$` * %` @ @C#`@v# 耢 @v @v#D@vS*耥 DL`# ($OpenBSD: inet.c,v 1.48 2000/06/30 20:04:01 itojun Exp $TIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSED㿘@V 㿘@O tcp??? Active Internet connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p 6%-5.5s %6ld %6ld %d %s㾘 'L!@ea`?@( !!'9!7!5!L0 3 a!3!a  #X @L' # ``@' `d#D@' !#ꀢ`@%"!@!a`!@ސ!0`` ?"``* $`@ؐ "#``!!#\!a!!!#`aH!#d#h  !@$!!a!a!#\!@$`  `d@  @! @(!b@ `\!`8"@a ^L@V \<@V  `X@ 4 \H@ / `#bD`* 2` :!" @a: `T!@Y"(`` ?"``* $`@S   (@'8 4@)!@>!%s: %u packet%s sent %u data packet%s (%qd byte%s) %u data packet%s (%qd byte%s) retransmitted %qd fast retransmitted packet%s %u ack-only packet%s (%u delayed) %u URG only packet%s %u window probe packet%s %u window update packet%s %u control packet%s %u packet%s received %u ack%s (for %qd byte%s) %u duplicate ack%s %u ack%s for unsent data %u packet%s (%qu byte%s) received in-sequence %u completely duplicate packet%s (%qd byte%s) %u old duplicate packet%s %u packet%s with some dup. data (%qd byte%s duped) %u out-of-order packet%s (%qd byte%s) %u packet%s (%qd byte%s) of data after window %u window probe%s %u packet%s received after close %u discarded for bad checksum%s %u discarded for bad header offset field%s %u discarded because packet too short %u discarded for missing IPSec protection %u connection request%s %u connection accept%s %u connection%s established (including accepts) %u connection%s closed (including %u drop%s) %u embryonic connection%s dropped %u segment%s updated rtt (of %u attempt%s) %u retransmit timeout%s %u connection%s dropped by rexmit timeout %u persist timeout%s %u keepalive timeout%s %u keepalive probe%s sent %u connection%s dropped by keepalive %u correct ACK header prediction%s %u correct data packet header prediction%s %u PCB cache miss%s %u SYN packet%s received with same src/dst address/port p F"@"@%!(`!"3!`` !""@%@  @!"3!``4 !"" @%@%@p  (,@!"3!``40!""H@%o(@%k,@S04 03!`` 80%"x@%U @?8   !"3!``4 @!""@%?@)@`!"3!``4  max ip packet size %lu tunneling packet%s that can't find gif ( ǒ@  p""@  !(3!``4 !("@ $@ !(3!`` !("(@ @(3!``4("H@ (3!``4("p@ (3!``4("@ג (3!``4("@ʒ ؀(3!``4("@ (3!``(#@  !(3!``4 !(#(@@ !(3!``4 !(#H@@耦 !(3!``4 !(#x@@} !(3!``4 !(#@@lȀ !(3!``4 !(#@p@[ !(3!``4 !(#@_@J !)3!``4 !) @N@9 !)3!``4 !) 8@=@( !)3!``4 !) X@,@ !)3!``4 !) x@@ !)3!``4 !) @ @䀦 !)3!``4 !) @@Ā !)3!``4 !) @@Ӓ܀ !)3!``4 !)! @א@’̀ !)3!``4 !)!P@Ɛ@Ѐ !)3!``4 !)!x@@Ԁ !)3!`` !)!@@쀢)3!``)!@  !)3!``4 !)!@@q !)3!`` "@v@aaddress mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceededrouter solicitationrouter advertisementecho#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %lu call%s to icmp_error %lu error%s not generated 'cuz old message was icmp Output packet histogram: %s: %lu %lu message%s with bad code fields %lu message%s < minimum length %lu bad checksum%s %lu message%s with bad length Input packet histogram: %lu message response%s generated ؐ 8@ ""@8 !+3!``4 @!+"@@@ !+3!`` !+"@@! D)+'+    `"@t#0 P@o?  2!+3!``4 !+#`@p@[ !+3!``4 !+#@_@J !+3!``4 !+#@N@9 !+3!`` !+#@=@(! )+'+    `"@# P@?  !,3!``  @@ %lu message%s received %lu message%s received with too few bytes %lu message%s received with bad checksum %lu membership quer%s received iesy %lu membership quer%s received with invalid field(s) %lu membership report%s received %lu membership report%s received with invalid field(s) %lu membership report%s received for groups to which we belong %lu membership report%s sent p @| $""@Ѐ !,3!``4 !,"@@sԀ !,3!``4 !,#@w@b؀ !,3!`` !,#H@f@Q܀,3!``4,#x,#,# @< ,3!``,#,#,# @' 䀦 !,3!``4 !,#@+@耦 !-3!``4 !- @@쀦 !-3!``4 !- P@ @ !-3!``  @@localhost0.0.0.0%ldPc?`q'  ?  -?#c/@u#h @B  <-#x@ < o'7ab'  2@! [''`#\@ 0 8  c耢 ``€ 0A#耢 "(`+--@=V  #c$%c4 $ @ "# @ @"$  `$`@# . 2  2 "  2  %.*s.%.8s*%d[%.8s]%d %-*.*sH"#`.!`  '4Ḁ " @b P@א@H Ḁ  .`2  @p  ?.`2 `?.%a.!@ %`Ḁ 2?!a@6     .?% @ `?.% @4 `   .!@ה %s%u.%u.%u.%u㿈aЀ %4 G "aЦ 0@F! 2 ,0@ڒ . @H`,0 .  *'@?e@?'  `@@  2`2 @uƔ  "@ . `0@` ",@` `!.#@$ 2# !.#@ 2# `2`2`.#\2` `#@  2# %u input AH packets %u output AH packets %u packet%s from unsupported protocol families %u packet%s shorter than header shows %u packet%s dropped due to policy %u packet%s for which no TDB was found %u input packet%s that failed to be processed %u packet%s that failed verification received %u packet%s for which no XFORM was set in TDB received %u packet%s were dropped due to full output queue %u packet%s where counter wrapping was detected %u possibly replayed packet%s received %u packet%s with bad authenticator length received %u packet%s attempted to use an invalid tdb %u packet%s got larger than max IP packet size %u packet%s that failed crypto processing %qu input byte%s %qu output byte%s @ 7@ X""@Ȁ/3!``4/!@z ̀/3!``/!@m !/3!``4 !/!@q@\!/3!``4 !/!@`@K쀤!/3!``4 !/"@O@:!/3!``4 !/"@@>@)!/3!``4 !/"p@-@!/3!``4 !/"@@!/3!``4 !/"@ @!/3!``4 !/#@@!/3!``4 !/#H@@Ԓ!/3!``4 !/#@ؐ@ÒĀ!/3!``4 !/#@ǐ@Ѐ!/3!``4 !/#@@耤!03!``4 !0 @@!03!`` !0 P@@܀ 3!`` %0@ @k䀒 3!`` %0@n @X %u packet%s were dropped because of no interface/bridge information %u packet%s dropped for other reasons %u input ethernet-in-IP packets %u output ethernet-in-IP packets h @ 0""@Ȁ!/3!``4 !/!@!@ ̀!/3!``4 !/#@@Ѐ!13!``4 !1!@@Ԁ!/3!``4 !/"@@ْ؀!13!``4 !1!@ݐ@Ȓ܀!13!``4 !1"@̐@!13!`` !1"0@@쀒 3!`` %0@ @ 3!`` %0@ @ %u input ESP packet%s %u output ESP packet%s %u packet%s with bad encryption received %u packet%s with bad payload size or padding received @ P@B X""@J̀!23!``4 !2!@N@9Ѐ!23!``4 !2!@=@(!/3!``4 !/!@,@!/3!``4 !/!@@쀤!/3!``4 !/"@ @!/3!``4 !/"@@@!/3!``4 !/"p@@Ӓ!23!``4 !2!8@א@’Ā!/3!``4 !/"@Ɛ@!/3!``4 !/"@@!/3!``4 !/#@@!/3!``4 !/#H@@~Ȁ!/3!``4 !/#@@m!23!``4 !2!h@q@\Ԁ!/3!``4 !/#@`@K耤!03!``4 !0 @O@:!03!`` !0 P@>@)܀ 3!`` %0@+ @䀒 3!`` %0@ @ %u total input packet%s %u total output packet%s %u packet%s with possibly spoofed local addresses %u protocol family mismatches %u attempts to use tunnel with unspecified endpoint(s) h @ 0""@Ȁ!33!``4 !3"@Ő@̀!33!``4 !3#@@Ѐ!/3!``4 !/!@@耤!/3!``4 !/"@@}쀤!33!``4 !3#0@@lԀ!/3!`` !/#@p@[܀ 3!`` %0@] @G䀒 23!`` %0@I @3!33!``4 !3#h@7@"􀤠!33!`` #@'@$OpenBSD: ipx.c,v 1.7 2000/10/23 19:17:09 mickey Exp $dropresponduseroutputinputspx??? Active Internetwork Packet Exchange connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld %-22.22s %-22.22s %d %sX 'H4c@ڐ`?@ 4:#ظ`8'ܨ 7454!`    # #  `@k  0p@d h!!ꀢ`D'"4@f# `4@`#P ` ?"` * $ @Z "#``4#44c44#\#h#t#hc#`#d#l#p#x  @6%a444#c4#\㠔@(%a` 5 0`@ ` 85 \H@ @5@0@?5@ `@p ` 5@ P  *`T5@ X ` ?"` * $ @ ܀@ : @Ԕ \ @Q4@ڐ#%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  @Y 5#@aW* !5#5#c@i55#@OcW4 !5#5#c@W55#@=cW* !5#5#c@E65 @+cW, !5#5#c@365 @cW. !5#5#c@!65 8@cW0 !5#5#c@65 `@cW2 !5#6#`@65 @cW8 !5#6#`@65 @њcW6 !5#6#`@ِ65 @c< !5#5#c@ǐ65 @c@ !5#5#c@65!@cD !5#5#c@65!@cH !5#5#c@65! @wcL !5#6#a0@65! @ecP !5#5#c@m65!H@ScT !5#6#`@[65!h@AcX !5#6#a@I65!@/c\ !5#6#a@765!@c` !5#5#c@%65!@ cd !5#6#a@65!@ch !5#6#a@65!@cl !5#6#b@65!@՚cp !5#6#b @ݐ65!@Úct !5#5#c@ː65"0@cx !5#6#bH@65!@c| !5#6#bX@65!@c !5#6#bh@65!@{c !5#6#bX@65"x@ic !5#6#bh@q65"x@Wc !5#6#b@_65!@Ec !5#6#b@M65!@3c !5#6#`@;65"@!c !5#6#b@)65!@c !5#6#b@65!@c !5#6#c@65#@c !5#6#bH@65#(@ٚc !5#6#`@65#8@ǚc !5#6#cP@ϐ65#8@c !5#6#`@65#X@c !5#6#`@65#x@c !5#6#`@65#@c !5#6#c@65#(@mc !5#6#c@u65#(@[cĀ !5#6#`@c65#@IcȀ !5#7#`@Q75 @7c̀ !5#7#`(@?65#(@%cЀ !5#7#`@@-65#(@cԀ !5#6#`@75 X@c؀ !5#6#cP@ 75 p@c܀ !5#6#`@75 @ݚc !5#7#`@65!@˚c䀦 !5#7#`@Ӑ65!@c耦 !5#7#`@75 @c쀦 !5#7#a@65!@c !5#6#cP@75!@c !5#7#a(@65!@qc %ld %s%s%s smaller than a header smaller than advertised with bad checksumsh 8@E ,5#@MԀ !;#6!8`@U;@=!HЀ !;#6!8`@E;@-!`̀ !;#6!8`@5;@!㿘a*`  *` *` *` *` *`  *`  *`  *`  *`  *` @"*`$OpenBSD: iso.c,v 1.7 1998/02/27 12:07:36 deraadt Exp $%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀 -@   (;@#8;@#@;@#`;@#;@#;@~#;@z#<@v (<@r P%s: %d total packets sent %d total fragments sent %d total packets received %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀 D@ Ԕ! ? <@ِ!0<@Ր!P<@ѐ!p<@͐!<@ɐ!!<!@ Ր@<@"<@"0<@"`<@"<@"4<@"8<@"<<@#(%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀 "@ w  != x@ @w!= @ @n!= @ z@e%s control block: symbol not in namelist tpprev %p next %p isop_prev %p isop_next %p??? 耦 ==!h@@0Ga@y 2 H@S0==!@/06@  0!!@0 !@&'#!@  `ߔ ` @ @^ ` ?"`* "@ Active ISO net connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld () *.* x" `N!"=@#a =@#8`?"`਒ * "@˘ "#``==== 㰞====#\#h#p#t#x#P〘#c#`#d#l@p $b =======#\#Ȓc㘘#@^c$b #`  !#  =c@P   \>= 8 @Ha`4 a  >a@D>@: `!` l>@/ (`!3`l#@/ # #@  #@֒ `4 `΀  >`@>@ 0!` >@ (0!:` x@/i  x  x@   x@ undefined tpcb state: %p %d %-12.12s㿈 @ Ԑ*`@, h@ ʒ*` ^ ->+#)'>`N4  @ ! `@(!`2    8 6 5 `@   `  @4 !@     `*`>@#H@P` ?"`* "@ʂ  * @*%8lx tpip4`$ @ Z@a  "p<@/M'< "#``"#?!0@R#``\>`8 ?@Ia8!=!vpt`TP not configured 㿘 ?@0"0 ;@,#8!"ؒ!@ @u %*sReceiving: %*s%ld variable parameter%s ignored %*s%ld invalid parameter code%s %*s%ld invalid parameter value%s %*s%ld invalid dutype%s %*s%ld negotiation failure%s %*s%ld invalid destination reference%s %*s%ld invalid suffix parameter%s %*s%ld invalid length %*s%ld invalid checksum%s %*s%ld DT%s out of order %*s%ld DT%s not in window %*s%ld duplicate DT%s %*s%ld XPD%s not in window %*s%ld XPD%s w/o credit to stash %*s%ld time%s local credit reneged %*s%ld concatenated TPDU%s %*sSending: %*s%ld XPD mark%s discarded %*sXPD stopped data flow %ld time%s %*s%ld time%s foreign window closed %*sMiscellaneous: %*s%ld small mbuf%s %*s%ld cluster%s %*s%ld source quench %*s%ld dec bit%s %*sM:L ( M mbuf chains of length L) %*s%ld: over 16 %*s%ld: %d %ld: %d %*s%ld EOT rcvd %*s%ld EOT sent %*s%ld EOT indication%s %*sConnections: %*s%ld connection%s used extended format %*s%ld connection%s allowed transport expedited data %*s%ld connection%s turned off checksumming %*s%ld connection%s dropped due to retrans limit %*s%ld tp 4 connection%s %*s%ld tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d %*sTpdus RECVD [%ld valid, %3.6f %% of total (%ld); %ld dropped] %*sDT %6ld AK %6ld DR %4ld CR %4ld %*sXPD %6ld XAK %6ld DC %4ld CC %4ld ER %4ld %*sTpdus SENT [%ld total, %ld dropped] %*sRetransmissions: %*sCR %6ld CC %6ld DR %6ld %*sDT %6ld (%5.2f%%) %*sXPD %6ld (%5.2f%%) %*sE Timers: [%6ld ticks] %*s%6ld timer%s set %6ld timer%s expired %6ld timer%s cancelled %*sC Timers: [%6ld ticks] %*s%6ld inactive timer%s cancelled %*sPathological debugging activity: %*s%6ld CC%s sent to zero dref %*s%6ld random DT%s dropped %*s%6ld illegally large XPD TPDU%s %*s%6ld faked reneging of cdt %*sACK reasons: %*s%6ld not acked immediately %*s%6ld strategy==each %*s%6ld strategy==fullwindow %*s%6ld duplicate DT %*s%6ld EOTSDU %*s%6ld reordered DT %*s%6ld user rcvd %*s%6ld fcc reqd B㿀%'??bp@@!?"@@`!?"@@` !?"@@`!?#@@Ր`!?# @}@ɐ`!?#@@q@`$!?#p@e@` ?c@`!?#@R@`H!?#@F@`L!?#@:@`X!@ @.@z`P!@ (@"@n`T!@ H@@b``!@ p@ @Va!@ @@J@`@D`D!@ @@8`@!@ @@,`\!@!@Ԑ@ @a8@a !@!P@@a$!@!h@@a@a@a!@!@@@a@@a(aؖ@a( %@/A, @, @ , #`#\@іb  $, alb@b@Đat@b @ap!@@f"8@@bX@`,!@@T"p@`0!@@H"@`4!@@<"ؔ@`!@@0#@{a|!@@$#@@oax!@@#`@c@c@]A`0A @#\#`@AAc ` @Maa"   b#d#\#`P@; `dA`h  `b' " BB`,'􀢠"" Bą"?  `<#`#d#\@ `#A``Ħb`̢`#\#`@`!A` `Ȗ`#\`#`#d@`lA`8a8@````#\#`@ِ````#\`#`#d@̐Aah@Ɛ`tA`|a`x#\@`A` a'  BB`,' "" Bą"?  @#\`A`ab' b BB`,'􀢠" Bą"?  @l#\`ԢbAaؖ@c`@ 'A`@ `@+A`ܔ#h`ؚ#``#\#d@K`Ab@@D`@b``@1A`@"`#h`#``#\#d@,`)A@Ր@!Ab@a"@Đ@a-A@@a@@aAc @Ac@@aAcX@aAcx@ߐaAc@ؐaAc@ѐaAcЖ@ʐaAc@ÐaB`@BaĐ`@{}[]<>㿘 E@J   2    2   "   >`  @7 2   "   E ` @ @&   E `   @ @ @`?"``਒ * "@ %s㿘@ $!8@ "( .@*`  :  ** *@ *@E(8#8*@~*$OpenBSD: main.c,v 1.23 2000/06/30 23:32:14 itojun Exp $_mif6table_mf6ctable_mrt6stat_ip6_mrtproto_pim6stat_ipsec6stat_ipsecstat_icmp6stat_ip6stat_etheripstat_ddpcb_ddpstat_ipipstat_espstat_ahstat_ipx_errstat_spx_istat_ipxstat_ipxcbtable_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatetheripipencapespahigmpicmpipudptcppim6icmp6ip6spxipxns_errsppidpesisclnpcltptpddpAadf:gI:ilM:mN:np:rstuvw:inetinet6localunixnsisoencapatalk%s: %s: unknown address family %s: %s: unknown or uninstrumented protocol %s: kvm_open: %s %s: %s: no namelist %s: no namelist %s: no stats routine 㷘@'D"   "#\# "'9;4947#5#-#1F 8I* 8@€ ""c` " :"`pFa@ެ F $\a@ޣ F $\a@ޚ wFa@ޔ qFa@ގ0 F v$\a@ޅ F m$\a@| F d$\a@sȀ F [$\a@jЀ  R$\ 8Fa!@c@'  :E"aa "$`?"T <$` 9'`7a 43"` 1a .'!@@a    8Fa!@Zc@'i #"< #"b3` "` &  $\  &8@a %@$`@uD@ٔ#x?K?a* @@L @ `" @@א %@#!/bin/sh # $OpenBSD: install.sh,v 1.74 2000/06/16 03:19:42 deraadt Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN= # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" if [ "`df /`" = "`df /mnt`" ]; then # Good {morning,afternoon,evening,night}. echo ================================================== md_welcome_banner else echo "You seem to be trying to restart an interrupted installation!" echo echo "You can try to skip the disk preparation steps and continue," echo "otherwise you should reboot the miniroot and start over..." echo -n "Skip disk initialization? [n] " getresp "n" case "$resp" in y*|Y*) echo echo "Cool! Let's get to it..." echo ;; *) md_not_going_to_install exit ;; esac fi echo "You can run a shell command at any prompt via '!foo'" echo "or escape to a shell by simply typing '!'." echo # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. if [ "`df /`" = "`df /tmp`" ]; then md_makerootwritable fi # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` if [ "`df /`" = "`df /mnt`" ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __get_filesystems_1 You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __get_filesystems_1 if [ "${DISK}" = "${ROOTDISK}" ]; then echo echo "The following partitions will be used for the root filesystem and swap:" echo " ${ROOTDISK}a /" echo " ${ROOTDISK}b swap" echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done"#!/bin/sh # $OpenBSD: upgrade.sh,v 1.15 2000/05/12 06:02:13 deraadt Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK= # filled in below trap "unmount_fs -check /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp= # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp= # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets $THESETS # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab with ${EDITOR}? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" test -d /mnt/etc/mail || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << \__rc_edit 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __rc_edit fi echo -n "Making devices..." cd /mnt/dev sh MAKEDEV all echo "done." md_in (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx@HPX`hpx @X $``@  ``  @P@PM@P@P9  @<:  "` 8G!`(@@' @P@P1@P@P:b@h  ` 4   8G!`@@Җ0 8G!@˒`X@&ڐ  #@`@&Ґ b<   ` * @*`  0G @|I p@& @' @W ` ##b@]`P@& ؀  3!``@`t0@a@& :a 43!``\  "aX@aL"#\  H@4 <0  "a|aLad@ap"#\  `<@2T@&h \  % @V @ɚ 0  @ 2     @@V @U\   \!@  2 \   \b@~  2 \   \L@n  2 \   \"@^  2 \  3a` \@`\   "@B  2 @% $x,<P\ht㿘3!``  * b* `@  * b* `@    "#\` %s: %s 㿘!: @Ŗ  8# a!I@ "@Z?s I(Ees IPE㿘b b@      2 㿘  @T@@TȐ 0 @   2@T 2`@T˰ usage: %s [-Aan] [-f address_family] [-M core] [-N system] %s [-gimnrs] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] 㿘#!!`8J`p@`8J`@`8J`@`8J@a0@$ $OpenBSD: mbuf.c,v 1.7 1999/02/27 21:22:19 deraadt Exp $interface addressesaccess rightssocket optionssocket names and addressesfragment reassembly queue headersaddress resolution tablesIMP host table entriesrouting table entriesprotocol control blockssocket structurespacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbuf%s in use: %u mbuf%s allocated to %s %u mbuf%s allocated to %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines 㿘#a  8J!@c@0  3 8J!@ڒcp0!dc" #  ` /4  *  @ !J#i@yT  ,`34!a %J*@` *% * @N @y8   2c  %3!#J. `c.   c.c@yc &. ad J  "@ @y #K  *`   *  :` "*` *  * @   d@xad K@x H K@x hK @x %lu%c㿘  # k2  m21!Kp@w ip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㶰 'HK@x#0ג$ $``L@w 0L@w 00H L@w X0L@w 04L@w 0!x' "!Δ(    ;L9L/L+L)L  #.2  В@wĔa   @ @w!@L`!`@ L!x @w $*`2   ְ D2HL@w!H    `R N  .`@z `?`9L/L-L+L)L2!@wv (e P0@ @wjb(4@ \8@w_"8 @:#L.2  "@wRbX*`2  @wJb`(`'@ LL@w:"h0"@w6@w4b`4"!mrtstat: symbol not in namelist multicast routing: %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size X K@v#0 ``L@v 0vL@v 00q`M@vy"80ji 4M@vr"`!M"x~@vi!M"u@v`!M"l@vW!M"c@vN!M#0Z@vE!M#`Q@v<!M#H@v3!M#?@v*!N 6@v!!N 8-@v!N h$@v$OpenBSD: ns.c,v 1.5 1998/02/27 12:07:38 deraadt Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s8 ƸN@ڒc `?! T!h@ T!h@7# ;Oa     #  #  `h  (` _ h2~#%ꀢ`;!"N@u]#0a`N@uW#H` ?"`* $@Q "#``NNch@u?`#` N#pN#O #\ NNN#NcN@u(%#` " O @u  \O 8@u @C@u`0@>O@u `@# ` O@u P *`TO@t X` ?"`* $@ h ה T @ZN@tݐ#(%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  [ O#@scW* !O#O#ckOO#@sQcW4 !O#O#cYOO#@s?cW* !O#O#cGPO @s-cW, !O#O#c5PO @scW. !O#O#c#PO 0@s cW0 !O#O#cPO X@rcW2 !O#P#`xPO @rcW8 !O#P#`xPO @rӚcW6 !O#P#`xېPO @rc< !O#O#cɐPO @rc@ !O#O#cPO @rcD !O#O#cPO!@rcH !O#O#cPO!@rycL !O#P#a(PO!@rgcP !O#O#coPO!@@rUcT !O#P#`x]PO!`@rCcX !O#P#aKPO!@r1c\ !O#P#a9PO!@rc` !O#O#c'PO!@r cd !O#P#aPO!@qch !O#P#aPO!@qcl !O#P#bPO!@qךcp !O#P#bߐPO!@qŚct !O#O#c͐PO"(@qcx !O#P#b@PO!@qc| !O#P#bPPO!@qc !O#P#b`PO!@q}c !O#P#bPPO"p@qkc !O#P#b`sPO"p@qYc !O#P#baPO!@qGc !O#P#bOPO!@q5c !O#P#`x=PO"@q#c !O#P#b+PO!@qc !O#P#bPO!@pc !O#P#bPO#@pc !O#P#b@PO# @pۚc !O#P#`xPO#0@pɚc !O#P#cHѐPO#0@pc !O#P#`xPO#P@pc !O#P#`xPO#p@pc !O#P#`xPO#@pc !O#P#cPO# @poc !O#P#cwPO# @p]cĀ !O#P#`xePO#@pKcȀ !O#P#cSQO @p9c̀ !O#Q#` APO# @p'cЀ !O#Q#`8/PO# @pcԀ !O#P#`xQO P@pc؀ !O#P#cH QO h@oc܀ !O#P#`xQO @oߚc !O#Q#`PO!@o͚c䀦 !O#Q#`ՐPO!@oc耦 !O#Q#`ÐQO @oc쀦 !O#Q#`PO!@oc !O#P#cHQO!@oc !O#Q#a PO!@osc؁ %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀 8G O#@oO耦 !U#P!0`xWU@o?!@䀦 !U#P!0`xGU@o/!X !U#P!0`x7U@o!x too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰   U@n#h !U#U!0cU@n# !U#U!0cU@nt# !U#U!0c|U@nd#p !U#U!0clV@nT l !U#U!0c\V@nD  Ъ)V,` ",`@n6 @ ,``@+`,`  %V,`@ ",`@n!` ,``@`,`in transitat destinationUnknown XNS error code 0%ox *` * c ` 2``V"V"V@ݔ   !U!0@mט㿘` 2`  2` 2` 2` 2`  @2` $OpenBSD: route.c,v 1.38 2000/09/19 03:18:46 angelos Exp $Routing tables rt_tables: symbol not in namelist Netmasks: W@m ("c`    x` @y :W@m 808a y  !"'W% .  &m t #\c` " #\ 2 @ml`@G  2 @1 $t@0@@4  ֑. InternetInternet6XNSIPXISOX.25EncapAppleTalk %s: Protocol Family %d: 㿘?`W"*` €W!W!W!W!W !W !W!W! `W@m "0W"@m^P^^^^h^^^^^^^^^^^^^^^^^t^\^^^^^^%-*.*s Address%-*.*s %-*.*s %-6.6s %6.6s %6.6s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀"#``WW#X` @l W  #h4!`  "   4!`W "W  #4!`     4!`W WWWWWW#c#Țc#\#`#d#h#l#p@lv%-*s %-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)㿐"#``XW! `@lN X!hXXXXWX#\!(aP㘚a`@l? 㿘! H * H$%-16p (root node)%s => 㿘%##"  T `Kc` X"8@l c` 8X `"@X"PX"X@l ,  t`!#! @~c`  @N    @\ ,`?"`਒ * "@ސ     0    t`X@kŐ"8@$ `` mask (%d)%6.6s %16p : %16p %d refs, mk = %16p {(%d),%s ->㿘#" T"   Y@k W  @?``_%0!9"4Y @/Y @k{`%?9)#Y"4`H"-Y+Y `  8@U" 8 Y `@k[   @̖?` }?"``* $@K } `@k=`h`͒`?"` * $@4 route-sysctl-estimateout of space sysctl of routing tablex   ?''''   @ Y@`"H@v @ܢ 2Y@j"`@l   @ 6Y@H"p@^ @ @  %-6.6s 㿘 L% `" $ 2    @; $  @5  L ?  M@ P  @(  Y @c`?"`਒ * "@ defaultlink#%d%s%x: %02x%02x%s  x?`}[ *` €   @@`Z  ? ?  ? ? & 2`@͐` @-@^{@w    2  Z @ h  ! `  Z @ Z`+Z)Z?$@͔`@: ` @ D@0@@ ; z $Y @٬@:( :&+Z)Z?$@ٙ`@   ?$@ي @    ?4Z @iɒ0!`X! @i0W#X@i hjjjijjjjjjjjjjjijjjjii㽘 7@q  ( . @h  2 @0u " @Y  (  @P     44!`  "  0   4!`"      4Yc 8[ t@i#  T`[@i  @[[ @i` @!"l a  @$"l[ a [!Z @h `?"`਒ * "@ %u.%u.%u.%u㿐`| 'D"`|#p@`! 2 ,cp@ . @b4,cp4!` D @H  @ݒ . cp@ ", #bp@ , D! 22[#\P2 `"p@F!"p%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d㿐4!`   `@  2`" @` !"@ #`p@ť , 6` `!\ 6  p@!* p `!6 \ 6   !6 6 \#\6  ` p@! p!6 6 \#\#`ȗ6  ` p@ߒ! pillegal prefixlen invalid%s/%dp`    ' `' '  ' ''' E @C`@ + 3` "$  "  `` " `"  "   ` 2 `  ` ``2+ + `@ Ĕ  ` `䀢  `耢  `쀢 `1Z& \!@b84!`2 !#\ؔ! @ \P@F!1!p\X@=!㿐  !!#\"x! @ƚ Z ,"xrtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route 㿀 ]@g9!03* ]@g3!(!]!8?@g*!]!X6@g!!]!-@g!]!$@g!]!@g*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sp 7  7 7 * 7777&7+  2#+` 2 2,2  #cx] 2@t@T 1!]#x@j 21W#x @_S  ], " @_H  2  ],"1%'#]# c ]#d   #\#`  `@;Lc,`01% #]   K 0 *  2] @ #x,#xc( 2@@0H.㿈 7777 7 7 77`^!h@^  " %02x:%02x:%02x:%02x:%02x:%02xp ? / / // 7  / / / / / / // ///#/    #c] 2@խ@!]#@գ 2G# @^  ]"" @^  2 `]"! `*  `: L` (L`+ +`#\#`O^#d; ;`@v  !]  @m 1* 1#](  2@^@>㿈 7 A7 77  A// 7 7 7 7 //X^!h@ơ  " %-18s %-5u %-18s %-5u %-5u %-42s %-5u %-42s %-5u %-5u %s/%-u/require/acquire/use/dontacq/permit/deny//in /out / 㼸 @I 0  @D 0 0h@? 0ʀ  !_ ڒ@e0!_ ܐ@e&ʀ 2@j@q  `@q   /a//`/@ h @ !_!@e@q @p ///a/`@  @!_!Ȑ@dj ilҔ Ȑ  #\  @!_@dА!0B_@d̐!8A`%*``! €_@d!@_@d!P_@d!`_@d!h_@d!x _@d!_@d!`  _` * *_@d!02 `` ` _ __@d}!0@dz! 4H  J(8f4 a* J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$OpenBSD: unix.c,v 1.6 1999/12/08 12:30:17 itojun Exp $Out of memory (file table). :`!`  @!H !Ha@c 00 *` *   "aL$"P h PT P (v P`   P` P (@LP 0* seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-*.*s %-6.6s %-6.6s %-6.6s %*.*s %*.*s %*.*s %*.*s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%*p %-6.6s %6ld %6ld %*p %*p %*p %*p %.*s㾰  , h `  H  2  '< 'a@c !aaaa!a "#\aaaa#h#t###!!a#`#d#l#p#x#|#@b $O  ` K ݼ@h@X!A  ` 8 ݩ@h@X".(  ` $ ݕ@@Xb p\ ` 4݂ @Xl"8  @XeH   '3 ;h9h7h3h @ hh@XNb "#  T,=N t ` 4KB h@X+!@|  ` 7 /@@Xb. ( ` 4% @X"  p܀ ` 4  @W8  @WbH   '3 ;h9h7h3h-h @ gh@WԐb ""` S+<M` ` 4JȐ @Wa@ ` 48ܶ @W".`(  ` $ ܣ@@W `p\ ` 4ܐ @Wzb8  @WsH   '3 ;h9h7h3h-h+h @ g@WZb "" S+<Mt  ` I N@@W8!@| ` 48< @W&.( ` 4%) @Wb p܀  `  @@W8bH  @V 쀒@3!`` h# @V @3!``h#( @V֔ Warning: socket(AF_INET6)ip6 on %s: Warning: ioctl(SIOCGIFSTAT_IN6) %qu total input datagram%s %qu datagram%s with invalid header received %qu datagram%s exceeded MTU received %qu datagram%s with no route received %qu datagram%s with invalid dst received %qu datagram%s with unknown proto received %qu input datagram%s discarded %qu datagram%s delivered to an upper layer protocol %qu datagram%s forwarded to this interface %qu datagram%s sent from an upper layer protocol %qu total discarded output datagram%s %qu output datagram%s failed on fragment %qu output datagram%s succeeded on fragment %qu incoming datagram%s fragmented %qu datagram%s reassembled %qu datagram%s failed on reassembling %qu multicast datagram%s received %qu multicast datagram%s sent x  @g m@P#0@m@U#0HaS@ m@=#0|쀒 3!`` %m @U̔ 23!`` %nΐ @U 23!`` %n@ں @U 23!`` %nhڦ @U 23!`` %nڒ @U| 23!``  %n~ @Uh $ 2 3!`` ( %nj @UT(, 2(3!`` 0(%nV @U@04 203!`` 80%nPB @U,8< 283!`` @8%n. @U@D 2@3!`` H@%n @UHL 2H3!`` PH%gh @TPT 2P3!`` XP%n @TܔX\ 2X3!`` `X%nސ @TȔ`d 2`3!`` h`%n@ʐ @Thl 2h3!`` ph%nhٶ @Tpt 2p3!`` xp%n٢ @Tx| 2x3!`` x%nَ @Tx 23!`` %nz @Td@node information replynode information requestrouter renumberingredirectneighbor advertismentneighbor solicitationrouter advertismentrouter solicitationmulticast listener donemulticast listener reportmulticast listener queryecho replyecho#103#97#89#60#59#58#51#50#44#43#41#29#22#17#6parameter problemtime exceedpacket too bigunreach#0 %qu call%s to icmp6_error %qu error%s not generated because old message was icmp6 or so %qu error%s not generated because rate limitation Output packet histogram: %qu message%s with bad code fields %qu message%s < minimum length %qu bad checksum%s %qu message%s with bad length Histogram of error messages to be generated: %qu no route %qu administratively prohibited %qu beyond scope %qu address unreachable %qu port unreachable %qu packet too big %qu time exceed transit %qu time exceed reassembly %qu erroneous header field %qu unrecognized next header %qu unrecognized option %qu redirect %qu unknown %qu message response%s generated %qu message%s with too many ND options  ?#Pg @S ` 3!``4?!p#`  @R?#P  23!`` ?!p# @Rޔ?#P 23!`` !p#ݐ @Rǔ?#Pa ?c@@?"@#<?"#8?#c4Ȓ@?"@#0А?"#,ؘ?#c(@?"@#$?"# ?#cD@  "@3p#h @ ",@R}c ,@Rw`` ?#P 23!`` ?!q r @R\?#P$ 2 3!`` ? !q @[ @RE?#P,( 2(3!`` ?(!q hD @R.?#P40 203!`` 0!q - @R!  -h'h` @@ ",@R@ ,@Q`` q@Q ?cP  H  3!`` ? q В @Q ?#P`P  3!`` ? @q  @Qʔ ?#P`X   3!`` ? q! @Q ?#P```  3!`` ? @q!  @Q ?#P?#@ `h  3!`` ? @q!@ @Q ?#P?#< `p  3!`` ? @q!X @Qj ?#P?#8 `x  3!`` ? @q!p @QP ?#P?#4 `  3!`` ? @q! @Q6 ?#P?#0 `  3!`` ? @q! @Q ?#P?#, `  3!`` ? @q!В @Q ?#P?#( `  3!`` ? @q! @P ?#P?#$ `  3!`` ? @q" @PΔ ?#P?#  `  3!`` ? @q"  @P ?#P<8 283!`` ?8!q"0ճ @P?#P?#D `@  3!``  @!q"XՖ @Picmp6 on %s: Warning: ioctl(SIOCGIFSTAT_ICMP6) %qu total input message%s %qu total input error message%s %qu input destination unreachable error%s %qu input administratively prohibited error%s %qu input time exceeded error%s %qu input parameter problem error%s %qu input packet too big error%s %qu input echo request%s %qu input echo reply%s %qu input router solicitation%s %qu input router advertisement%s %qu input neighbor solicitation%s %qu input neighbor advertisement%s %qu input redirect%s %qu input MLD query%s %qu input MLD report%s %qu input MLD done%s %qu total output message%s %qu total output error message%s %qu output destination unreachable error%s %qu output administratively prohibited error%s %qu output time exceeded error%s %qu output parameter problem error%s %qu output packet too big error%s %qu output echo request%s %qu output echo reply%s %qu output router solicitation%s %qu output router advertisement%s %qu output neighbor solicitation%s %qu output neighbor advertisement%s %qu output redirect%s %qu output MLD query%s %qu output MLD report%s %qu output MLD done%s x  @ m@#0@t@O% 0HaT@V t@w!0쀒 3!`` %t0 @O 23!`` %tP @N 23!`` %tx @Nޔ 23!`` %t @Nʔ 23!`` %t̐ @N 23!`` %tӸ @N 23!``  %t(Ӥ @N $ 2 3!`` ( %tPӐ @Nz(, 2(3!`` 0(%tp| @Nf04 203!`` 80%th @NR8< 283!`` @8%tT @N>@D 2@3!`` H@%t@ @N*HL 2H3!`` PH%t, @NPT 2P3!`` XP%t0 @NX\ 2X3!`` `X%tH @M`d 2`3!`` h`%t` @Mڔhl 2h3!`` ph%tܐ @MƔpt 2p3!`` xp%tȐ @Mx| 2x3!`` x%tҴ @M 23!`` %tҠ @M 23!`` %uҌ @Mv 23!`` %uHx @Mb 23!`` %upd @MN 23!`` %uP @M: 23!`` %u< @M& 23!`` %u( @M 23!`` %u @LĀ 23!`` %u( @L̀ 23!`` %uP @L֔Ԁ 23!`` %uxؐ @L”܀ 23!`` %uĐ @L䀒 23!`` %uѰ @L쀒 23!`` %uќ @L 23!`` %uш @Lr@Ɛ %qu message%s received %qu message%s received with too few bytes %qu message%s received with bad checksum %qu message%s received with bad version %qu register%s received %qu bad register%s received %qu register%s sent `  8g @L" 3!`` %x8$ @L̀ 23!`` %xX @KԀ 23!`` %x @K܀ 23!`` %x @KҔ䀒 23!`` %xԐ @K쀒 23!`` %x @K 3!`` %x(Э @K%.*s.tcp6tcpudp6udp%.8s*%d %-*.*sH"#`y `  %4 " @J@@   `y`@ 2yy ``@ 2y`@%> y`.`y  y @}`y`@v2`   y @K* ?pa %4 > "a#@b! 2 ,@Ē . @`, %         @+'  "@ß . c@"` ",@ `  `   ` `y :2b!@\"3    ?  ???  ?//''''' /'/ !!#\آ ؔ! @ y"P4 !"@Ҕ 2b؁mroute6pr: symbol not in namelist no IPv6 multicast routing compiled into this system IPv6 multicast routing protocol %u, unknown mf6ctable: symbol not in namelist miftable: symbol not in namelist IPv6 Multicast Interface Table Mif Rate PhyIF Pkts-In Pkts-Out %2u %4d %5sreg0 %9qu %9qu IPv6 Multicast Interface Table is empty IPv6 Multicast Forwarding Cache %-*.*s %-*.*s %sOriginGroup Packets Waits In-Mif Out-Mifs %-*.*s %9qu %3d --- %3d %u IPv6 Multicast Routing Table is empty 0 z@I 0F#?bؔ ``gz@Iݐ 09z@Iؐ!04`z@Iѐ!@0-4z@Iː!h0'? ? " ήb  b/z-z%z  'Ο `. @Iᐪ .  2`@I z`!0@"z!@I  (  @I *`2  ? Ҡ ``z@I|"l$  *``?cpzc`" [ `734z@Ia"@`z`"hḀ    '`  'Ḁ   `z`"Ḁ    `  Ḁ  z#\@I0#` `z`"Ḁ    '`  'Ḁ   ጐ@I``Ḁ    `  Ḁ  q@H`z" @H   3zܔ    @Hb8?#@zz@Hؐ"?@HԐ"?c  3z. 2 2 *  :  @HÐb *`2  @ z@H2N `$?*``zz@H#z@Hb?$ḁmrt6_stats: symbol not in namelist multicast forwarding: %10qu multicast forwarding cache lookup%s %10qu multicast forwarding cache miss%s %10qu upcall%s to mrouted %10qu upcall queue overflow%s %10qu upcall%s dropped due to full socket buffer %10qu cache cleanup%s %10qu datagram%s with no route for origin %10qu datagram%s arrived with bad tunneling %10qu datagram%s could not be tunneled %10qu datagram%s arrived on wrong interface %10qu datagram%s selectively dropped %10qu datagram%s dropped due to queue overflow %10qu datagram%s dropped for being too large (  ``gz@G 0z@G!0`|@G h0ٔ h|@G !| @Gؐ!| ؖ@Gΐ!|ڠ!@GĐ!|Р!(@G!|Ơ!H@G!|̼!@G!|̲!@G!|̨!Ȗ@G!|̞!@G!|̔"(@G~!|̊"X@Gt!|̀"@Gj!|v"@G`㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿀@Ϡ }"   75:# "%/:+}2'쀢 8-* @€ (  %&"aJ@ @ 4 }b@$ @Ja a@  % ?@@|b?ː?a * & ^@   0406.`? @耢 } @ } @ @  } @  @     @g#\ 2 @( }0@   @}c@<  @ D "@Ő!@4 @@@@@ '}@c@ @ T 2& }@c@@ ) T@@  }@@ }}@c`@{  @耢 } @  } @  " }@c@d    #\ 2`}@@ }#@@ 2`@#\ @@.`&@< !}c}@1ఒ }#@ΐ  @ ?  "a }c@  :0"  !@#@A :!` @/ #@A 0@u %s on %s type %.*s%s%s (, %sunknown flag%s %#xsv3v2nqnfsudptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadleasetermdeadthreshmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemcd9660norripgensextatt) 㿐  T #@CI D:>a *   } `@C5 "8` D#3}"8 `-+)@`  2 ` @C ,@`  뀌@`   @" 8" @Bc@2 O !   !2 " @ H P@Bא   @    @BÐ       X `@B   ᘤ    @Bh  "     @Bp  @"     @B{x  ᘤ    @Bjᘀ      @BTᘀ  $    @B>ᘀ  (    @B(ᘀ  ,     @Bᘀ  0     @Aᘀ  4    @Aᘀ  8"     @AԔ !Bᘀ  <     @Aᘀ  @ (    @Aa@ߐ @ v!  !!x@!@Aa @ 7ᘀ  ! l  p !(    l8 p@A`!@ᘀ  t̀!H   @AKXa`@ {ᘀ  ! l  p !(    l8 p@A%!@ᘀ  t" x!H   @AX x     @@h x     @@p x     @@ݔx x K    @@̔=@a 7! l     @@ l     @@ l     @@!#p@@㿐@  @6  @  @ T `@! 㿘"4  a`?  #:@f    2a@ empty type list㿘 N  na@ΐ  :N  o:: "a "! %  @@ , ` @*  $4 @6 $@ , `$@  @) , 2*@, $@%s,%s㿘 L@ @=@: @滐  @6 @`@`@̐-o㿐@'!%  -}, &@ =  ,  .&b@  ,  c, &&  @7 2N&@usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘``Ș ؚa@ː!@ڐ ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘} @c  }@c 2( @ "" @q   @ka` 2 }b@d 2 @=:!h  !@=3  ,-o %s: option not supported㿘@  @5Ғ 1' n L  o  @ = 2*`"@ 2   @2    &*@&b@n  @⠠ 2L@徐㿘@㿘@@ @, 㿘@㿘ؠ! ?R$ ! @ 4  H @!0? @!  @2!  !@"` !@F;?` !"  smcuprmcup㿘 ` $`"4$0T!܀ )3! `$!a@@!! @@ 0 3! $!a @,!! @? @݄`@݂`' !  @?ܒ !@?֒ @i  !@"!"`@ 㿘 `$@H! "&"X K"""X 2 ! n  !!,""X    !"X$"&@ "X!&@ 㿘$ ch @ޔ 1 !̀ " !! *` * 8`0 @ 0@E_ 0 " !! *` * 8`  ch @殔  㿘@Fa8`?؆"?P"@"?P" H@ "@㿘%؀ /@ &!`?R@?R4@@H ? @Dڔ ??  @ Ҙ @DΔ@ {?8`?㿘 ` $`w! @> !!`l Ԑ @0 @> ! `?"``਒ * "@  !@>Œ 0F!    ?`&  @  * $ @<     ?`&  @  * $ @<  `?"``  * $ @ڐ @ 0@f 㿘a@  8`? ` $ ` `"  *`?"" Error: move: l(%u) c(%u) o(%u)㿘 H@@D?   HX@  㿘  $a `a@s @E a8`?xterm]0;%s㿘  \ $!  a(@w  !`&!!0@$! @䀢 <   @  2&` @ڎ#'#@ʞ* "@*`@*`'0!@$`!*` € &`&` &` &` &`@ -|--,$,\input`$!" @U 2'    ??p?x?' 'pp 'p  @ ? `0 `0, @ْȀ 2(T`  ̐ '''''''Ԅ '''' @ ՔT  @ ϔ!\T @  ?pp??x?'p p3@ d"`2`*@ `.  #@ 42d  @; ?$ p@G @LQ Ű 06 @2d!  1$! ! .'  "!` ذ @ `   ?` "' !*'$! `  @ Xȁlines=%lucolumns=%lupР?8''''$@@⟐'@] 2 H$@@⎐'@M @ 㿘 (T   $@j 2e (T ?$(T`$`2[ ``2V $  ?&$$  &$ ! H  4!@? @K! 4  H@!@?~@@!)@ 2. a $a$`"' a"# " " " "  *` 8* ? @ܐ @9   @]  a ? $a 㿘 $!  # @ 2 ! ""2!@ 2 ! "" @ 2   @ !! $!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattr㿘  $a a\"@׫   p@c   >@n 2 #耊 " ## * * `8@! @Ԑఒ @t @ʐ" "  * * `8@ฒ @a @޷!` !X * * `8@@Q `! "$!@s `!  @  e Ȗ@ ]  @ ` @ ఀ2 @  j@>!@>f@=!@6? !@6  $aܒ @߽  @جa\ @ג + a"$a\"$a\a$"aha\$$a\ah  $ah,a~,aw,au,av,a{,az@ 2 a\ @    @  @ 0 㿘! $ @6O!!`! @> !@Ē?! @>@?$!@@&!܁ cupsmsormsoelcuu1㿘  $! K!0"N`@Y!`@T!`ؐ@O!`@J!`@E!!` ! 2! `@G $!! "! @@$!! $!8!!$!@!$!D!$!H!a!! %!$$!L!($!P!,$!T$!X$!<$!0$!4!0 @    @   㿘 $@# 㿘@= " @Z "  @ِ & @  @= 㿘! "!@&!! "!@&!! "!@&!! "!@&!! @&!%lup`  (@w@  ?>>>>>>>>>>>>x>p>`>X>P>@>8>0> >>==============x=p=`=X=P=8=0=(===<cursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1>?>=?x==?p<=0?h=lakahaja㿈#`%  @ "@@ @ #\#`#d@ 2  #`0)   @ " ! !`@ 2``"@@א`#\#`#d@ 2_  #`"B   -@ 4"3@ ". @ޫ@ި#\#`#d @ޜ@ޙ@ޖ#\#`#d@    !D " $     @=  2 $ 㿘!D`  `$ @@3 2 `$ 㿘$    " @ kf%d233|This terminal has no %s keyfunction key %dH#c@R @@@  " @" ` ` !@  #(@Qߐ@p @ ?8 ?@ #d#\#`@㿘 ` $`>` `" (T0,`I"0' (T`"(T$  &$  @0`?0   "  0 " ```   stderr%s046|messages not turned on: %s045|messages not turned off: %s8@蟐    < @O 7 @ 6a؀ .((     &a؀@ϒ` 6 0?c @ 6  P@  TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '`h @4?  `1 ` 2q'0oi" " " "  *` * 8 0YW!` " !X!X *` * 8@ ܀0G@؀0C`( @D" ! `@" 6 @ `` @" 6 @  " `" P@"  @D @"Ȁ  @; 2&2& 㿘 `? "`` *:   * # @wl 㿘  `C  @  2 @ @ L ` `  "  *@ ` L ` ` *@  ` !@ $ `      2   @" @ 1 !$  @W    @  $ , $  a@ $ !@"` "a@ !@$  @B $ ,  "  , @8>   @ ^`@/ @"   @ I   @ >`@ @  @~ ,   "!  L `2  1  `e 1 !@  `  }  z  2s  m  @ΐ , $  㿘 !@) ?π` "H*` € 2* 3* 4* 5* 6 * 7 * 8* 9* 2  `"  "`  @"@!MMMMMMMMM㿐 @xo 2(  @F    "" @o@&  & &  2 ' "'     ' 㿘!@  "@F `"  "` @"!@ 2 !,!,@0㿘 @  <  @  & @׈ &  @   `@ע  @& 㿘`& "`@&"@ @2@㿘  @x@v002|Line length overflow㿈/ @  ' @x4  d d@& d  (T`  @u   (T`@? ' @y 2      @w쀢 2 @`? k @'' @w _ d d@& d  (T`  @tɖ   (T`@? '@ @wM쀢 2s    `T! ' @ 耢 !x t@x "Q &ttx'T!&T@4``@@x * < @ 2Q` @w 쀢 20    T!"x ' @ǔ耢 ޤ` t@x " &ttx'T!&T`@ `" `@`# @@xF" נ ՠ 6 @v 2ް    !T!"x ' @u耢  t@jx " &ttx'T!&T@ؠ @v쀢 2 쀢 [?@W"  @       T!"x/''   "TtTx >&T  t@x "k &ttx'T! &T@耢  `@?" "@ @@w 20 @ '' @v # d d@8& d  (T`  @sf   (T`@? '     ` `thT >"hT@zscript 170|Interrupted㿘`@a "lܰ  `x   `"  "` "@@O @Ml 2 T   $$?#` *  p+$d @is 2 @n&@ $d@ @2d`L@ d $d@< a<`"a4a4`*` * 8@2 @ b ` @ b  8bؑ*` * `Tb؀ T "T :@\0 2Y `(T`  @r   `(T` `@;@;Ɛ @-`x` 2` $$$`$ $@ "`T 2% `(T`  @rj  2T`(T` T "T @aT 2&dV & !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  |` "`` %`%`@ @v< L  ѐ & P`*@$`` @   %` ``* $` $``   3@9`Q`@$`@v 2 T` $` `` $`$`` &:`J   %` `$`  2`  :` ?  $```$`J`:"``  "`?  $`` $`J  2``J 2|` `@ ?$`$`y$`"`` J`?$`  $`J "` "``   $ `("`@ !  3 |` " /'L``   *`J` *$` @    쀢 2`` u ` J`?$`  $`J "` "`:"`` ] `J`|X` V@0   ``?$`$$`` ` L @ ` "` ``$``$`  `2``2 L * : I #* €b! 'JL   'JL L l p + - ^ ##``"@! $`0!Ę !`$!$`!$`!$`$$`($`,$`4$`8$`0a$` `+   ,@  T$` L k s0> <``?`$`$`@$` ?L  L c" g" r""`?`" $$`($@$$`$$$`$$`$`$$`,$`0$`4$`8$`($`  `*  ,@ Đ`` !X@$ `$` ` ! " H !Ӏ"#X "#P#P *` * 8`2  @^ `#p `0L < `02&` L >! `+ `: `J@2```$``$`J"``" @ 2S`` #(@  "@$`@2`%`(`*@"$` ``(``@$`$@2 ` $`` L`$`d P$`h` $`" """ *` * 8`2` ` " ``@`| b$`4`|@*@$`$  ` $"` $` >$```  ؠ  @  $`@h@@v8``"``J !2 ``|!$`4`|$`$``  5` J`$`` $`J "` "```" ``J +2``$`$`:``@ J 0  'S ` 0 'R @m  `` ` $`$`J    "`,`` $``$`ʨ `$`֮"@x@P@0X` ` 5`J\ `` J  $`$` J`%`  $`  ,`` $``$` @Ȁ@:' 5``?`$`$```  J   '쀢~!2}`` #0@쀢 "t`J "p```$``g$`J 2`b`@ ]5`  J`$`` $`J "` "`` L  `*:  |2`"$$`($$`$$$`$$$`,$$`0$`4$`8$`(($` `%$``$` `J \2 ```$`$``J@ "`` $``$`2`` `J@ @ Y```@ J 04  'S ` 0* 'R &@lȒ " `  `J ` '쀢`|2%, 2 ` %` `$` ` ` $`$`쀤 |2, 2``  $``? $`,`` $``$` ```$ "`$`` $` $` $`   L \",` `c`` 050 `` "  "`l~@$`` $`@q耢 2`耢 2 L`$`d $` L$`d Pd$`h$```p$`d_$`h] 0( & @ $`$``  $`l@q`l 2```   `l  `$`$`d$`d`$`p $`6$`h "*`d2 20` ` $``$` L 2$`d @q_耢 2`耢 2  L`$`l $`$`d L$`d$`l P$`h $`p `h$``$`l$`p 2` ` @,  $`` L`$`d#4   L#, *` * 8 #,$`l P$`h$`p@q!耢 2\`耢`" `  L@(` `l 8$`l` $`\ L`- !2``""`J@ !2`|`!$`$`4`| "`` J`$`` $`J "` "``  ϑ* : Fݘ "* €` ?#`J ^"`\ l +"`\ - #"`٤" `\դ p"`|Ϥ $`\?$`\`| b$`4`|`(" %`(`|$4`|`(d 4`|`(@ %`(`` $``$`` "`J ."`| = + -" `| ^" `|   @`| ( L 32`| 4`|`` $``$`y`J + - ^ #2 `@* 1 2h` L  ` 2_``|?`,`Q$`$`T4`|` `L ` L +2H*:  + -2A`J - +`| 2``| 4`|`@ 2G䀢 L 0*``"@ " $`$`L a `l`p$`d$`h ?$`l$`X`|  4`|`@ ـ @a u쀢 ܀ `@o $`T ` #@ ``?@ M ``'``?``@ J 0  'S ` 0 'R @j3  `  ?`$`$` ,  2 ,`` $` $``` $``$`$ @ ޒ 2`` "` ` J`$`` $`J "` "`` "` `'``6!``@J"`",   'S `"`, 'R @i͒ 2,`  ?`$`$` ,,`` $``$`$ @  2U`]```@  KL NQ?'L o`$ "J`` 2>` E``` aP ` *` *  !X@+ :`@hސ@w L  ` `? $`" ``J  $` ` 2 ` @tْa " ```  @wt ``` ( 2@$`l```2`d$ 2` @2`d` ֔ @nn 2`d`| ʐ@n耢 2`$`l`d`` $ 2` @2 $`  @nJ $ `@B@=<``  21``l L   '`# " & L& P@\ P``d L   `  " & L& P@D P``$`$`@ L  P''`* $` '@v+ 2\`$ "  , & ,  $@2`@nؐ` @" `   "`$ "`T 2`@2|` @2`|€ ` *@$`` `€ 2T (T`2T  @iQ  2$ (T`" $T " `$$&$ " @x  "&$`\""$ L @ٔ8   @ `@ @mv 2 LƔ L`\ & L$ G  C L ?`|`:! @4`|`@@<`|! @4`|`|"@ $@ ! "!! *` * 8`2`  ` @2   L''@/ 8`@J?`"`!` ?   'S `"`` 'R *:`@gː 2 `` $`*` $```"$` @G$``@$```$`$`$"Ȥ   |`# `P`"*` € 2@ 2 @  @u @@D@`2 `P pn$"@2y'|@u ``0@vђ `  @Ӗ ` @͔ ` 2@`` "<`! `J` @$` 0  'S ` 0 'R @g6  ``` $` $` |2 `` 8 $```? $`` |@" `@u. @u@j  @u"  '%$*@&$DD<<<<tuu|||||||||||||||||||||||||||||||x|||y||||||||||vw(||xP|||||xh||||||y|||{dddddddddddddddddddddddddddddddc094|The second address is smaller than the first㿈&`  &``` @ ?* : `2r *` €`@2    @k’`l ǖ `l` `@ `?&`d&``&`&`&`p&`h`@2հ    "!``` " L  " L`" `l` &`d P&`` &`h`p&`d&`h L &`l P&``&`p`J`;2``` "`d  `" `l `@& L`h& L`p& P` `?&`9&`@ޘ 2  쀢 - \`` "   ` ` &`d&`h&`` &`l&`p &```l&`d`p&`h&`l&`p ` 2O``@2M ;`` "2 L   02"&`l.`` L&`d P&``'&`h  @ .   @  (   @ ! !   @  `p&`d&`h L &`l P&``&`p`` 2 `d`l @@s  & \tttttttttttttttttttttt\tttttttttt@ttttttttttttttT$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿈'&`* &`  2``J@~O!x     @r '` @ ?ܑ* : `8!$*` € &`@&`&@jO 2 `` ? &` &`` @ @= z'&&``""@&`&` &``  &`@rђ _'`J @qה "`T'` &`j&`` K  / ?" `@r  ` ?&`&`K `/265"|6" L@& P&`` ` p!p#\ m  ``" " &`&`&` )&` & P& L 2&@i "  "`&`  ``L  ` ++` ?&`&`` Ơ `J "` 2```?&`  &`J` "`` "``  `  `L `2 *:  + - ^2 2 ` & L& P&` &`` L`J "` 2```?&`  &`J` "`` "`` iL`  ` 2 *:  + - ^2Y L `2`  `2 `+2? ``?`&`&`J@ - ^ ``?&`&` ` @|2  ` " $   ` $ :  { `$``" " &`|&`  "    @q~ ^ 8   S @& dLX㿘$*@ &$|@2 ``@m @`h$` 2f `P ?`<`<  @@ $`@"` @$`<"@@`<2 2,`H `P `D`@h " `D@h2 L " L+   & L@`H@`"``"``@@"|`L   @;$``L$` & L$`D`$  `P $ &$ 㿘 `|`"1`| P ` < <@& @"`@& <"@@Œ  <2@Ō H`"  "` @Ł"`|2 P`|"  098|The %s command is unknown㿐    (T!" x ' @ 1(  t t@ x %$ t t x'(T!$(T,@@ǹ @q   ` `t@hT >"hT@+㿘@$   #耢@%@ 㿘@J?`!  @   !@`?㿘b bLJ@4 2  @   2 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"      @o 07)0&P @@Q 0('!@. €p@f̒ @oy 0@os 0 @ @@oj  105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ޔ 2q X@o j @İ@` ?L@ ` 2 @`_Rx@ "@  B  @ ` L  ` _2    ` _   @ `  #\#d@&#` 2  hT  "hT@n  109|"%s" is not an abbreviation㿘 `t(T @@`@ "  @8@oՒ  㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐    `  @P\ 0`d & L`22``d `d`l   2Ѱ Ζ  2ɰ ` C`%     2 2$$@$   .2  @d3  }`   @d$ n`ǖ2&`&`$@u``&蠟€  `  @O 0o$!2  ``&$!@) @ra @)!@)@)`|!! "!! *` * 8`2!< "!<!< "!4!4 *` * 8`2@  @  ? ''@I۔  @```@c  `@@2`` & L@d   & L 111|No more files to edit㿘`x `(   2`K `!"`|`x 2`( @Ś@  @T}@}y a@[  r `x Jd@2d`$ " d@  @`$d* $d$`(`x @q   $`$  @mI `t `"$@ $ `  $`$$`(@R d $d `(@R d@  2`|!  $ @S[    "d`( $`(d ($d㿐 @ 3 @ `t@R  `|2 @S.  @ @c 0 @"`("`$  "$@ $$$ 112|No previous files to edit㿘`(`$@2 `@lr 5 !"`|@ķ@ ' @q" a@Z   `(@RV  `|!  $@RД   `( d($d$`(113|No previous files to rewind㿘 $ 2 `|@l( !  a@Z  2  $& (@R " `|!  $@R 2 $ &$ 114|No file list to display %s%s%s[]㿘 $ @k 0Q   H)'-@( (  8@ ?@   @'"  (" ( @' ( # # # @'b hT   @^g  2  (T`  @'g" 㿘` `x @   @k `2`t@ʐ@ &  @ `"$@@ $`@`  $㿘  @Y$ $ &`t $&`x 㿘 @N $ *  @² $ *` * $ * "` $  $ $&`t $&`xx    (T!" x'' @G" "e '쀢!  t x@;" "Y $ t t x''(T!$(T#\#`#d'@ʚ    ` `thT >"hT@ݐ /  @ @  J@  J@ "` "`@ y   ` `thT >"hT@  echo x  ` (T!" x'' @ɖ" "̰ '쀢!  t x@" 2$ t  t x''(T!$(T  *@  *`  *` *` + '#\#`#d@5 2  3@yk  R  4@yd  K cp " chch`* * `8@N     L ` J?  ? # N@uK  0  %N   L@ `2 ? @u4  ?   ?'N * .@@]  @` `` `thT >"hT@ɐ 㿘z "xN N " ""j )`N  0  'S ` 0 'R  @[}     ؤ@$*@ " @ ))`" @L@ "` @   'S `"` @ 'R  *:`@[A 2 @` @,`ܠ ,$ $$&`t$&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\`@d'@+N #"`  % ! '`@ \'`"`  @V'@    "(T t(T x >@  '(T t x@ " ' t(T ta x' '(T@ @  ӠN  @'@    "(T t,@@ '@    "(T t(T x >@  '(T t x@Ж " ' t t x'(T! '(T@ @ @`@@&`(`N % # !2`'`    "(T t(T x >@  '(T t x@ "^ ' t t x'(T! '(T@ @z B, "'`   `"hT`thT`x >@  &hT`t`x@X * &`t`t`x'hT!&hT@@F  ؐ@h    ,'@%` "㿘 ` `$@&"`` @,  @,  $` @g `2` @e? * @9 P$` `,   @& ` "@ @gÔ ``!`  #$  $ @  @ $ @g   $ , $  @g   , `,@   @ ` "@ @g ``, "`㿘   "& $  @ ,``"  ` " @\@ @Y@ `@& @R & $& &  ./%s304|Shell expansion failed㿘@ e / !  ! ,@} @y@u 2M$@hh _ 2  L  .? @c@^@ 4@ -@ `$`*` @f`M / /, `@X$ *` " $`$$' t$' x@x @u$@  .` "@rX  @f’  㿘@@@u289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sx'D#X'H'L 'P#P *` * 8`  DDcP D/  cd  Dc\`* * `8@'#\'@  / '' 'H?@'L'@''@(  DP @fC @x`X  'D`@f6 @3 Dh@f% 쀢 "@yq?"@r? @l @  @f@d@b p@ W Dܖx@gC @ @QC쀢`9D     t@L(T >&(TL x*`  x t@D "Z & t t'L x"(T!&(T@*  D@L "E 'L@"@'. ?'`? "`@xQ@  "@䀦( .N?  2.?.P"@H"` @@xܐ  D@fʒ   D @*m 2 N  N " "" ``D@e] `@ 㿘`|  @`Q ` @ *2 , @2 ਐ 9 , L 䠐 ` $䠐 ` + @  ` !@     2  +  * !X@ @VJ @G 0^@a 4`<$`<$`@ @Y  ,``d " `P"   `P`l " ,`P`<"`@"$`@"`$`<        @.  $` @d͔ " $`L$`H*   @/   .  `| $@`|"  "`| |$`!!%s 303|File modified since last write.! 㿀`t@` 2  `  @F 0  @~@W:@ $  @d|  `@$@2```@`@@ߐ ``@`H@ @ W`` L  > X ";$!$ "!! *` * 8` $T  @S@  "#$m $T "$L$L *` * 8`2$$ "$$@2 $`P@i< $ @`?@(\:$ 2 ``  @F 09 `d @`&``l 2@@[E쀢 (  2@&`l&`d @`d`l#\@ $ & L& P@7 P$& P$ @2 @`x 120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  `X "`x`|!2`x  J@/@c  `x  "#`t0$@ # L @p@   "J  @ch k @@@  2`x_ V`t `/"P  `.H `.2 !H  .2 !H  /; :!H " !@!@ * * `8@ ')`N@ @ :2`((.@@̐.@@Ð 2N@@(  0@dR   N@ ږ`P@dF  A|h`AX8 ŀu8BX`H@18 uTBXŀ1p`4X@ T8"h`TX@ TX 8BxH@ XB8 Ph` X8 X״Xh`TLXP x1`@8,B05A`XXP9BH(52,6xhPH4@ AX>xPHAX ?4?4xh?X0 Jq߰ߐ߈Kxh`Ll1@@xTޘސހP}xVXݰݨjݠ`0(j {|ܸ|ܨ܈܀|p܈h8BH@$8 l8۠xpd`@8|(4@ڸژڈXx`X4P@ ٸٰ`ٰوـ!xH ـ Xڬؠؘ $hXPH$($װר<$X׈׀xpH( 0֘`replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D x`X0dx4PxDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $8   @l " $8_  ,$8`t@  L @ `      `2"7 L @ ` 2 L   `"L , L   L@ `   L  @ `2 @ 2  @Z  CSCOPE_DIRS :㿐@ x "T @ِ     (T!" x`' @~ @  t x@~ 2$ t-  t x'(T!$(T`@͐'# @!@:` 2J   ` `thT >"hT@6 %s/%scscope.out8 @}`x} 2 `x@ @gby @@< q `t,  @ @Z a <  2"$@w@ @Y E @  / .@`@. @8`8  4 @Y֔ /  $ @>$ $ @. @  $" $$ @ @>   @ cscope.tpath%s:8` P(@wE@* Q@]` &`, @Y \  @  `,@`@Z  G @ŐC @`, *@ `,:2`J` 2`J@  @@  #&`(`, `h@* "! & h@#   @K` &`, @  &`(`,  "@`,  @"&`,pipevforkcd '%s' && exec cscope -dl -f %s/bin/shsh-cexecl: %swr㷈?''''D'H'L@ݐ @ؐ耢 DH@X @H?"`  0DDP@X ?"@8?"@2耢?"@,쀢?@ @&@ؒ @Ւ @Ғ @@H LX(@vib @"D@Y @ @ @Hb"$@j HH"` b @j"H"`310|No cscope connections running%d%s 278|No matches for query㿐 ` 2 @@Xp     @’ $$  @ , % % 2$ " $$@ ~   L  P` !`?` '+ `@ @} @?  @@18` 2  2  @X R $ ``|! a @.G <   @. 3@2 $$`2@$`" $@@$ $`2@$`" $@`@ "  "` L"  P"`" "` "  @  @ sgdct efi311|%s: unknown search type: use one of %s㿘`SN@N@ "` "`N@ FN`  A&J##  &L`"LN@@2L 2N`@ ` #* *  !X@*`:`@Hc@Wn n `L  "  " L  "@bXY ) L  % L  " L  `  *@  `  !@ `     2  @r @|`#  @W @.&& & *`& @y@ *` . cscope: %d lines%1[ ]%s: "%s" x@b '*@` @Vޘ`@#( b@ۢ  ??'`@#(  @a '``? "`@iY``@  "@ 2`*@' #"   "   @@g  @qc 値  Z耢 U`"T@Ǥ@m܀ 2  @e   .@`@`@  ; ( $ @ / *@  ' @`@$  $  $ $  @$  $$ &"@&  &??_'@  @V  ` `  " "a``@WV @  8`( ""'%$@s@| 2 &@<'`   '@ 2'㿘@"%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ c@ 2 c@\#  c@U @Pc c@Kc c3 c@?   2 㿘@!@  312|%d: no such cscope session㿐 `` ``@ 2@`2 `@UY * ` "` @h` "`@h`@W @`"@`"`@`"@`, "`(@1`( @+@) 1㿘   " #b0 "    No cscope connections. %2d %s (process %lu) 㿘   @b0  %  @ ` 㿈 2$@K 2` ' #\ '' @s ` @.0 0  "& & L & P@y P 㿘@#`#@c˔   2 㿘``? "`@g@``@  "@>2`2` % `? "`@g$` >` @`">``? "`@g` ` @`" 2` 㿐  2 `|`  @6U 0&  `Q`d`l  2 Җ  2 `d& L@K " L  8& L buffersconnectionsscreenstags㿘`t `c" `s`b"  >`  `t", 8` 4 @qb( 2/` @@0 ' @qb0 2"` #  @qb@ 2` @  @qbH 2` @+q`  @5Ҕ 123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2 @S 0\!@ "( # `L 2  @@]  (T`D  @FZ  2 (T`8 2  !@ "' # `L   @@4  (T`  @F1  2 (T` 2  ! @ ********** %s%s (line mode) (character mode) 㿘À!``*` *  !X@@Dq` !!@ܐ``3% & ` *` *  !X@@DM@ߐ hT   @EƖ   (T` ޴@Ȓ2 㿘`x  "`t0       @8 7  @@8 . `t @B`@c`!@`|@Af a 2 `|!,@95  $ ($$ 㿐 @oԔ = @ `|2 @9 @ @pF 0# "` ""`   `2 L"`L P"PԒ "`("`$$ &$&  %ld 㿐  2 ``  @4K 0@ @I   `d'@ ax 㿘  2 `x`  @4) 00 ) %`t@ @v 2`!  `@AK@ ``?#? @`6`&`   h @ L@T  piperfdopenvfork-cexecl: %sfilterforkwparent-writerp'L'T'`'D'P'X"'ܐ "D 3@`۔ ? ''''\  '@Ә D@Ӑ耢 D @cc  'D@Q @(?D@Q ?"@?@`@dѐ 쀢?"@쀢?: @̞؀?"@{ @x @u ?"@?@@@D d` D\ * * `8@Dc\@k / D d  D\ * * `8@Dc\D d  D\ * * `8@Dc\ X @u D d` DD\ * * `8@c\DĖ(@RS @% @_@]\`'@Tc8DL@ǚ   'D\`\D "\L TT" "D  `X @*`X? 0$DĒ @Pǔ@ @'@kD@@c cH 2 @А #`Dc8L#\P@5> @@\ @kD  'c8DP@i   'D\ "\DP @x   '܀`T\TD L P   L PD  'T` D@GvD DT@?"@D `X *`X\  Dd @ DX@7 2 ܀2 filter read㿐   @ s 2` @0 2`  (T`  @Bܖ  2`, (T`"`,` @Ɛ@P  @c[ 㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppp  2 $`  @1֔ 0I@ ` @O͒ > `x "` `t@ "  "   L ` 2 ` \|   `  @1 02   \ 2 *  *   ꀢ \ " * @   2$ @1x  @2 L Đ #\   @Қ " Lٰ #\"   @ƚ 2ϰ  &  L P '' '@N 2  @ `<`t$`<$`@@$"@`'ƒ #P'@*  $` @O.  ؒ  $`H@$`L `P$`D  ,`P `| $@`|"   " |`l d `d |@z$`( (T`2@  @A   (T`@`"@`"`@`"@@`@U@pB  d @D4؀  ؘ    ??ܐ @   0 "/` `@"*``@@!`@ @ $  @   @N " $ $ $`@$ `<@2`@$`<"$`@`@(@o  㿘``@$2  [  @N U  |"Q P G<<B  : @ `2`? $ -$ 2 ?@'$ @ $@$` @$<"@@C@  $` `$` $ $@$`2" $@$2 $D2 P 㿘 @$<  $ &`$$ $  $    "@@ $  @N    @&%   㿘 2$$ @@ @3@ u 2  , " @  @@' 2 @А& 㿘`= @'G/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcȠ#Ȓ  @~  2  @Ɛ 2   |`"$Ε$&2 Ȣ#@ " @ @ H #@  " @ @ 7 @#蠒 "5 L 0Ȣ8#Ș#$@k @,  "    ɔ $@j @  2  @` 2[   |`"$/$&2O ! "!! *` * 8`? ;Ȣ#8 @ "%   8 ɢ  @՘ 2 8@<@ @ "    |`"$$&  X#\   5  @-q@@-@㿘 `| ` @~ 2`| @L 3  $`|" `|$`|$ ` $ $ `2 $ @q5 $  `$ $ @@q% $    $ $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@rƒ  @#` "` `" ``  `?`   w @Qo@W* / ?`@$ 7@Q^`  ` ʔ @K ʔ@ @Kۘ -   ` `thT >"hT@`  `  @K ʔ @K    ` `thT >"hT@ 131|No following lines to join.?!㿈 2 `d`  @-} 05@B  ː@Ks )   "'(T!"  x' @o! `|   t x@o! "  & t t x'(T!&(T`| "`d`l &`l`d`l@2`d`&`l`d `l   쀢`   "(T t(T x >  &(T t x@oG "а & t t x'(T! &(T @o5 L `|!I쀥  쀢 ?J 쀢 9'`0'J "쀢 "(J`)#ː @U ",@,`` ,@` ` J'` 'J "쀢 "쀢 @"@ @J?@  $@?"$P " ?"$P  @?쀢 ]&`l`d$L`d`l @@T ?$@@AQ  ` `thT >"hT@]  ` `thT >"hT@K`d h`l`" @$h132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@l۔  2 `!!@J  @ @ #: L @ ` 2    `2 '`  ` #\ #d#`@kK " Z ( `t KI `27`t  23`t ` 'S 'R  @;  "  " `t2`t ̀` "*` *  !X@@:֐@I   ` #\#`#d@j 135|"%s" isn't currently mapped㿘`t ``|!@ @k} 2`t  @@J  136|Mark names must be a single character㿘  2 `t`  @+F 0 `   @H`dh@I6  .exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0  "@@89`|@`|! @o ͐ ] &@o! R͒bX@[: ! "!@9E`@l' 9! "` @6!͔p@l  2,! "` @2(! "͔x@l   2! "` @2! "@Z 2! "` @2! "@[  "!͐@I  !@["!͐P @Iڰ X    `  @* 0?`d `l `h`p? ''?耤 ''?'''ؐ  M Ƞ `T /'' @^   & P"  & Lū139|Destination line is inside move rangex 2 `d`  @*+ 0`h'`l'`p'`T@ '쀢@ ΐ@H    8`T   '"  8    . @@ג 2   "'(T!"  x' @l! Р耢   t x@l ! "ư & t t x'(T!&(T耦@"@G` &@ @=܀ 䀢   @k䀢 ܠ@"ܐ @=ϖ ` 8 `  '" "&  2 @=a wŐG A @<٘܀ d䀢   @k䀢 Xܠ@ݐܔ @= K`` 8 "   '" "&  2  @= 1Đ ` `thT >"hT@/$L`$P 8 "l  '"   @? 2 l $l140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " "" *` * 8` 2ϐ@F  306|Vi was not loaded with a Perl interpreter㿘ϐ`@FΒ  142|Preservation of this file not possible143|File preserved㿐  2 X`  @( 0$ @ ϐ@F  @^ 2 @= 2 @_   2 ϐ@F  㿘`t@5`|@5- a 2 @,} "  2`|a  $ @,  $ ($$㿘`|$`d@8`l  `l $ L`p$ P㿘`|"`d@%`l  `l $ L`p$ P㿘`|`d@`l  `l $ L`p$ P%6ld TOOBIG x  2 `  @( 0VU PЦ"?bH#!Ѐ"'䀦 b@@c''  @ 24  @;E܀ ܀  $@"X  @ 2  (T`  @8  2 (T`2 " $㿘 'PP$@ 28  (T`  @8g  $ (T`2' $ ВcP @ "   (T`2   @8G   (T`2 А@KbX  [ynq]㿈" '" *` * 8`@" ѐ!'  @Q 2J @ @:쀢 2A  ` @= 26 `  '&  @+ ^ 2$  (T`2   @7   (T`2 ѐ!'  @  2 @ %c㿘", ""$"$ *` * 8`2$#Ā "#ĸ$#Ā " ## * * `8@@ 4`$2 @\ 8 }%@??yѢ"Ѐ` @x hT p  @7}  2 8 (T`2e& 8:\??‧`V  , *  !X@@5ג ,  * a] @@5Ð`2 ? 8@@T-??"*)# 8 @D"Xb @ hT   @7$  2? (T`2 &??ݤ2v@& 㿘`$'L'P'T'X$4L`4" @d$4$$4J`3 @)㿘N@    4$4$(@@@$4* , :`$$4 ` N@  `@㿘 $4 4 h $$4 㿐  2  L`  @% 0  P'`|`'`Q `d @Y    $ L$ P㿘`| !@2 2 @$ `  $$"&$ !!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable `x   "`t0'( @ @ !`#X`   #P 8*` * `2 `  #P " `  @%o 05 @    @)i  @) 2!   `x!  2 `x2  `  @%> 0?` "`t@1`t, @5@ $` Ȕ $ `@`tc@$`@ `tcĐ0Ғcݐ$`2$@&$$ (€  `  @$ 0$ &$`t  @#\`d 2 ` @&`$ & L& P@g- P  J  2 `x 7  "`t2`t@[!   ` ! @gG "  @` "  ?#? @2   ` 3   蜟@ Ӑ@1ʒ `t@ @$ 0NӒ`@B% T @E  Ӑ@C ; < @  @" T @UӐ @Bc 0'T   @1  ӔH @BS`d@! $ `d & L``d & L 147|Reading...148|%s: %lu lines, %lu characters㿐 !   0@ d 2, (T`,  @4Ֆ  ` (T` `2 ,   hh , @8 >@" ͐ @1@U: ,Ӏ 2'`/ @GBԐ @AҖ    ` `thT >"hT@  Ӑ@B @U `hh  㿘@ 㿐``x` !`t@  @|    $ &$&  㿘`|     "  ` "  `  @#o 0`X@ž149|No background screens to display 㿘     Ր8@AQ 0I     @` 8@ ?@ բ a`   Ւah   T   @3  2  (T`єT   @3Ԗ   (T`Րْa` 150|The script command is only available in vi mode㿘$  Ր@@  `x    @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@OΔ 2 @ ? @@  $ & $  \$ $  @u?2 `Րp T d ? $ `$ d`h @ϔ?Ր p  @ ?Ր@@  @L?$ 0bՐ@@r  ?" @ ?b @xՐ#c@Ċ ?Ր#c@ā ? Ր#c@x ?@f ~@  @}`a@  @L  @I  @F @ #d`" #\#\ * * `8@@M / 2 Ֆ @tՐ@A` @2 @  2  $@ @&$T  "TselectError: timed outError: shell: EOFshellh    ????'' Й2+ @  * "@      @Ғ f "@  ''  @@ ` גa@ǔ   ` " "a@> D A   `"hT`t@hT >&hT`x  `t@b`x "; &`t`t`x'hT!&hT  @b䀢 % @@@5I 2    ` `t@hT >"hT@Rp Ш  ????'' @ $"  2`* `(  "  ` 4 2$   @:? "'  ֐@>  '@$" `2* @ :@ `"@  2 2$ `@5=̀ 2̰     "'(T!"  x'Ȑ @b $  #  t x@b$ " $ t t x'(T!$(T  `@$?  @ ֔@= } (  'S 'R  @/   2 ̦$ '̖ @3 V  * C$@Ā Ā %a  ????''`Й2+ @  * "@ `   @9 @@2 +  '̐ @3k  ̀& L& P& P@%    ` `thT >"hT@!㿘  @@ $  @=   @P $ *@ @I   5 1 . K2!K )? K"? "" J@K `J@2" KJ@ `?Ԕ  2" script-shell㿘` 2d  @*@$d@ ?" @ ?"@ٔА @  @ @$`   "(T@䠀 "(T 2(T߁"(Tttypqrs0123456789abcdef㿘@ ؀ ? J `T "+ `M`耢 F-"  p,,  @b   t "!`/:?@B,@ܐ!@@ @b ?&&@@.Β@   `g@b @~L 2  M 2  " "a?㿘`x 2` @KI   `t @H " %s -i㻘 3@K 1  #dښ"`  #\ * * `8@#\  @Y$ h  $3    @  h $@$$ vfork-cexecl: %s㿘'D  3D'L@JÔ D d  (€  D`  @ 0u(\  D$`"$ DacЀD\DXc{D@d` DO D@;v L D cd " c\c\`* * `8@@ / D cd  Dc\`* * `8@#\D cd " c\c\`* * `8@ L@ޙ D #d` D#\ * * `8@c\Dږ@N"hT@M `2J :` E2D N #N " "@?@b `"hۚ"p : #\@:    ` `thT > "hT@d  @@:e   tt tttxthtHt@t(ttss s sss ssx shsXsHs8s srrrrrrxr`Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘ܖ!` @  ``1:!ݔȐ@W (㿘@ 㿘@  152|shiftwidth option set to 0㿈`    @E 0k c| " ctct`*` * 8` ݔp@92 V  dlј  N t @'J " ctct`*` * 8 `'J` >" c| <" c|` ` "'(T!"  x' @]%! d   t x@]!  $ t t x'(T!$(Tdl  @.1쀢 `쀢 = @. M  # &  cĀ  c`* * `8@ c  *`  8*  @w.&`@*M   $ ``L"  ` ` "(T t(T >$(T x   t@\ x " $ t t x'(T! $(T@\ ~ c, cĀ`  c`* * `8@& c& cĀ  *`@ *` 8    , ?@@"" "@/ ` `` `thT >3"hT@; `L2  `P$ `P%@@ "@$`P %` `$`L$`P@\N`P` `` `thT >"hT  @ݐd `pl`" @$`p%s8`t  @^s F@ AȀ   " @ " 2"a@`  @7 `@2 ,@@ɐ@ ș>`̀@ ȕ>`̀ " "a@ސx@8͒    귚 㿐`|!2  @&q  2  h€    2  @\  㿈`x `t`@L@ `L@ " "2L@@hd`L  ``\2.  P . 2 @L` \`2 @,`  @,` L@  @ꀢ \"`,L $ 2$ @ % @  Đ #\   @W 2    #\  @H  #\ ؘ @< Ȁ 2  & L@` @@`%@"` "& @& & L``@2@``Ϣ*`:   :  ~` L@ 2*`   ` hT!"`x' @Z  `t@Z`x " $`t`t`x'hT!$hTL ' ~L` \?` ~,` 827 @"D `"< *` * 8`2) @ "< 2# @ 2 @"D ""<"< *` * 8`2  @ " @  @`   @,` L@  @ \"`'&  @ @ &  @6    ` `thT >"hT@ @c   ` `thT >"hT@ې@㿐 ؀2$ @͔ !  @  ܐ #\   @' "`x `x  `t@@b 㿐 2$ @ ! @  Đ #\   @ "`x `x  `t@@6 153|Count overflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found㾈 'L  'P`  @A 0<! L ' P '!| *` * 8`!| L. . L ''`'J@ y @?* : `i}"̓*` €`\ b&`\`\?^&`\m5 "LL&@  "&LJ 'L "2`l֔ @4   &`l&`d@+ 0L@,$`l *LѰ  $' $`?`.   ?'' `?.  '  ' $@  'PL 'LJ 2 @LJ`2 ` 2 $ " $`  @ 0$ "`d `  "`di0`d `l'' '''' L@)̘ C  C    T!"x/''   "TtT >&Tx t@Xqx "= &ttx'T! &T@X_ ZL@'L ' '   L   ? ?(P@ @qY  Ӓ `'8` $@24 (,@2/     !*!@' @Ð  @ ' @3  " 'L? *@  ' $',@''̀'''$ 4 ' 'Ԑ& P& L@  ax@8ǔ @ ؐ @&a o ")  (k @(@f иȐj 2[  2T  @( I  @/䀢 q"E  y"H(   B    &L@ $@  2!a ! ' @  @W ' @3<  )L@,@,@T' 'hT !"hT& L  @ B  $ & P2)@ & @ B 4  2! !   ' @Ӑ  @ ' @2   L@$@[$ L'@ @֚ 2 ',` $ú  ` * @  !*!@' @  @͐ ' @2  "'L@@@'  ! @  / "  @) b   \`  & \ $@ " '&  @)T I L@'˘ A   "TtT >&Tx t@Vx "R &ttx'T! &T@Vt oL@ 'L' "!@' @  @? ' @2$  "J'L@@' `   L `  )  !*!@' @Ɛ  @ ' @1  "'L@N@@'   @  / "  @(L    \`  & \ & " ' @(   X `& X & `` 2' "!'''̀`'ԐЖq$Жh" Ж_쀢`8  (T`  @$/   (T`  L@ 2& P P & P@U P  `    ` @&`P@  $@ @10   !   ``thT >"hT@1   @   9'@ @dddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd㿐\'H'L T ! "!! *` * 8`2 ! "! ! "!! *` * 8`2`!䀢 "!`!䀊 "!! *` * 8`L  LH L @ `    `""`  $@ @ $*@&$  $ @ @ $ *@&$S  HL@y 2e ` HL@ L@^ 2T   @& L'L@͐  & @/  H@^LL*@    ` H`thT >"hT@А `" 'HH@p  2 @ `$ &$ $ &$ [[:<:]][[:>:]]㿐 @` L ["l"D \ *f ."e"Dv ~"H"Dp`(m L < [ *' ."&"D_"""D ~ >"  V""DR O " "<"< *` * 8` 2A ' "D " "<"< *` * 8` 2/ +  ""<"< *` * 8`2   "   "D " "<"< *` * 8` 2   2~L  &&    T!"x' @S8   t@S-x 2&tȰ tx'T!&T`@ ` ~ \L [  \ * .""D. ~"q"D.`(. L < [ *F ."E"DZ."A"D ~ >Q."#"DM. . . . . . .  . . . . . . .` ""<"< *` * 8`2R.6 "3 K."D ""<"< *` * 8`2. " . 3. /. ""<"< *` * 8`2  . ". @   "D " "<"< *` * 8` 2 . .Q &&@& ^.[]$*㿐 &   , T!"x ' @RG  @ t@R<x 2&tY tx'T!&T@  J? / ? ?  J?`$ ?   N / ? ^ ?N ^,@ `?  ' \N \2 NN  / ?2N  ?@8 ".?.   $.&&@& ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}㿐  @L@ "?` &* @* $@   *     ` hT!"`x ' @Q @ `t@Q`x 2$`t9 `t`x'hT!$hT@ ^. `@ʔ  ) \L@` @   @8o 8 " @.  @. ?`@   $. &&@& RE error: %s㿘 @kT @  @- 0 @kF( @-@㿘'P 'L'TP'H N L & \ ” `"D ""<"< *` * 8`/   )*  `L?ڀ`O  H*` €"D  "< *` * 8`"<   *: ?Ц* @ ?@ @  {@ `?2`` ?t `` H"@3 @ `   'R  @o ' "    `L0  `L0`L ` `   `L ` `  *@  `@!*! @.@k  @,P M-`      ` 'S 'R  @   &   @2  ` & @*` @"*` &  @,  耢 2 & Z  * "  +& ) "    0  0 L ` `     L ` `   *@  `@n!*! @@Ԓ  @+ -2LL "P"T"                                                               X#\   9  @ @@ @   > $158|No previous tag entered㿘`x . 6` "`t@`t@@ $` @+  #Ѐ " ## * * `8@ "`@Q`(``*` 2 `@*  @`@ " @   @\> j$$  @\6 , b% % 2$ " $$   L  P`  a2`| `|a !@ >  @Ð 5@2 $$`2@$`" $@@$$`2@$`" $@ $@g "  "` L"  P"`" "` "   @m @h@ 282|Already at the last tag of this group㿘 2  @ &  @ 2 `|@@*G   @V "   $ H `$ @ `  255|Already at the first tag of this group㿘 2  @x &   @ 2 `|8@*    @ "   $   `$ @`  㿘` `@ &`` @ @6   ` @Y   $ >($$ 㿐` `@  &` @F G @    @ @Gk09` @@$ @ @GZ 0( "` "`"`   `2``  "`("`$䠐 >" "$@ $$$ 159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @@2`x @ b   "`t0ST  @&J@ $L @4;@@) 9 @]@@ /   @#'  @8 22 @@*2  2`|  @~~`|@ 㿘 @  ``|@  @,  㿘@   @  & L & P@  2)    "   #`  `3 @,  "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @Ɣ 0 "@([ 0xd @] ;9753/@`` ` 2 `@      ܖ 2Ւa@"` 8?• @`  8݀ 8 @!!!  㲐㯒(@@2 (T`  @   (T`2 㿈 F`@ d  '@ 2Z  "` "` " @2 ""@"` ސ"`"@@2`$@"@$` "@"쀢 "` "`` "$`     @0 $` @'r  㿘@|>  2` @'e  `$ ` @$` $ $ @$  $ &  㿘`  ` !@|  @'?  @~` $ `$ $  $ & 㿘`  ,` -` ``$ @{  @'  @~`` ($ ` "&`   $ & 㿘@` `"``" @ `"@@{`@{㿘``@ @`&` "`@&`"@{ΐ `@2@@` @`$ "``@@"@@{ 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found㿘`  ` 0  @& 0@@'Ғ 0@|$㿘  N@ @  /`&@`()@@{>   @&f $ @{4` $  @&[   @{N @} *@, $ $  "@$ @``2ʲ` 㿘 Q@ 5 `  @{" 㿈 L@ `@8'@0 1#  ' '#\@D @% (  " #\ @Dߚ "   Q 0 2 & & L & P@J7 P 162|%s: tag not found%s㿘@~ @W' ! K  & &   &  & @}/   @J     ,   2)& p@& `  3 "#   2   c&a@&Ӓ   ,  2 @z{   163|%s: corrupted tag in %smunmapclose  'P@L   "! ' @u#  "#\    @}  "! @|' 0P@ @P@( 'M  `'J` @"J@  *@ '%`"`'@}_``@ ``2P P@}J 2>PP@*]' @*X  @$     t@T >"T@y    ` `thT >"hT@y@3 <@P.@`@`@V  , ( $ @| / *@  ' @|   $ $ $ @{$  $$ &"@G& @{ @$u @{͐  @$l  %s/%s8'N /"@J `@| / ,@`@$@A@J  /`@|&' /,@㿘&2  : @L  @3 2&2  : @L  㿘@@ "@? @0@@N@ `뀦@ J(88   ?J` @ : JJ@  @ *J  @  J@` ` 2?302|Vi was not loaded with a Tcl interpreter㿘@#  8@  8$   ݖ "m @$ $`2@&`" &@ L $  T    Q*  * L#   L  @sY 2C @e ؐ @- 3?`  "X*` €A @=      @G| " $ ?`" *` €쀊 䀎   ` @J?`\䀎    @ @J?`.@ &`"` @&@"@ذ  A Ѐ  $` @rט 2 @w   @r˘  @ז$`$ @@2`&@"i&`  @2   @~2| {䀎+  @ J@  J "` "`@  $   *  *`?`" @ e) `"&"  *" 01 @''  @F "G '  @y  '' @ |€ $ $  @@ 2( |@w| €@B䀎@  L `  Ґ  * `$  πѨѨѨѨѨѨѨѨѨѨѨѨѨѨϤ|`dhhhhh%c%6lu %.*s㿘@ "" """ *` * 8`  `@""`"@`@o. 㿘#Ā " ## * * `8@#| " #t#t * * `8@` ` @ `L 2`@`A$@ *L@`7$@  @`1$@`+$$@  `@E”` 2&` &` &` ``* `&`    `?`* `&` 㿐`L`P'' '@   , ` X 2 4  . X& 4 4   @Ր 2   & 4@y    & 4@v $`L$`PTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘Ēab0ܼbhbܸܴb The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x S `t@`L  ` `*  + "@`" @@@>H` 2`@  "``!2`  @ `*  *@`?c`0g!`9#!X@ @[@ 2 ```)#0Q"6@2`(#!$ [/@ @ ]*  /@` //@ ``*  / * +`  @`` @  (T`  @  b (T`b0@u The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x e `t `" `  @ 0 `~4,`[`]`~ #`~=$ "## *` * 8`w= w =".`@` `` "X*` *  !X@@lQ ` J b ""Z? =" #w !.`$ "## *` * 8` `.` `.`` 5"``~4  (T`  @6  Հ`~ (T`Ѐ`~ @u 㿘\  @wÐ.`@*`" @& & `& d& l& h`& p |!6 |& t & x$ x t( "`"@ x t(" x"@㿘  "`,"! `0  `,@CU`0 "2 $`,`,`? &`@1@  &@`  ᐀ 2  $6` ` 2 ,2&2&   Ť167|%d more files to edit㿘`2$  0 , @"  ("  " & 0 `@ 2` ("@ :@Ȓ  㿘 (€  "(\$   "`" " "  * * `8@!`  & 4!X * * `8@!X$& 8 ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 C#. €0@9 02%!`2@p @ђ 00x@ƒ 0@  0@hxVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.㿘@  175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " "" *` * 8` 2 `d@k   " & L`| (b  - @  ^  ( +  . L P#  "`@A L ` 72``|   L`X@:!  LА@:! 8  @ `|" @d"4$b2$ !  @+ܘ $   @+՘ $`2$@&$$@  `& "@{p' 2 2 2  ؿ`  &$ 㿘@j 2  @  2 k&`x㿘@U  2 @  2 `| aӒ `  $$"&$ 㿘@4 㿘  2 X`   0! @   2 @ j 2 `| a `  $$"&$ ! 㿈  2 `|`  l 0!  `x `t@L  "  " ^2]`dL !2Y`d#X "#P#P *` * 8`2`      `  5 0L  "  " L `  " 0@tn  2 $ &$`t `d#\`l+ 2 $ @2 ͒` `d `l@ ` "``x L >L  > L`L  "  " L `l`dP @t 2I `x 8  4@qO`t!   ` ! @@: "  @p` "  ?#? @2   ` 3   蜟@  @ ~   `l`d@253|Writing...%s0 `\`%'@! Q 6   h  @ X @-@O  ?`& * &@= `   @Y d Ґ (T`  @ ٖ  ` (T``@hZ 2 V@jΒ  <  @LAV 2  @.J 2    X` @1 @.9 ``h  `%'@㿘  2 `|`  ɔ 0  `Q`l`dg ---------------------------------------- 㿈  2 `|`   0 "$``X " $X$X *` * 8?`| `d ( @('  @``4(cZ`, @ "@ &`d&`d`d?X&`l"@  &`dO&`l?2 @ "@&`d&`d@&`l L ' P''@ 9`?2 @ "@&`d&`d&`l  2> # &`d&`l 20 @?`&`d&`l@ ' @?&`l&`d` @^쀢 2 `l쀢 8&`lҐ  2& L /tmp㿘`,`0`0'   $`4$  @$`0"@  @n@nӐ@) 52  @K'   @Ɣ `# b@( `0@ n  & @n @  `0&`4& `02`4$`0"$`4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only` `   ?#ߐ @6`@5 `6` @J \ 2 `X @^  ? $`T,`X$`H$`$`x@t | `t X @(N 2<`!xx h`  !p * * `8@!p  @6ْ$@7?x@ `@pt``` 6`@ Ȑ  &` ` 2` @  &`` "@m @ @6y`` $` 6`@ΐ`D-  @; cB + gB + 3`   8 " < `X x|  ,`X$`<$`@$`D, ࠐ @   ??  ?/''T2   '`@0B `L'@ ] $`L @ ` `X' ,`X  ! @,؀  $`Ȑ@̒  @[ 2}`@W 2w` "     "@  ``6` @ @ X``?# @6` ` @`H@ "   0 `! 6`Ш @z  $@`  `@    )  @&ܘ @ )  @&՘ @&  $@@& $ @&$2 "` @l&`` " `X@5u@l` &` `X @"`L@5l`L`L "`@l$`L`  @@lՐ`^ %s/%s㻘`2Lf& / .L / . L / @>M`?P&@>G 2"Ȑ H&   " * * `8@" - !  L : 2 ?:L,$@54#8#,@> 2L ` @lC  @j   @nՐ@l\`&`& -c option㿈  & L& P $   `2 $@ L q L 2 & L& P #ah@o o  \I$ $ @s L Q L 1 ; ` `& L`&$& P!l "!d!d *` * 8`  & L  @ & L  L  @ P쀢  & L& P P쀢@8  L& P@;9 P P L ''& T '@+240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@  L $  P`$ `14  ".`@4-  ㈐@ @k   $  0@ "4"`  0@"0"@  @k@k~& ` `"@  @ @  C&@@f@F`X` 2`H`L " `P@3 `L㨐@ `P " `H@3 `P@ `H?"`T@m`T?"`L@m`L "`P@k.`P @k(@k& 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters   @$ː     ` "쀊 """ *` * 8`    D"8A"p B$ " $$ *` * 8` 3`  @;   ""k  `@;ʒ  "#@# 0 @; $ `   X  <@ @@ D@ #8#-   &"  @$  !0 !( * * `8@@ " @;y!  `Ȓ @ 0  @  㸐 @##@'  `@ @l @ ''@  2 '@#\#`D`@;  " X@aD  ,X$<$@$D  2 @ y  ?  5  X ,X `@㿐 5 @<0` @ p@\ HD@$@@1?8$? 8@i 8 !@lv@@ OH /@  N@ /2` 8?:`@  ..@.@.@@ <    ` `t@hT >"hT@h 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b'H! "$! @:[ ?   ! .HT N#\    < N N  @k 26    @͒ @jݐ)      (T!?# '`*  2#  @7 〥@ x*  2 (  t t@7 x Ҁ$ t t? x# '(Ta$(T @L*`: `% `/L  %" *"  *L    % d,@,`,`@ #P ,@  /,2 @$@7#`@֔ 4@$ ?@!?  `"@@0X @@9 "*<  `@@  6  㠐@ E$`@9a! : @i 1 ?#@@i 4"H@i H@i  逦   ` `thT >"hT@g~+ @iא`@/@iА`Ȑ@     ` `thT >"hT@gT 㿐  @  "  yJ@#$! &$ <J`#2j& L  @ 0^ ,/*J` *&$!&$ ( J@ *J` /`?' '  @\ 032& L/J@ /+J` /'$!&$'' ( J@ /J` /`?' '  @) 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X7 1!$ "!! *` * 8``  `@   ` # @m  @B264|File modified since last complete write; write or use ! to override㿘  X   `H@?  @265|File is a temporary; exit will discard modifications㿘 "   `@"  4  `2 @  266|File readonly, modifications not auto-written㿘  `X !$ " !! *` * 8` 2"  """ *` * 8`  @Ւ    = 㿘 `@e` & @t &  @ 㿘"8 " "0"0 *` * 8`   @.& ?2 1 "@ݒ 1 "&!@ B  ! #@? ` 177|Empty file㿐@`` @   @o  ` ` @i`  &`&``&`` .` 㿐`` ``"*` 056`2@ &@ @`  @?&`$&@` `&`@i{ "` &`&`&`&` @.``?@`  &``&` .`@e 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``; \*` €@' &@ `@(`  @ '&@` ` @i `  &`&`` &``  ?@    &` &`?`&` .`@eA xxP㿘 "`  " " 2  ` "  079|No non-printable character found㿘 `@k͐ @ @N  @J  @F  @B #!! b @,RbS R@:  ,R ` *  `LJ`    ,p  `L @J`2 ,p p  @  㿐 h " !` !  2" 2   b!*` * `# #b㿘  ] *` , !X@   - ,@`  㿘@ 㿐bԀ /b`. (8b``@" b"'/``@b" bxbx`. (8` 1@ `@ LH L/`_  L   2b ^/`@ ?/`I b"bb`(( 8! \ȱ6  \/`/`   8 8  (@6`?'` \ x/`/`  @0@ /@@`/'`)㿐" /a#@:ɖ   㿘 a (aaa a`2 a 8 aa ("&$aa@ @ `@* @@ "aQ a .a*"@ "a* + " #H*` @g* $aaa*`" a* @0$a `"$ @$`$ `$ ` $ `$ `$ ``$ ,  'S   'R  $  $ , ՠ  㿘`  ` !  `@!!! "@@ `@ @@!!*`" !* $!*"@ `*` # -` $ @, ` 'S   'R  :$  $ ,  0@# `$ `$ ` $ `$ `$ `$  h`   @2p `A6T "xՐ 2b x1 2Y `?` #Г*` €  @RF   hT "hTg 28 A25 * "@*` ` ` &@`&``&`` &` `&``&``&`? $$ $\ ` Y`L"W ` L`  ` 2H @ : I  #\ @. Ԁ 5 $ "$$ *` * 8`2`| y ` 2!! "!! "!! * @*`8 * *  _* *` *  Y* &`L `  `2@* a@&@`&``&`` &` `&``&``&`? $$ $"  "L  2  a .` &`.`&`} * "@*`  @0S `? "@`$$  $  # "## *` * 8` J F  @K> xؔ  2     (T `"(T3&`     " ݘ  2&    Ԙ   * "@*`a    Ř  "       O &&&&&&&&㿘   "  @$(   @$276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event㿘`?` .*` "x € !h        0 P p@ % ` @` @`--.T---.T.T...(.8   """  ( (  㿐 !@*`.`" "**   '!@/  2$! @YK $!   ` 㿐 '@ ` @ 2 `  @W  ' 㿈`K'H ` 월 H 2H$@"#` x |`      @`2@ `'? ;`H@" "@'H`H 2&` *&` H ?`  ? 2H H@ 2'2&  &`&` &`' `& 003|unable to delete line %lu㿐  'H ) @ @ Ӓ  29 H  22 H@ H ''    H H@    @($   ?$  X " X@" X`, XH @ 004|unable to append to line %lu㿈  'L Ԕ J L ?''   ? L L@@  4  @*$    $  X " X@!ɐ X`, XL @`L@ P L@   2 L@B   005|unable to insert at line %lu㿈  'H v F H ??   ? H H@ c 1  @:$    $  X " X@!l X`, XH@ H@ H@   2 H @    006|unable to store line %lu㿈  'H  3 @ H ''?   ? H H @    @"$  X " X@! X`, XH@] H @ 㿘  ` ߔ  2  $@  x |`"   `?   `?007|unable to get last line㿀 `2` ꮔ G  &@$@"?  x |`" 6 ''`  ?    @ &@ &@ / ,  ,  , $`$`$` $`$  | @  &@ 008|Error: unable to retrieve line %lu㿘H@U 㿘$ 2&  @   "  2  @ 2    @009|Log file㿘 &`$&`,&`(&`&` &`0 "! @ &`  @@  `X  .`X㿘` "` @&`` " @\&` &`$&` &`,&`0&`( 㿘 X  , L",P "0 ",P @"0/usr/src/usr.bin/vi/build/../common/log.c㿈     @+ "& $   ,*  @`  ( ''  ''   ? (  $ $$ (c@̔ ð 㿀 'H X " ,b ` , X  2X $ ,H Ԙ H`E  ' '  29    (   @+ ", $  H*  @`   @` ( ''  ''   ? (  $ $$ (c@`! 㿈  X " ,; V  23 $ ,    @+?  "' $   *@  @`I  ( ''  ''   ? (  $ $$ (c@!W 010|Logging not being performed, undo not possible011|No changes to undo`  `X`@  `( `x @ 0c@!z ,`X`( '' `(`$`(   ?`[!*` €"`( @_Ք  `X `P,`X @_̔ U B  d & dĒ @_  Ė 1  \ & \Ē @_  Ė?    XĀ "`( `& X & `  @_ؐ''@  `(@[ `X  ,`X@x@ @@@@ A$A012|Logging not being performed, undo not possible`  `X`@ ~ `(  `x c@C!q ,`X`( ''`(`$`(   ?`S d*` € @_1  L@2 `X`( 2`( `XB  @_!  L@"`(`( `X` ,`X3$`( @_  L@2  X   X "  `& X & `  @^ؐ''@ 2 `X`(@[B `X  ,`XCCTBBBBCC013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  `(`$@Ȓ @k 0c@"I} ,`X`( '' `(`$`(   ?`^#H*` €"`(`(`$`( @^}  `X `P,`XĒ @^t  Ė ?  \ & \ @^c  1  d & dĒ @^U  Ė    XĀ "`( `& X & `  @^>ؐ''@F  `(@Z `X  ,`XEtEFFLFFEtF015|%s/%d: log put error267|Log restarted㿘!#h@)Y @Ƙ   @ @ exnexnviewviewc:eFlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s0(h !&(h(  ",&(  0!,  |  & & |& . p& 4&!0`& & & & & 0&!,&!@@&!D   @`  @` @`(    @ "(T   @&(T     7!`80!*` €!  "!(&! %`(T ?!&(T  t r  rt "!  t  ` "!( 0@/ 0?ƒ?a`*  `  @   (T 2  @!  `  "@"` 2 & "`}& d "d ""` 2 & "` 4&  f    6 ?Ȁ )"@` 2"@`?"@@  L `!@!2@[''''''@ `   @0  (  @*  C  @$  G  @  "  "   * * `8@"4 ` " XX* * `8@`"8   r}  d& r  2 `@  ~ ` X* @*`8  2 "!   ` ?"d "dש   ( "@[= @W   & "! @ ` @x" $" (rd "d " 6$`2 @ Ȓ   |$@   2 7 n  | `d&  @ d ] [ $`!@ @Y ؟@ D B  2(d耢  2(d ?" `  "`") $` @`ѐ  2$  @ hh@   @FKKKKKKKJKKKKKKKKKKKJJKKKKKKKKKKKKKKKJ\KJxKKKKKKJKKKKKJJJKJJ%s%.*sex/vi: 㿘   . @   @  @  @ @  @(T !@3<b l !b%#  b  @3)` "` " l 2 ---c$-s㿘)' (N+L +$L  @Vn  '&@ `* `* `*8*@Yې@V^  &@ - c**@ )` -2&`L   c@VI   &@ "! @*   ( * ** T t w2`J` "``@ " @` 2@ %s: %s 㿘!a@2a@2` ! "a@Ԡ!@2@2a"`8 㿘 `8"``"` @@V"`8`2@ 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@   `"`*`#  `" ` "  2 `` "*` *  !X@@  & &㿘``" '@C  %@Uq    @ / 2 `8 "`8"  "`8  8 " "" $"  2     $ , $  , ,   8  *2㿐`  ` 0<@U  8 "6  * ? `. &  2 ! D  2  o      8 "     &  2  020|Error: %s, %d: : %s%.*s㿐'P'T  'X` C `"@ ?: `7#*` €$ / $$  8$*` * `$   T $T$$  8$*` * ` 0$  $@:b@US:b   "b$   ` `t@hT >"hT@T, '    (T!' @# "%b x  t x@# "%b$ t t x'(T!$(T` b@ @Vΐ @ ``@ <; 7L $ " ` "* *  !X@*`:`r@ ' L  "@@є 'n@0 "@@0P^' X`2  "a!$@@"Ȗ@' D   ?  .ڐ 蔒 !bД@0;   ` `t@hT >"hT@S%b[D\[\[㿐! "0 !@$!    ` `thT >"hT@Sa aa````299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedaHa8301|lines300|line%lu 㿐$@#  & X# * * `8@# \  ,    t   ,"@0    "'(T!"  x' @"N" y"  t x@"B" m$ t t x'(T!$(T!,`     9 3" ; , , ` !X@` ` @ ' @ @@UL ,@ @ @U?`@  $Ȧ , `h    ` `thT >"hT@R317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈  @U` '  * (Ta  ' @! z   x  t@!| x m$ t t x'(T!$(T  L@ , @  * @ *`!] '*:`c' @ ` *`* *  !X@:`Z@T`L@` @ :, ,$@' $ #@  `@   `H@ @6@U; :, ,$*@&$ `  ?# @2"````p@@T;   ,, ,  X```@є@T   a  ,, ,`@@T  "쀊 " "" *` * 8`0  ,, ,`@@S   :, ,,쀢 |쀢 `Ȕ@q@S" @e`ؓ.`@*`@*`@J@0 `@Q@u@Tz ,$'* 8@&M /   L /2 $@8  .$? ,?,?,?,$' h    ` `thT >"hT@PېLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@ / "#L  2@QB#` K  @Q8#p K  x@T$   @!  `\ 2*"`\*   ?'`  2` 2 `c@  " `@`\ "`\ 㘒  0  h "`\ @  " h㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`"#4.` €aa a b8bXbh@@Pnnnnno㿀 L@ `9` `3` `-N` |) ?@'䀦    "` h   2`  ?& *? `@R&㿐&L   L@ J` " L L  @ J `2 L  2@Oq ` `thT >"hT@Ob  @O5 + .&  (T!" x!' @z 1  t x@n  1$ t t x'(T!$(T17 p &L `(?& `*` * !X@*:`TJ@ `.J@ * @ L  * .{H{8{({{{zzzxzzzzzzzzzxzhz`zPzHz84z0,z(z 4zzzyyyyxy4yxyyy<yyxyyxypyhy`yXyPyHy8y(y yyx@xxx@xxx4@xxx xxxpxhxXxPxHP x@ x8 x0x(xxxwwwriteanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase}}}}}} } }x }p}h}`}X}H}@!}8$}0%}(+} )}/}1}3}9|6|7|5|=|<|A|;|>|>|H|M|H|J|K|Lwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s/usr/share/vi/catalog/report=5paragraphs=IPLPPPQPP LIpplpipbppath=%srecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionhР?'''' >  @  e#`.#   @  Z"`."   @v N!``.!` 2  @j  2B#X!`.#X@L"!Ȁ !Ж$@A@Nڐ' @ " !@L!耢 !$@&@N'@~  ! ! ?/'@N'@i  " "7?@N'@V  " "'?@N'@C ͮ (8$@ِ@Nr'@1  "P "P /?@N_'@  -"`  "`????@NH'@  %−$@@N6'@  &⠒$@@N$'@ m *"  "  ? ?'7@N '@̔ V 1"@K;" "$@Z@M'@ < 3"  "  ? ?'/@Mܐ'@ % 4# # ?/'@Mǐ'@  5# # ?7'@M'@q  8#( #(7?@M'@^  ;8$@@M'@L ""֮ = "  * @*`8 ?2 '̀ ̐ '@$@А@Mi'@( "  /h`€̀ 2 ̀"X$  " " " "  *` * 8?'P$@@M9'@  H""`_  !     O  "" 0G   @  @ >  " @? * * `8@ @x ,  "@?*`  * 8`    "  * * `8@ @T + @J$  ` @?"@* @@ @L'@} 2 @`@?*   "- `Y  all032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀  `  "@#a 2 $   L " = ?2  =`Ò   L ꀢ =`'-@`@( L n L o  '@ @kR b% :`,*  `2 ` 2  @ `?2    "  0-   "᠀   "Ѐ"` 2  ,*  a "   *` * 8`   *  a "    *` * 8` 2     @    @ܘ     2²  4 2  @&/ 2  ( 2  2    @   @  " 0` `L @ `_@n `N"䀤` ` ` "X "p @H9    ` `thT >"hT@G䀢 뀦   ` `thT >"hT@Gn+ J A ? "> ͐Ȑ" Y耢    ` `thT >"hT@G>䀢    ` `thT >"hT@G*  @   "XȀ  ,*  a    *` * 8 @À   @ʖ 2     2   2 @% 2  ( 2  2   "  ` 2 "   s- 2. ,*  a "  *`  * 8`   *  a "    * * `8@@ђ "F   @J 29     2.  2& @$ 2  h 2  2  @ " @F `2` @|㿘.`*  !`  @ * *   8@ @ې       2&`` "&`@F&`&` 2 &@@ "&@@E&@&@ 305|No %s edit option specified㿘.`*  !`    * * `8@ J 2 2  ".` %  %ld%*s  5  8@?, ?  8  ? @?# 'l   %`: `, ``"0`  ,* *  a   @  * * `8@@ *  a "   *` * < ܐl* אg* *  a   @  * * `8@@ *  a "    *` * < *  a "   *` * <`3*  /*  a "    * * `8@*  a "    * * `<@@Q }*  !`v* @E* @ ! ,!@HF` `.?S ! " @@ *` * 8` "A@? !p%#`  @ * * `8@@  @ { @H' ! "@@*`  * 8`   *  a "    * * `8@@G?l/`" `* " l'l `=@ @>@. 2`   @,l"/%- `' , @*`@=@@l %"Ȁ&ߠl @%",``*`@@l@ l%l@,`%ȁ%s%sno%s=%ld%s="%s"㿘"&@`: `+ `"A+`0q+` *  a'"0   *` * 8`  '  `"'"8@ 0M+` *  a'@ "@   * * `8@   03 *  a'@"H  *`  * 8`   ` *  a "    * * `8@"Yset %s set no%s set %s=%-3ld set 㿘"`" 2  %`):  `>,` ,*  a "@ @  *` * 8`( ( (`P(`X@ɐ` ,*  a(  h@  * * `8@@   @` *  a "@ @ *`  * 8` `  (`x@-  \2`` \?`&``@ \@* &@@`?`&``@ @* &@@ `L@ Ӏ ` =?`&``@ =@* &@@*  a "5   * * `8-@  \2`` \?`&``@ \@* &@@ϒ`?`&``@ @* &@@༒`L@ Ӏ ` ?`&`@* &@ @੒` @ 햔    2  㿀)cT"8' %@2  1 * "7')"P' N@   0(' @E  JL & 4@  2 `  " JL & 033|set: no %s option: 'set all' gives all option values㿘)t 㿘@g@㿘@a@㿘`@D#"`  a  ,@2l @ 2h  @  `*`` * 8` 2 @      F " `* * `8@      ( @ "`*` * <`2 @ " @ " `* * `<@ m  졔  `  M`㿘"   !  ,@2F @ 2B @ "*`  * 8`  @  @ "  * * `8@@A^ @ " *` * <`2 @ " @ "  * * `<@@A>`  M`㿘  B    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘*    *H ! 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !*В   * !ڰ 0   `?$`  & $X * * `8@ $X $`   *@ *` <  $\  *@ *` 8  HS (P  H   a H  [ B $`2 ` & $X * * `8@ $X $`   *@ *` < @ $\@  *@ *` 8 ? ( ? H  !? H   044|The lisp option is not implemented㿘+@  㿘u 048|The paragraph option must be in two character groups㿘@Cs +   㿘)$ $$ $($"$ 㿘$@  @p $*@&$$ @@pu $ *@&$ 䠐   049|The section option must be in two character groups㿘@C  + Pʒ  㿘      㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@   *` ( 8: 0    *` (8?" " 053|The default buffer is empty054|Buffer %s is empty㿈`H ! `2A,+   L `  *@  ` !@`` `  `@`` 2@`2,`!ؑ*` * !X5 b  '`4 2X  2``   \ '`& \ '' 9 ` $B? `' '   \ '`& \ @ '   ' 쀢 2     "(T!   ' @ 耢 U  x    t@  x "߰ $ t t x'(T!$(T쀢 @ @@˔@@'@@ 쀢 `?"  ` '` @  P  ' `@@@$ ~  X y  `& X t& `` $'쀦    "(T t@2`(T >'(T` x@(  t t@ ' x "h ' t t x'(T! '(T @ 耢 `@`@@O`@@H` ߫$ 2,  X " `& X & `   \ '`& \В    \ & \     ` `t@hT >"hT@=%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 *y T." " "" * * `8@@ " "!`.@ .F 2..? +.@j֒#N` N .$@ܐ@!?.@?z@Ր &`L  @.  `X  @.`X057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X @, XB  P `0, X @m 1. +. .(h b  € . L  hh  . hh   L@jE! X `@, X砒  060|File backup failed: %s061|Copying file for recovery...㻘 "| X @ v ` €  / X ,XLp跒 c `` X ,X`P@`K  *k 2D " " "" * * `8@.$@@8!?'/ (h` L@  @>  @ " @@>z  hh  ` ` L  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Nvi recovery program)To: Subject: Nvi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r 064|Recovery file buffer overrun065|Recovery fileX @\@}ޠ  /\   *g 2 " " "" * * `8@? /$@@1!ؒ   ~  /)  2 @%T %P   L  / @9 `!?"@#@!@/##d//?cp##`#h#\@//#c#l#p#x///#t @cX@6@<n0@*@00000`(H` `#`#p#x#\#h#l#t#d0`#|#0`##/00#`@d 0婒 A , <@@’ & <N 2& <8N .&@<20٢ ?@@ @<͐ 0 l    ?%T @< .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 *H ""  " "" * * `8@@gӐ  11@!p   1x` x 91715/3//1d-1!@&  ]@䥒ᘤ WT  K   @H0I$@. !@@  @  $@ cX@   @ 2* 0,@! "$!@ \  ! 2T@90 T@4{ @@@@  `1@!@ %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover('H *t ""  " "" * * `8@@+ H.ƒ ?  ' ''1a@W  2 h$@ @ Д   r       ''@;o0$@ #/c@@#  2@( $@ٔ /cX@   2@ 2 ,2 - p0N,@! "$!@ x   '! @R0;@ 6@3 `'*@t  㵔 @h  ` 㪔 @8@8@8'@:@:@w Q @v  2 ̰ 01 `2Ȑy  2p H  @8_@8]@:   "`P"`TH!2 `X  @*`X?c @  ? ? @:I @?@:V 4.  .o  㿘@:A?@@  "  ;   @: 0 㿘@? ..E 0@e2`/usr/sbin/sendmail071|not sending email: %s%s -t < %s 3#@ y 3  0 3@@(@ ~㿘& @ $ 2& ⾔    x   $ $ $ $ ,$ |& `$ xa$ ` "d@] B$ d "`$` $$, ``@ `$ `@% +$ ``Ā`$ `@  $ ``܀`$ `@ $ ``䀢$ *@7@ $  g  耢 2` _ 0`$ `$ @9Ȕ9 d$ @$$$  @  &@ 㿘 ? & m `"$ @ " "`  @""@$ @(&$@  2 $@2 x $ "  x@6  @6 $ x " _] x " @6 "$@6$@" @gj  ؀ "$@6$ @" @g]  " @6 耢 @65@6` ""@   "` @  "@" " 2   㿈 L ؒ 2s   ` `!@ h ` K2N   'N2 ' 2$@ K @D`@ Ě `  #\  2  \2 @J` 2 @` @*`J@ 퀦2` 2'"  Ě `  `2 `2 #\ 2 `@2&  㿀\ | 2ڰ  B @ Y 2ʰ @`20/ `  ' A  $ " $$ *` * 8`  @  `  d  t @  d @    $ `p@Ӓ l`$ " $$ *` * 8`   `Y@ U`;  "7  ? ?    @  "  ` d@0` @ & &@   ?&     (T`    ` (T`{``@ x\   "``@`('䀢 #@ $ " $$ *` * 8` @0  Ԑ瀧 '`  d  ɸ @M  d`@@ ``4` ʐ@ ƀ $ " $$ *` * 8`   @   䀢 䀢 2   @  '  ܀ ܘ ?    ?   @Ք  b +   X쀢T䀧`/-@ *  ?쀒   @ )  e d@I   쀢 `B ?  쀢䀌 &܀@   ?&&  ?'>` (T`  ߖ  +  (T`& @p 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`!8 (.` €777 7 (7@7x޳ 0@4M߰078|Searching...㿘 8h`@㿈`#\\d @Ț 2 ``  @  "  "$ @3l$ |$  @Ȓ (  g ` "!8 $ @ $  "!&$ @ $  "!`$ $  @Д $  "a @3+  @3%@3#$a % 0 $ $ , $ 2 !D`$ !D"` "aD !D $  $"`"$  J@  @ 2H  * @*  㿐#\ @&  @㿘`" "` "@ @2@2   @2@2 㿘\ 2$  C!D*@ 2< $ 28  @J  @85`*' 2# $ 2  @ 4 `& 8  " `2&@0  $@    `2&@ 㿘!D " @2]  " @2W  "@2Q`"  "` @2F"!D 2  㿘 !D  @2 $ 2}  -9 @` *` *  !X@\? `@D %@$ !9ޒ!Ȥ$   @` *` *  !X@0? ` , (@ %@ !9!Ȥ$  @` *` *  !X@? `2}%s㿘 !D2 $ :`@`G  |     'S ` `? 'R _ 2`` ?`&``@ @* &@@x`?`&``@ @* &@@e2 ` ?`&``@ @* &@@Q "H` `C  |   'S ` `? 'R  2`` ?`&``@ @* &@@`?`&``@ @* &@@ 2 ` ?`&`@* &@ @2@ " `   ?"` 㿘"*! @0@0Ӓ  ۸  &@4&& 㿈&Ԙ쀢 쀠'`?   "  '' J ? ' 'J   B&㿘@ / 2 㿘@0:  b @2̔. 㿘! "@$!&!``"  ?  㿘! "@$!&!  "   #@  @   %lu㿀`0" @` @ * $$ @  8   L  &$ ` *@  `  !@` `  `@` ` 2@`2. * * !X@  < ` ` '; `   X ̭ 2&    ̤ 2  2 ``0(`;`@U 8  ̊   㿘 !.` !`<!8*` €@- @̒@e@ @?@0 㿘 !.` !`<",` €@ @:@@ @z@/ "!ԝ㿘@ "`@ ?`, &`@ @2 `<&`H&`D  "a 㿈`0 ` *!  "a`48쀢 쀢 /6  ( @`8`0@h'` @ 'J @  `," `&`@`@" `<`4 `8@ `<`@&`D&`H 㿘@ 2  `@ `< &`H&`D&`@  "a㿈`0 ` *!  "a`4֘쀢 쀢  9  @L0  `8?`0 '` ?@ 'J?@  " `<?`,&`D&`H &`@@ `8?&`8 178|No previous F, f, T or t search㿘=XS 179|%s not found㿘 `= !* *  !X@w6 a8T@"Z h`(Xh [X rx6 D hHWxD8 KXW(DH  WxD  VD  pKX h PD@  H 8X  (   T  [H    x h 0 ( @   0  PD   ,  h @   0 R8D  =D@"  D  :C(  xnD@" h PjXD@" @ WxDH  LD   VDH  h ` @\@" 0 :(@  D , pPL, 8[@"d (` 8D hH8ƠD  F TEHUTExP) @  UEUE`@"* x`H P( 1\ F ` X8 D ( hD@ heD@ `H8D @ 6D@:B"( TD , pX 8 ƼD F 6 D *H hWxDX@VD0PD :`@"+ I XK @(28 F  <D h P8Ϡ h@ED@"x8D hPAD@"@ p  ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A㿐`0 2 " ` `4`<  NZ 2I P; 2A `Dɽ` 2 24   &`D+&`H`D     ߖ  &`D`0   >`H @ &`0 &`H`0  > @&`0 `4X#\    D@ @207|The Q command requires the ex terminal interface 㿘 (€  D(\   D L#  a P "  3 $ $$0  `4`0(`` `4p#\   @/<`4`<X#\   D @>`4`<X#\  v DH @suspendX#\    6] Dv @180|No previous file to edit Eѣ     2 X#\     -@)ېD@X#\   9   !0@)(@p#\ ;    @!`0@ `,>"@"@b`4p`< #\ ٚ  E" $ f  2?  $'4@. ! /  x 8  L &`D P$&`H@;r`4p#\`<    "`$  e՘     $'@$'`   p0p #\ , #\ G  x @&u@㿘`  €@   㿐  K f`!T "!L!L *` * 8`   @ 2i     Ԛ  2_ @:$ ` ?"`* "@Ï Q}u@=M < #` ,  & ,| `@တ@r : 2-  x 8    @Ő 2  ` $ &$@= 2 @ 2    @&㿐 L b  $ L $ P P ` $ P L`0&`D P ~` &`0&`H 㿐   @ 2= @ 4 @QO  ° 0*  "` " ` "  ` 2. L`L  "`L@&  "$@&$&  307|No ex command to execute㿐 L    L   @)K   Fϩ    ܚ  $  "$$$ 㿐 ` 2 @  2    `2&  ɒ 2 & ` Ś`&  㿘 p 잔  "        X `*X %#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number # +. + -( @( 00(   @Ԓ  4@  G 8 L @ `      `2w&`P@=̒ J`0+"`( J  X x2#K@ L @ `   *G!@:` EJ `XGa M a I K@ 0`` L @ ` & *:  8! 9Ga . `#K@ + - @  LG a   G @ `L   Gl  D!G !  `L03"00  ` *:  8 9' @?Ȑ 8&$ `L @ ` $`L  ` *:`@U!  $@# $` ` (T!  2' 9  x 2   t, x " $ t t x'(T!$(T @@'/- 7x|  t - |  `#" b  |`6   " W | '| @ "ᠠ|@e d$ Y @ + xx8  6 @:"/  'xx@B d`c c@&ɐ@&Đ"@@&""@"@ 4'J @(` `` `thT >"hT@"P182|Resulting number too large183|Resulting number too small㿘`  `` I0 @"I3 0/ 㿘 @!̢  &`$a,$a !H "!|@! $aD   !D@&O!H!H$aH!| " !@%R $a|   !,a!$a!$a 㿘 !0 "!D@!!D "!|@!!| " @! ! @!@!̐&  㿘`1""`H`%"#L% " ! #D * * `8@ " "" * * `8@@@*Ɛ㿐`4   2    ?& P   *`" *  `ē@x @& `4 & L쀢 쀢 2 ' `"  P @& P `0#\( `#`#d @ 㿘& P`4 P "    *`" *  `@@x @G & `4 & LH쀢 쀢 2'  " `0#\( `#`#d @2 㿘@  㿘@ x@   L `& $ 2\  2 ''D  & PJ#8` '*`" *  `А2 L L5 25  L 쀢 2,  L  Ø 2!  L & L 쀢 " L ?`0#\쀊( `#`#d @ x`0`4 >`< &`0 쀢  쀢 ܐ @ & `02`&`8! "!! *` * 8`2`4`4 " `4`4`8 2ܰ `4& L`8 & P  *`" *  ``;`2*`0`4`<@%`0" ``<`4F 2  "`0h#\ `#`#d@4 " ``4`<  F 2 `= `8 9`4 ; 2~     `8(T! ' 耢 > x  t x "\ $ t t x'(T!$(T@#`8H: 2G ``4`8" 2= `4& L`8'& P`4Ř쀢 쀢 2'* `8 :`0#\( `#`#d @    ` `thT >"hT@]x@  & `4쀢  쀢 2'!   " H `4 &`<?`0&`@(`<#\ `#`#d@c x@K  & `4N쀢 쀢 , ' " `4`0&``,  &`@ @"`8`82`8@!f3 `, "&`@ @" &`@`8 2&`@@!" `8`@ `, "`< @`4&`H&`@&`D " `< @&`8`<`@&`D&`H 㿘`, "&`@ @" `,`8 2`,@!^   &`@ @"`<`8?&`8`< `@&`D&`H㿘``4W 㿘@  㿘@ 㿈``<  2 "#`<0*`<  8쀢 2 `@쀢 *`,2`, `,    @"`<`0 &`0 `<&`@`@ "`,f @W "`< @`< `@&`DV&`H`<`42 `4`@`8@2`4@ G `4 8 `82`4`8`@@( `4&`4`@&`<&`8&`@''`4`8&`D.&`H`< (`@ &?&`<  Θ 2 쀢  ?`4&`@'쀢  `8쀢@  `0 &`0?&`@ 184|No match character on this line185|Matching character not foundpܖ`4  lԀ Ԁ  Oް `8؀ OfJ >"7 ] )" < (& { [ޔ }ؔ!| )#P (!| ]#P [!|  }#P {!| >#P <`4' 'i 2   `2`    `OÒ m `4&`< &`@2`<`8 :`<`, " `< @"`<`8&`D&`H`@&`D&`H`, "M  @"H `4`<@`<@`4  'Ѐ 24  Ѐ :`4- `4`<@`4Δ    ܐ @' ؐ"  ?J@    ؒ`?'܀ '`0  &`0㿈`, "`4 @"`4`8 "`0`4&`@&`<ꖔ`@ 2 `8`@@8`4`0 &`0`4   2`4`0( ``, @e "?  ` g h@0``"?@H ?> J  .?"6`,ۨ2٨ (ը !|J` H*:  2J` 2H "?H@2?J  `"@  2?2 `, "&`D @ &`<&`@&`@`4S`8&`D&`H&`<P&`@@B`4@@2!`,˘쀢 쀢 = :&`8 `8?@ `,`2`,@> ) @ ? P`0 > @&`0&`<` `,  &`@ @"`<`4`8`<`@&`D&`H 㿐`, `4 @"`4`8 ?`2`0@e`4  &`4&`0&`8`4 |   2s `0( ``, @i "`8 ?  ` i S@0K`"?@J ?C J  .?";&`Dݢ2ۢ (ע !|J` H*:  2J` 2H "?H@2?J  `"@ 2? @Y &`D&`H&`<&`@ 㿘` @ @`@"! @q  2  Ę  !| `@`@̔`@Ɣ&!| 㿘`0@@p`0(* (``0" ` `4`D- 2 `D`H&`4&`8 (T`2       (T`  ؠ? 㿘`0@@5`0(* (``0" ` `4`D  2 `D`H&`4&`8 (T`2   ܖ    (T`  ؠ?  `πR4( 2  3  4  5 6 7 8 9*`(JJJJKK KK㿘 h€ 186|No characters to replaceh``4 "Ѐ 2: Ѐ2 `0Rxý /  ``8`4? &`<&`@@`4 F  $`@2 2 ؐ X 2 ?` +T *` € 耢    .!<&!@d $$d @  @25 Πڰ հ ` ` (T!" x '̐ z̀ Ԁ  to x " $ t t x'(T!$(TԐ@wЀ'!@ "`4!@ 2`8`4&`@Ԑ`&`<`8 2~ `8ԐД"@'Ԁ`(' a "aa`*` * 8`Ѐ Ѐ  JԒ'Ԁ` 'J Ѐ А@" 6Ѐ "$&`@ a "aa`*` * 8`2`4&`@ "&`@`4  @ '    ?&`@   ?&`@`4     @+  !<@ `4~` `` `thT >"hT@`<`@&`D&`HLLLLMHM(MHMHMHMHM㿐`4   !G  `0(`8`@`&`@`8?@2`@`, " @2`@@1 & 􀢀 ?`,`&`@`@"`<`4`8`, "`< @`4&`@`8&`D&`H`<`@&`D&`H 㿐`0("(`<` #`4&`@t`@ 2N `, "` @" ``8`@@8``0 &`0`&`@+ 24 `< ,  "( ' 2`,`,@? @@  ?` &`@`@"`<`4`8`<`@&`D&`H 308|Enter to execute a command, :q to exit187|No other screen to switch to㿘$@@T  @" #  2 # T      "$ @ #$㿐`0(` `  ǒ 2  " @1`4     " &`<@; 㿘`0(`<`? @Aj   @' 㿘`< @A\   @ 㿘`0(`<`? @AH  @  < @" D ,"" H 0 4@@ " 02 4 8:  4? @  8" D" H 8" D" H㿘`0( ``4@ "@ `@&`H&`D&`< @`4 㿘$@"0 @2`4@0㿘`0(`4`@` 2`,@`4   &`< @"`<`4`8`<`@&`D&`H 㿘`0(`&  `<@;Җ   `< `@&`D&`H㿘`0(`&  `<@;   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @T  *` * 8   8$X* * @@  $X@;  ?`<@;k   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @  *` * 8   8$X* * @   $X@   ?`<@;  `< `@&`D&`H㿘`0`<( `@;   `< `@&`D&`H㿘`0`<( `@:   `< `@&`D&`H㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@   @ p` / ?#@ "#8#8 *` * 8`"" ""  @x 2߰  x`8 ـ 2` L&`< P`,  &`@ @T `< `@&`D&`H $ `$!$  !`2 L@$! L  PJ܀ 2 $ ܀ 2&`H`  "l `<d&`<h&`<p&`@`<7 2`,`< `   Ob &`H " @  @Ks`[ @L zcW L @ `    `2 Ӑ *`:  + ^  ;W   W(   25   2, `<W0@c 8   2  aȐ!2a`<`@&`D&`H`0 > @&`0  8 &`H&`D 㿘 ``"     @t 㿘   @j %s%s%s[[:<:]][[:>:]]㿐 !4 `   (T!" x' —  (  t tt x 2$ t1  t x'(T!$(T X!0XX( a0@ : @@    ` `t@hT >"hT@189|No previous search pattern㿐`,   @2  !`"!`" #\ `#\`4`<ݼ  `4`<Ϛ " `, Xܒ  @u "`< @ @  0`<`@&`D&`H 190|Search wrapped to original position㿈`4`<@`8`@@ X M "`4`0 &`0`4`< 8 `82`4`8`@@( `4&`4`@&`<&`8&`@''`4`8&`D.&`H`< (`@ &?&`<  ј 2 쀢  ?`4&`@'쀢  `8쀢@  `0 &`0?&`@ 㿐#L " #D#D * * `8@ " `, "`0 @"`0`8 "`0`4&`@&`<ጔ`@ 2 `8`@@`0 &`0`0( ``4R NJ{ `, "J @ }2 J?2<`{")`,0&` H&`4&`0&`8`< `@&`D&`Hx`8`4 '' 2ư `0( `  j   e 2 ?2[ `4@o`8䀢@k  ``2H ?2E   T 0 O0-?IҒ ݠ?B )?`T#[!*` € ` `" `` 2 ?2   T  I   `4@ `8䀢@ @J ; `,&`< /&`@ @"+`<`8 2!`@ 2`42`@`4  &`<  ˜܀  ܀  ?&`@`0 &`0?&`@`4`8`<`@&`D&`H klPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlkklPlPlPlPklPklPlPlPlPklPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPklPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPkx`4 `8 2`4 `8 ''l 2 `0( `  A 2ذ         {   2 p  ."  ? e !0QP ^ \> ` )" ]" "" '`   2 `4y 2t `4@9`8@6 \`` " `!''` `   ) ] " ' \ 2 |&`<`, ,&`@ @"(`<`8 ! 2`4`4 &`4  q܀  ܀  ?`0&`8 &`0  &`8`< `@&`D&`H㿘`4  㿈 L&`D P@^&`H 2Y  !`$$ L ! $$ $ P  *` * 8`2  $ " $ $ "$$ *` * 8`   #`#d#\  @  $*@$$@h   4 2`D$ @$$`D $ L`H$ P4Pa"a"a"a@"aD"a<"a@D"((aa : a !!  !"!a *a "   (.!"!@"<"@"D 㿘 4 M a& <a& Da & @ 8 < (  hl€  @ (  < *` * ?@"a?$a" " "" *` * 8` 2a @7 2  !a@a a$a 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾨`xd`x` \'H`$d   @:$ (6$ $$  $  $ @ $ 5֖ " $ $ 2& " & $ 8`L $ `P$ d@ ' "  $ (' $ $ d@@   d    @A    $   $ $$ $ $d@d  *   $` $ $ $ $d    *      $ @/$ d@'' d " d|d|`* * `8@" dx`8" " dpdp`* * `8@ T ', 'd2  d@  *@'d d@'  /#/#d@'''4 '('( $`L  @&$`P a H 0@d( R 4 "d 2 '!\ `4@'4" ''Ē%!\%!X%!T@&@& ?` e!0*` €d $'$d@&n؀ ɰ 0 @4 D`d@ 2 2 !D  *@ 'd `2g d !% aT aL`* * `8@ `@aL `*` * `8@ J @" @& a a`* * `8@ a  *` * `8@ J @"  "E$ 8  $@>$ 82 @O4  !'  ]@ d@i''d @%`. "!H*   !D!H "j%!D-`!D"* #"" " """d@ -`"!D* @``"  '    $( ? '( '(`?   ' ( $ 7$ ( 2' 0''``L   `D`2 @  '?`e *` €dh@  @-ٔ   d@@]  S   $@q o$ 8@T  @  0@, 2Đ0d2 (  d@@h(d "   ` ?$ $   $ 4$ $ 0 @-  d@ (@ 7$ ,4`x  J@ @  ,  $ ,J " , " ,B"@ J " , 29  , 1$ ,J " , " ,)   a  a`*` * 8` `xa `x `xJ J " "  2 0&`|& `x@2`|$`x"$`|& & ( d `*& ` x@u 2` `` `thT >"hT@ |    @Z    `8& \` X2 `"-'         و "֐& `\  X@@@ \`X@  @  & \  & `& (X& '  ( 2! 2      X "& d    'd*    `& &  @,|  d @>`  *@ ` '` 'd@$* ($ $ ('d  $@ $ 8#   $  @  $ 8(d@(T  @  0@r, K0;d(  d@@(d  d ` ?$ $ d@@`x@  (d "    @ ߒ   (" $ d @ ǒ`x         ذ "$   *@  ?$  @+ڔ  ذ 0  @d 2   @d 2 d  W`"  <`"" 0F`}d $@ wd''   g "'  @ t  ' '`^d $@ Xd     *? $  $ ("@  $ ($  `Ed $@?@  @   $ @d a$ 8 `x@'d kΔ$ #   *@  (   @ $ ($   2  `x@d J  $@(d  @ $$  @ (   @ (?`$   $ ( J? "  "    d   ( $ ($ # "  *   @J?  @ 8 (# ( $ ($ #   *@    J? v u    ?`L ` _2'0 '0 @ c  ( $ ($ # "  *    @ L ` _0 0C J? ? = @ 8 (9#  2  `x@\d   $@8  d@@  @ $$   (" @$ (#     ?$ * @ 8 #$ #  /#d$"@b  g d@ ' d*' ^, (   ?'i'( d'd @`L  `   ] d@2d L  ` 5_12 2 T   0@9, 0d @"  (  d@@(  L  ` _  d@ݔ `   (?`$ $ (  `'@t '"@'b$ $ d8@ H0 0 "     ' '       J "$ d  'd  *  ` $ $     '  'd@$2 `!`  @)Q  h  "!\`!`2 '@b Y '!\ 2dT d@4   @' @ 2 `!`2# $`L @ $`P@  - #  H@# " d@(Ődd*  $d%!Ld@   H"`D H" H@ x \ p@@ lxH||0|0P|x|D|x|x|x|x|`㿈'``$@ ` 0  ? , * L ` ?_? ` ? `2?_"?? ` ? `_  2?"``$2 @@  D'@'@ 2@ #\  C 4/    2+      " `"&` *` `(&`("  ``(   @ @ `( &`( `$@ " &`' 㿘` ` J  2``  @`$@2@  `$@2  @  ? &㿘&``y`$ u` q@8#&`&`k&` " ## * * `8@` `?`  ` 2 2 @& ?`? L@  @ ꀢ` <  7 @ޒ&@ؒ&%$@ "" %@ $@``"@"`&`&` ,@`  ,@` &㿐'P`' A  nP P8 'P `? 'P J@ "P P@2        '  "  @ % @'   @ ' 193|Already at the beginning of the insert㿘2 4@26f / ( $  2  *   `$ $   ?&@&`"`@"@- `@&   㿐#Ā " ## * * `8@#| " #t#t * * `8@` @  `J  @$ ` * @ *`!]   ``@ @Ӓ%@@̒$`$ `    (`` `(?`$`&` &`(`J? "` "`` @  `J  @흒$ ` * @ *`!]   ;``@*`   @~$@ @x$@$`&`  /@S ?  /@G ? 㾨&`  ` `` ` ``` L@  2` ```$  $@ ͔` "$ &`` * @,@#\    + C2 2 C֖` ,@ ,@ " 6 2  d@ @@@[@ R@  <  @2ΰ  d@Ȱ &@ϒ 2 ? (`-  `* ?@ @ 2 : @@@  " ݠ`@   ` ?,@`` ``("@&`&`( `(  ?,@`(` `&`&`(`2 + ```  $@ ` "W &````@` &`&` @@??  ?,@?` 29 @H 21 <  2* `( ?` ``  $@ ”` 2&` `` `@˒` &`&`(` / &`,@  %s %s%*s 㿐'L @'H@R / L@H$L` `$H`*  L@@  H `%L @ @  * @ *`!]   c  2 8`ߤ@릒 $ "@ *&$ '' 8,%in@H` hT`"    ` `thT >"hT@Tf @U?H@  @NH@^ 2    Ji :;i9i7iL,`%@ahl    ` `thT >"hT@T (H@@ !&hKT` Lih^T`* iahST`2ThrT ?%T $ &$ 㿐` 'L!]J@ ؀  @`L@! * *   '(Q```   `p` 2&`K `  "`L@ @@u``&``(L@`&`(J`  $'L , ` * *  !X@IL 'L @,` ` $L+ `@#] 㿘@  `2`& L & L$& P @&$㿘` ` *``J   @"``$@J  2` ! "$! @u ! 2`(`` `"* `* ``"`" &`&`*`("` `` @ݒ` "  ```(  @Ғ 㿈@`( Ȑ?&`(` `*@ &` "`` '` @ *@ `@ ``*@*  * a] @ '~ &`(`J`   `@ ՘ *  * a] @p'"c'" 'V``   `R` " &`"` @ `(@` `@W ``(@`&`&`(J `   ??(  *@??`*'  * *  !X@@ * ?`?    ?*@?` ' `( `"  &```( `  @ "'```    `` 2&` ``  &`2``` @  * ``(  @ݐ ` `* `&`㿈 4 2M 8`4 `8&`D&`HJ?`\2 #p" J? \2 #p " #h#h * * `8@ @J "`" `4@J?`\"`4`8&`D&`HJK? 2 "`4K? \"  `4 `8&`D&`H o.!Ȑ`3!$* &$ 2b   @`4`8`D H`H''J / #\?`D  #\?`Dۚ 2`D& L`H& P . a  @ )  .` 2"  ?Ȑ# @2$  &$@& a@  @Ζ 2  h€  㿐@$`'``` 29  `@!  2/ ` x@@$`'``  2   `@   "@  @@ $*@&$ Unmatched %sx`& L`& P@_  2{ ؔ @)  2s ``?' ' 2g `) { ( %mq N   `` *` *  !X@w6 > ڠ ِ?؀  ܀@*'  & P& L@ 2 "P ""H"H * @*`8 * *    *` *  *   @ ` `H @"J"`$@?D"I  2` "`"`$` 3  "` `( "`(`  #``( ` ` #` #` `(` ` #`#` #`(I   ```#`@#``$@2? " 㿐( / @ x@2``, @@ &(8  ٘ @@("@ " & &&(194|No more characters to erase㿘n0^ 㿐`0 `4(#`8!``&`H *&`H#@$@&`H? @O ` 2  `  ؀ ? @  &`D 㿐`4 l 2!  `4`8`0  `<"`@@ "`< `< ܐ 㿐     (T!" x'    t x 2$ tF  t x'(T!$(T@@`@  L@   ` *`@ ` / * u 2    ` `t@hT >"hT@㿘&`H   X`*X R"4㿘 , "a  X 2`0   *X@4   "44   `D ֒`D@195|Movement past the end-of-file㿐`  @@ o @̔ 0/ 196|Movement past the end-of-line㿐`@  s `?@o @ 00  197|No cursor movement made㿘o 198|Already at the beginning of the file199|Movement past the beginning of the file㿘`o@ ooҒ 08͒ 200|Already in the first column㿘o " J     201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s㿘.p". €pHp ppO 0  pF0 p@ 0p(: `p̝㿘@  㿘@ 㿀`0( ``4`8 '' 2   '  !`,@ ? @ `a` 2װ ? ??!%5?     2 `,` `P@Y@0U  l נ?h`,    L ` 5뀢_ 5 L `_ 0  `_ 1 S :   ހ `,@? P!P2 `,P "`,O    U   ?`, " @`4  `8@`4" `,&`<  &`@ @ 2`,&`@`, " `< @"`<`4`8`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 ''v 2ǰ     2      ג 2 w w?r  n  2 E t "\`,?    L ` 5뀢_ 5 L `_ 0  `_ 0 E ,   ހ   "`,A    b   ?`, " @`4  `8@`4 `,&`<` &`@`@"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 '' 2     2      U 2 w w? ~ n  2 E6 k \?    L ` 5뀢_ 5 L `_ 0  `_  < ,   ހ  3 6       ?`4@  `8@`4 `,&`D&`H&`<` &`@`@ `8?&`8 206|No characters to delete㿐`4 r   s7  2 `0s/ , (`@`? &`@`@?@*`8`8&`@` &`H`0" ``<`4 2   㿘`8`2`0:' ( ` "@ &`8&`8`@ `8?`0&`@b&`H``<`4  2  c 㿐`0" `3  `4j`< 2# `4 t `<`" @ & t`D    `0   >`H @ &`0 &`H 㿐`0(` '  ؒ  `4'`8&`D`0 *&`H` "'`$` $X * * `8@  ``$X `"  * * `8@&``@~ 2y ` -" . + `K ^% `E@H = @B 7 `0(@9  2Q `D @"> &  <`D `0(@# 2; `D @"(  23 `D@   <`D @0 # 0" 'S 'R  ֐   `(  0 @    4"<@"D"D"<< (a("a@"㿘  X`    +      Œ  $ "$$110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0`  L@0` @h$0  ``  h  ```  h`Ȓ`40@ 20` L@Ȑ `Ȑ "0d``Ȑ("```Ȑ >"`0 ! "*D % "0 " @"$H0!" D0D@ @$H @ 4DzH )D@D$`LH$`P0@@@  @ 'P  " `  uH `(T`2`    2d`(T`"d`T  "T uxВ duɒ d@*@ $d` `` h`Ȑ`4@  2+ d( 7`$d` h  (T 2&d "`&@ `  *`" *  `2 Ȑ @  2 Ȁa?" @ 4Ȑ $`@^ 2 0!` ?Ȑ# @4Ȑ@`T` *`" *  ` 'f X' | `>!$(  L@`` @` w Г*` €=~ ( @ "'0 cX "cPcP`*` * 8`2 0 "0 `*` * `!X@B  @  `"`(p`0 $0`L'`P'`L$4$D$<`P0$8 $H$@``@֔ "0`(T`2`    Ґ`(T`2`ː0 ((2`,<? $<`, $`,(@€ dF  @"   @#9  W&     h4l,  ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modexب@ `? @   2& &&&&& $&$耢  쀊  '@ "0뀦      @  耢 쀊 2'@0b.&0 @  耢 쀊 2'@ L  `  0 @Z װ 0 (&0' @  耢 쀊 2'@'"4 0"  w0   @d  耢 쀊 2'@0b.&0 @P  耢 }쀊 2'@  ~  , * `!X@ u =, "@ D .0("'0& 7&0  ~@ X ~2&( d "cc`*` * 8`w&( w &( 2F0 . , * `!X@q耢   Ő& `t``,! 2 `00? `&0&( @20wXX(h&`0&`0".`@q L hD2" @b:@ @  耢 쀊  '@0".&0 `[`]`Z>z @{  耢 쀊  '@䀢(2 ~ d "cc`*` * 8`w w *  +  z8 @=  耢 j쀊  '@.L `  @ j 0 &0 @  ]耢 G쀊  '@.  w` !x*` * `!X@~= 6  @  *耢 쀊  '@.@ @      " `0 w   d@ @0#  ?????????'  @S Lئ@ '؀( 0( '@Đ0'ؒ w(d'&0@(w0` &0 L &4&8  L@   &< < I c !Cs&@  ?m&@( 耢@'?!&(  0  !А >&0`ؒ ~ L  P'''''''@€ 2O < `<  c !  : &@`&(0 !@!&0&0&,䀢   耢@( &4&8&< &@&4&8&<&@&D&H( @ @ L&` 214|Windows option value is too large, max is %u㿘  (€  2r (\  $ " `  $$"  * * `8@" $a !`  $ 4!X * * `8@!X $`  $ 8$X * * `8@$X 4$ D$ <@ z$ <$ DHΒ  4?$ @$ @ $ Ha @  "a <  *` ጑* ?@"   L" a"  a"$ $$aȒ`4aȐ   %d screens backgrounded; use :display to list them㿘 ``, ` ! "@x "!@` $`  "` @ $`"@$`$ `@2`$`"$``ڨ `@ $` "` @ $`"@`&` & `2` $`" $` {p?9 212|Cursor not in a word㿐 L  2j   P L @ `         `2  { C & P@   @ L ` _   L  :"  ` _   ""'a4 a0a4   $a0 a0@@a0*@㿐@ D S C $0 Y  _0  c $ d _ c y/.@     @=*`"@235|Number larger than %lux/ %|, *  ?Ѐ! @( 2#  L  f?  @  `L `Ց, &  㿘  2* ?` ! |"x*` € 2   hd€ 0@ ޖ  ` ʒ DDL,````lL%7lu $@'L'P !\`8= $ "` !&@ *` *  *  *   @  4 :  2" `L@ `'T "   tpp a &@ *@ *`@ *`@ *`@ 萟:`@ lh"  8" *` * 8`2 ` `" "`` ?@璐", " "$"$ * * `8@'`'`$@.'\"`  '\" *` * 8`0" @ `x|@@ 8 XLh _L T@ L@T !&@ *` *  *  *  L : "@ 8P"@"T`q`&`&` .`/.`" \@  ~\ `" $  , *  !X@T ,  * a] @@Xl@萰 tp08`T &`  l` "``3'l" *` * 8,` !@ . "+"@@2&"    l&` .`"` 'l" *` * 8`" 2 8@L 8"    " *` * 8` 0K" H >l   !'l`` #Ā  # * `8* @ # *`  * 8@$ *  * a] @h  lS 8l$?'lJ$@ Cl   !'l`  #Ā  # * `8* @ # *`  * 8@ָ$ *  * a] @W h$ 8h  ll$@?'l&` .` &` .`L`T@ L@ T P@  "@T + h hx'X'dަ l   $'l` ! #Ā  # * `8* @ #*`   8* @M$"   * @ *`!] ""   2.`$$@.`.` $$@.` 'd&`h HT?F`$ 2 d =` !&@ *` *  *  *  L : "@$@ P$"@" """ *` * 8`2$T T$@ T` P@ "@T T`@  X9x X $,X,(h x,$Xxx ` *` *  !X@@Z   @,`h & 9  * @ *`!] .`2.`\h``?&`.`  b5X ,x$Xxx  "0 @,`xl@x $ ,X萰 tp㿀$  d  a͒`p aa@M)|" """ *` * 8`2`` "`` 2- @` 2  ( a $@ + @ *`@ *`@ *`@ :`@ @" 8 X `a@(" 㿈$  F " !`h"\!\h!\ `$!` 2h $!d@!thp!l!pK 4 @? h hXhp!hhl@ 4 @? !hhch!``^!\ $!``2!p 4 @? h hl@!ph!lDh 2Ah!` < @z!t G#@ *"@ *`" *  !x* "@  +$!t!d`$!x$!d 4 @? !hh!dc( $!dhX  4 @? !hhh€ 㿘 4 @?  萔  h€ %s 㿐$   `  Q-Qnhp 4 @? h hl@` @ 8 8 hX@훐 8 @ "hXhh€ %.*s. ; 㿈$ @ hT ` hT hd€$hT$hT $hT$@`5``` h€  v> ߀`h\  "@B`2h\  @3 $*@`&$ h€ 0`2hp@g0` @ J?` " 4 2'  'X 8`?   P@ P@   @y $P'iJ J " "[X($  J  J  2  $ N " & J " "& & 2 " "  J?`."" @' (@   (T`     (T`hh€   'H @ '!X 8  "@ 2[ 4 4.!\ 2!\ @ ? l@@k!!\`!T 5!%!\%!T!\ @@2!\!Ȁ ?!T? %!\%!T5!!\  @  4 @?  !\!T`%!\%!T (T`  x  H (T`v  H @? H ?\  ?x&=N "   ,* a] @@ $@,@X,*  !X@??  @?,@`?` 2Nx@  ,@X$@ H 2l\  l@%!X `4' p!Xt.x  &@!!X ` 4!!P  $!P$!X$`  h€  "$s @2 $!\ *@g&$$* @ '&$ (T`2#$    2$ (T`2$$" @`?`@@@@ 2< $ " !Ȑ 4!  @"!$ @&$!Ȁ "h\$ &$h\  $?# @&$!\  '!\ 4@ " ''$!T$!\$!X@p $!T$!\$!X p ` hpԟhT  ?$hThd@$@*@&$ L  !`l "(\$ 2`l@_  "`lJ h  `"  "` "@@X @V`l 2 Ȑ 4\  2 @'  Ȑ 4  @  4 '\  "@'' $T $\$X@h԰ Ё㿘 4 & a\   @@ "@ "( (t€ `  4 @? ( (@aT @@ @p 4 @?   h  4`       @fhX!\$!T`$!\hl€h `2&@؟@ o   2hd q/hT $hT   q hT $hT :`2&@+=+=+=+=+=+=+=+㿘 8`8   (\ (X`(\  %.*s 㿘 @Œ  )@7 $ @ꡔ $ $  l`2@$ l& l$ @ 2@@ $@" "@$  @:!a @¢㿘` `8  *@ !*`  *  "`   `  &`  㿘$ @  @"$ &$  "  " *` * 8`2  1" " 1"$&2 ` aȀ" aȐ `@9` aȐ 2a耦`  $  !`  @"   '$  2$`€ $  $$h$    $$!  L L   @ 24 $ @&$ D @ "  ! L@:*!@a @`2` V 4 R   < @@`@T" 蠄? < v& < @@ r@(m @5 @`2` * 4 & \  < @@W@`  a "a  ! ? < ?& < @@ ; 4 @? ( (l@ < D($ L  aa" *@ *`@ *`@ *`@ (:`(l€ < & <?" < D@8  L   L@ 0@("$!2 2 L <  2  @ <`2` 0E C??""@  @??"$!x 2r L <  2   @ <`2`* > 2;  a ??"_"@z ??U"܀ 2"    L'!`' <@S' <`2` * L 2' Lܐ(  '!`  <' L`'2` @1 <`2`   L 2 L   @- 2ٰ $ @&$" " "" *` * 8` 2t$  L   2h$  P@R a L@2* `@:&  <`"2`8  (  a" @ $`@ &$@ ڐ 2  !`@  ! L@2-$@()$ <`$@2`8᐀( ᐐ"` @ $`@&$ @ ($@  2[  !`@ $ @`" """ *` * 8` !  !""Ȁ 2  L2  P@ ؖЀ Ѐ 2   P Vؐ 'Ԕ"@ @     ? 'ؔ  * @ *`!]  vؐ   ? ,`@*`!]  `^ ` ,` * ]  "@ N "@ \"S$` '" 2   K'ؔ  * @ *`!]  )" """ *` * 8` 8  8?:$$" """ *` * 8` 8  8?:  (p̟ ! L " "  2  * @ *` 8  ?   P@" "`" * * `8@2  "   )$# "## * * `8@ M   * @ *` 8 # # < `8 "  * @ *` 8  8   8?   ".$ 8 :)$# #* $ `* `"   8   `" ,$ !! ' $   a($   @2 ?'$ ! 8Z L@T ̀?" H$ !!  ?,   a(, ?'$ !! 8$̖ ì?" Ā "$  a$ @  D @ " <@ 8( (l@ @`@ (( Ā 2  P$` &$T$ L$" """ *` * 8`2` `Ȁ  ` 23 `2`` 4 `Ȁ  `$@`@<` (̟`@w T (€ `$? >&$ȔJ @ 4Ȱ *))))219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x A 4 @?  (   @   "(l  L` 8 L 2 ?29 ` *`* @ *`!]  :`})(#   bq b*  #   ` *`* @ *`!] $ :`} $8  ?`L /  9   bq(Xbl  b(Xb'L `* *  !X@*`:`|ݐ `8 *` * * a] @:`|Ɛ(X L  (l@ 8#( #  *` * 8`8## 3@ܐ L @ 2`$@ 2` ' 4 @? (  (Xb  ؐ (X؟# # *` * 8`2  #   X`2 * :تؠ$- 4 @? (#`" ## *` * 8`2 0   X`  bY(XbT(X؟㿘 " " *` * 8`2  " " @` 8@ؼ?"  " *` * 8`2 &@" "&@&@ 㿘  " *` * 8` ) 2 a a   @ 8@8@ @ " "!"a㿐` 'H HŘ` H  2'̰ ", " "$"$ * * `8@" " "" * * `8@"   " *` * 8`2  "  2M??' !`#Ā  # * `8* @ # *`  * 8@Ȑ&@*  * a] @{/ @ 8  $ @t$@ ??'E` !`#Ā  # * `8* @ #*`  * 8@J&@*  * a] @z @ 8  $ @.$@ 2`   "5@ $@'㿐  ~    ?0  T @ 㿐 ~ɘ` ˰ ", " "$"$ * * `8@" " "" * * `8@ 8@@ВQ : 8 $ `" #Ā  # * `8* @ #  *`   8* @ǥ$@ǡ$  * @ *`!] @ z?@ 8@* a 2 8  8$@Q ! ` #Ā  # * `8* @ #*`  * 8@U$ *  * a] @y@@* %?80 @ 8@  &@ @-$@ 2 ?㿐 ` `      ` @ ( @1"  < " <s @ "  L?" L ?& L"  L " L  & L!Ȑ 4!!$! 4! L2$`4!$@2 `2! !\`( !Ȱ  04!Ȑhp􀦠"00@ @ 2 !Ȑ  4!@# "   @ݢ h 㿀  <??!*??$ @ &$ jK`0 <'''䀢  2 @ʔ < 2 @`1 Ȱ '  < `'2`@ < 2 @( 2 <`8/ < !" !" !j" "    a" a"  a"   maximum option value is %d -- %soption requires a numeric argument -- %s㿀acH'  @ 2` @ 2] `&` 2 N! @&D@ ^N u2 NaH@] "  N <2  aP@R  `( 4*@  @w `!X @&@ 3J`!@&@ ) `(* N ^N `(`? `-   * `(*  &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 c@\ c@Y gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘   @' cH cH%  0 @ @'  2 @ː@Ɛ 8@':%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@ : 'H H+ 'H/-@ = 2,@,@`@N@ c `@ 2N@s&  i2 N@a@z 2N@f& i2N@a@m 2 N@a@U& $ l2 N@a@\ 2N@H& o2 N@a @O 2N@;&  oa(@B  a@ʔ*& (#H` #H' N@J@2  @) 2  ? @  , 2 H H  H@貒 N@ ittyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakall㿘@@illegal option -- -%soption requires an argument -- %s㿈@L@ -2&` &``` ' @ 2 # 2  `  @$y@   "  & &` @$h@  @ 㿘   D@ 㿘  " $@0 " `  & & & & $㿘@D<  & 6 F $  ߆C w   " * +* -* 0" $" 㿘   D@– 㿐    ``'@3   '``@+ & 㿘 @D @ &  @$**@"" "$@$   """$ "     " "  " 㿘 @C̠ @Ӑ & 㿘  @0 @͐  ?` # & & 㿘@C  & 6 D   $g`  "˒  " " " " $" %d %d 㿘 F!@%t D%d 㿘!!(@ @%iTIOCSETD㿐 `'@Β aX@& TIOCSTART㿘@΂`n a@ TIOCSTOP㿘@r`o a@ xph`XPH@8 0 (# 3#3233#@@@@-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5H@80(   @@xph`XH@ 0 -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkxph`XPH@0 @@@@    xph`XP@H@@80 (  C$CC$C-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoechoPH@80(  @@-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘b b  @ 2    ` *@&`   &` U&`  2 `  @} 2    `*@&`  &` ;&` 2#P`#P @c 2    `$*@&`$  &` !&`$ 2#`# @I 2    `*@&`  &` &` 2 tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ& ```" `"@!3#@!/# @!*#0 @!&#@@!"#P@]@X #`@!#@!`@@!#" @!# @#! 4 # `@@  4 # `@@$ 4 #Ȓ `@@  4 #В `@@  4 #ؒ `@@  4 # `@}@ # @s@  4 # `@h@ @ 4 # `@]@  4   `@R@" 4   `@G@  (4 @=@4  0 `@1@4   8 `@%@4  @ `@@4  H `@ @( 4  X `@@4 @" h `@@@ސ p  4  x `@@! 4  `@ܐ@ @ 4  `@ѐ@  4  `@Ɛ@4  `@@" 4  `@@$ 4  `@@( 4  `@@4  4  `@@  Ȓ @@  4  В `@w@  4  ؒ `@l@  4  `@a@ "  4  `@V@ @>   @H@  4 ! `@=@  4 ! `@2@ @ 4 ! `@'@  4 ! `@@  4 ! `@@  4 !( `@@ "  4 !0 `@@ @!8(2 #4 !@ `@@ #!""  4 #4 @ؐ!H4 @Ԑ!P 4 @ϐ!X4 @ʐ!`4 !h `@Đ@4 !p `@@4  4 !x `@@4  ! `@@$ 4 ! `@@4 @! `@@4 ! `@|@! @b!#H`#H%` @@ d@O@b` @ 2`@G 0C@D #H#H`2 !aȬ d,`` " ` @%@(`( @c@ 2 ` @h @d` @ ؀ !!Ȓ@X@U(㿘!:"( @K#$"(:"",%s: %s %s %s㿘!:"(  :",@4!$"(@y"(@`H @(!!@$ $"(@!"(@$"(%d㿘 ?  1:" @ 0%:1 " "  M."  -*  ^* ? *4* ^*@**" -aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@'H"! '/+ ")-H;%9@x?0 e"  f a !) g!# a@0  'ac@Z  !@H*` @p!H*`@ H!H* @:'H c@ `@ƛ c@. `h@Ɛ `@zc` `H H` HHH''@ C  4Hے .H (H L  `  @;. @4@5'c@~!  H`'#@@2H 'H Ő  @֒ c@    `g@ @c@M usage: stty [-a|-e|-g] [-f file] [operands] 㿘c@*!@9 㿘@ Ffs.%s8@':%:!:#-+:5/"   s F 0  0$4$<$"0@@`?耢 fb8"0* @ &H( "  . " `. @@`@5 @ @0@@?@ `@- <  "@@@  @@ `@@@ƻ%s: is a directory%s/%s8:"0`@˒ L :"4`<  @9!> @ :<  :@, /  @$:"<` :@s : "!`2 :"8€  @  0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘cx@-!@< 㿘@fRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABEL㿈@p '7!);'K5 "#K-K+K%;/9K_'쀢 8Z* @€!$  @  $!$N'!$  @ E$!$!$  @   ':$!$" 6%" 2$!$  @ )$!$!$  @  $!$'b $b %!$  @  $!$c %c $@@@??!$*@`&  $!$ b "   !$ ";@!$; @` "  `@6" !$"aX@ ?`x*` € @@ @ @t @z@o "@ @ m @h@] @  @m0`@@ R? C@LCK@`@k` `aX@' @  4/c . @~`m 'ah@ ? (`@`  `K@]C"@@Õ!@ o @@ē<|0000000000000000000000,00000000000Xhx000000000000 unknown disk type: %s㿘@  cx@i @6!&&& `&$@v DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %qd (0x%qx) lseekwriteioctl DIOCWDINFO㿐K# ` @}#!;"@x 8"@t p@q   !W&&6@|Kbp6Kc   e`f@u  ; "!  i ;"耢`   aD + 3` @;   aD + 3` @ ;  @ 2H'  @ 6 !' `m@4 6@^U!h@ ! @^J 0% !' `m@  @^:!h K#`2  e`g@  !(@J 0 %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 "!   0 0@#0@ 0 @ x0@| 0@!Xreading label from block %qd, offset %qd disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO㿘K"`t;"耢`  * 2`   :  @@ ! @  @ KC"@c 4 @K"aX@Đ  !W@ @  K@ *  bK@!KK!\`" ! !W !2  2   !@ *  8! (@͐!X2 ;"` `s@ߐ Kb@r K"`K#e`r@͔ b @a #e`e@  b8@U !@& Bootstrap doesn't leave room for disk label㿘`( 2 @"&`&`( @!@Ē !Ԁ@ J `@ *J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%d:ns#%d:nt#%d:sc#%d:nc#%d:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%d:%sts#%d:d%d#%dp%c#%d:o%c#%d:t%c=%s:t%c=unknown%d:b%c#%d:f%c#%d:㿘N``!a @f`N` a @]`!@\{`8  * a@M`(a@H`(@Ca`,@>a`0b@9`8b@4`4b@/`Hb@'a8`Jb(@a8`Lb8@a8`NbH@ a8`PbX@a8`Tbh@ `\`',@x,` L  `)@975/-+@ 7@ђ= @"@˔`@Ɣ ` a *@@ ` @ `  2` ` ,`@3< @`@b`@ ¢` @@w `*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %dH. `@   *`@ `?* : ` "*` €' !(B`('`!(BD?' !(B'`!(BʉD' !(B`8'`!(B?' !(B'`!(B' ?!(B?`($@' !(B艠?' ?!(B?@ې$' !(Bn' ?!(B?`(@' !(B؉?' ?!(B?В@' !(B:' ?!(B?`(@' !(Bȉ?' ?!(B?@s' !(B/ ?`a0/ #\bpa@F  : #l #\#`#d#hb@6a   `* b@+ b@%  ! "@ !8# b@@bؔ8@ .mb@i `8`d!@"@@`8  ?`&  @& * *@Yy?`&  @&  * &@Yg!"`8  @Ő??@`8@А  ?`&  @ * ** &@YB ?`&  @ ) )* &@Y1 ?`&  * &@Y# `   <    l# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐K"b@` *  b@֐b@А`b@ʔ b @Ė`c@`X`c@`X c @`X c(@ ?`&  * & @XA`(@c8`,@cP`0@ch`8@c`4@c`<@c`H@zc`J@uc`L@pc`N@kc`P`@f`T`8@a`h@]`\`    ,``"`&  4 `', x@B $, `@9`  #`` #\@(` @    ``@@w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]: !@?@vq`0 ?@o!X@;| @5"@w\@s `8@h`H@d@wL-/+CP) !@T@ @  ْ@S!bx @w,@ܐ" `@ ?`? "`@vp ?  $? ? n%P`? $`@v[P  $P` 2` n N@+  @c>` 2`X@’@ sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀`'' '@'  @a@@3  @ I `@V' @,  @)  @& 1 " #@c @  &! @@S @_ @, '@'@9  ``@ޑ:  @  @  @ 䀠 `? 㿘@@bL  㿘"@WL   , @'L  # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐&`  &`c@@_ ,$ "@mR : #H@C ,c`@q] 2  hch@T  @ `<@@ "`@TՒ v `@*@@. '#p@ n6`c@q' :'􀤠3L /-+'#א@q  '@q c  '@q㸀  'c@ Ԓ L 0&`Xc@p  &L "`\@-,`$  `L `c@W ? #@  6``6`!8`@p  `` @p `@l `(@p @-p 'a"&`( 8@ f˨ `P@p @-Z  ' 8@ S &`,``@po @-E  ' 8@ > &`8`x@pZ @-0  ' 8@ ) &`0`@pE @-  ' 8@ y w&`4`@p0 @-  ' 8@ d b&`<`@p @,  ' 8@ O  L6`H`@p @,ې  ' 8@ Ԓ9  66`J`@o @,Ő  ' 8@ #   6`L`@oِ @,  ' 8@     6`N`@oÐ @,  ' 8@  &`P`@o 2 @,  ' 8@ } &`T L  *`: `@ `Ȑ!6`*` @>@,V  '!@@ P &@!(@ F %@,=  '!`@ 7 $4, `` `P@  @ "`@Rْ ``@*@`L  `  @, '$@ : ' !@ ' ,  "^#YӐ@+ Q$!(@ H @+ې@.'>, !(@ В5 @+ǐ -$!(@ $ @+@ '􀤠, !(@  @+ 4$@: 6`!@  #@+ >@`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  !( , 2 0!8 2 4!P@    2 H!h@    H 2 8!@   8 2 < ,@y 0& 8 < 2  8@q 4& < !@   @ ( @ ! !@   @ ( @ z" `"0@ s   \)@ 753/-+  a h@ \= @ 8 ,`:`@ S @ 8 ,`:`@ JbЀ2  "    @ =#  <@,`:`@ 4H  < ,`:`@ )p 2    ,`:`@ c @  4, !a  " @ #ؤ h`!@HȒ!@CȐ'`LX'P'T7'@{d! usage: disklabel [-nv] [-r|-cd] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x'8cؔ @@^#a,c@r`@m`8@h! p@I?@_`@Z`@Ua(@Pa` c@Kؒa@Ea@Ab(@;`@J  (   @*`2 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -F flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) 'P0@!P   @˒   @Œ    @  2a(@ a8@,@1((@w$@y@   ah@  䀢 2@`!`8$  7$ l'$ , 4 , @P!`' z'z 2 7z@;"p`@}!05@N$@'@?   ?`$ * &@M  q/0/1"@ɒ @Ð @*`:` p=* @€ ! @uȒ!@8@4!@9@6@@xR! @!ِȒ!@!@@#@x6! 2АȒ!@!@@v@x! 2uȒ!@!@e`r@ @\@"Ȓ!@ʐ@Ɣ!@ː@Ȓ@<@w! @!3kȒ!@!@@ @wȔ! 2bȒ!@!@,(@q@w! 2IȒ!@u@q!@v@s@ٔ@w! @Y! "@Mfa@R@O@<@k "@B  L@ @ @># L #(c8@Ӑ !"@ @ބ@C#@@@n K#`#XP@K@w! )#@ݰ %# #@cؠ   `*  R  y n   *`@ R` y C" @! @d# @ m@g#4  `(@ L $c8@XȐ  P@K@lm@v! Ȁ @ @1 `Ȓ!@q!@m!@i@ "@k@ xK#`@#XP@@vw! C@#"e @#@1!;`?`"  @ Ȓ@!@!@L@@ ``````````````````````````````````````````````````````````````````````````````````Dd`T````P``|`0`,No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. 㻘 "H@KNa0 N    , !bx@ p0 `E  `A!@ b0 -` +   , @`2  "    a//%)'@@ p@-b N,  ` @ @ג#    6 ,     6 & &&& & @ &.  . $  &. 6@ " {&$&@ .   +  ". +      "  +  2  `+ . @[  2N& ϐ@J #p@ a&&@ 28&@c 21&;"؀`" 2@ 2"&@ 2&@ 2&;" &Ԑ @ ? @Cpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. 㿘#ؒc@; 2J @Ja07*   & !c@@ݔ`0&    `!`8@ϔ0 `   * a*@ !@`X0@partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and size㿈!a@ 2J @Ia0,`    `' ' '' @&  !c@@Y`0    !`8@K0@ w    `  " ` `      a!@ , &" &@d D@ 2T$ N$@ڔ @"H$ $@ #;"؀`"'   2! @L @   2 @  $$ $ $  ;bԐ @? @ϐpartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. 㿘!a@ 2J @Ha0q*!  j" `  " "``""` &"`"`"`"` `0O   .!c@@8`:` `  ` !@&`8(`  !@H?a` ;bԀ;"Ѐ      ` &" " " " ` .@ @&@device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐K".@3  !* @+ ”  @& ”  @!  (@  ,@! 0@!( 8@!@ 4@ !X <@ !h@! H@! @!>ϐ b#\’!@  #`> 㿐@ ;b";bЀ;"Ԙ `@@   * @  8? @ ?   + @@  @  #@S    "&@+  "@ @    +  +   `+ &@@dpartition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk 㿐Ð!@a`@ 2Jj   ,!c@@\`0o `  !`8@P0c@@!@!ؚ ` `!#\`  #`@ڒ??/ 2@)"8 9 `   # @ Ð!@bH0'" &@"@ @ &@ ` < "p@F a0`;bԐ  $@@˔? @㿐@  @;;"Жb  @ # `@@Z@"@%s: [%s] 㿘: Ĥ!*b@'ꀦ! @IPb@$@~ 2b@ ` ,b@ X ?4  " X* $ X @E4 $ b@@p $L@?L ", L@ ?@@> Lb@ Lb@@]K#,#Lb@ ?b@%s: [%u] Rounding to nearest cylinder: %u 㻐 8` \@s  P/+Ē@bؐ$@  ` /X ?4  "X* $X @DҐ Ӱ?@ ?L@ O ,@O ?O@~ܐO ? *`O `tr p`&? @   *`@ `?* : ` Ő#*` € 8 (,@  ($ ( (@,@O + -   ! "'$!@! "4?J` $!-? ' B" '@Đ ' " 7ā@' B'-:  + -"'`@?> '"B 8' "B"B"7ƅB' B' @"8@" @"Đ"@ Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@ܒ  0@ @`@ s  ő-`,`@@   `l?l""@2 2``a`aP@@}#x  荚   膚 Ŧ/Ť -ꀢ`'%"$* @m㰠P/$@ O X` ?"` X* $ X@C^ # O` ڐ?*  *  @ @ @;&`@ -`(2 @@) Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.`!@K@9"0 ;975/ *`X Ғbh "I@A"    a  , @A 2  )@Ȑ@Bਠ #)Ʀa%Ƒ, @# @B`  , `` ?"``* $`@A   6 #c  2  @Baa0" &@a@BX @:!0ޒ@Z . ')'%# ,#\#` #hxŚ ?〤?8@B:a ,& ,)'%# 0#\#` # ?ˀ?8@B"a 0& 0)'%# 8#\#` #Ж ??8@B a 8& 8)'%# 4#\#`  8P} ??8@Aa 4& 4)'ǀ >bԀ <"@ ǐ!@` <  4 @>  4@: #\#`L ?j?2  <"8@Aa <#;ΔbԀˀ @$ @&@@{L bԀ8$b& <)'%# H#\#` !@H ?@z;!`@!xa )%;97!Ƒ.`@@#` #@@``.``? "` * $ E6 @? '/-Ɛa! "a@?  ᴑ.`@? ",6 ``(.`@ΐȐ@@Q !Ƒ.`@@Đ#` #@@E``.`` ?"`* $@? ŐaStarting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).㿐)'%;!##\ < P#` x`2 < @?a0' -+#;')bԚ"@Д" #\#` \`2 < @?Ғ!0 "@bԐ $b$А@i㿐W 2;";;b@"b@" " L"   ` 1;;"Д"@&"@  " 64"@;b;"@(@ *2 @ *@``  #``#  *@` ##  *2 &ّ*"@( "@& @א <;; ԁ"";;К Ԅ "@ @    "  "  bЀ* @ "@ `@ The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. D - set label to default. g [d|b] - Use [d]isk or [b]ios geometry. m [part] - modify existing partition. n [part] - set the mount point for a partition. r - recalculate free space. u - undo last change. s [path] - save label to file. w - write label to disk. q - quit and save changes. x - exit without saving changes. X - toggle expert mode. z - zero out partition table. ? [cmnd] - this message or command specific help.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.㿘?* : `6S*`ѐ# €@ru 00@rq!`0@rm"`0@ri#0@re 0{@ra#h0w@r]"0s@rY"0o@rU#0k@rQ 0g@rM"0c@rI#0_@rE h0[@rA!0W@r="0S@r9"0O@r5# 0K@r1#0G@r- 80C@r) @r& @r# @r !8@r!`@r!@r!@r!@r!@r" @r "P@r"x@r"@r"@q"@q# @q#H@q#p@q#@q#@q#@q (FFFFFFFFFEFFFFFFFFFFFFFFFFFFFEEEFEFF$FFFFFF4FDFEFFTFtFFdFFFFFĝ㿘'  @ "@@@ @ $@(@ @7 @ ` "`@e$@`<@㿘   `" `2 @S ` ``  /dev/%s%s%s%c %s %s rw 1 %d x @ |   , @ " "@ "    `eҢ!ؐ@S5  N r Ҕ@a$@, / "`N@`r2G Ҕ.@$@a`.@@@?,֒ ἐ@Oz @Cc8  )  "!bH|   @*  ` a*@ @#\#\@u.  `@ 2@@W Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. 㿐.` Ӵb !-+)'% ` #\`   #`<  @6!% 2;b8@6! ` "Ѐ !@t ( ` ;"Ԁ !@tx ` `!@top ` $` Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors 㿐.` %%#Ӏ``2   < 7"p  "N$ " @&E$Ӑ!@sc  b#\``  #`? ? @6a&  "8@5a " Ӑ!@sɒb  ;bԖ Ӑ!@sc  $ fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block size㿐.` -+)%'`#\#`a, ?? @5 8@5` 2$`@o3!$` block sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. 㿐.` ` 9, J  @5>aC 7)5/-+ @@#\#`"淪ؠ?߀?8@P^: @PY!@r @  P@ c@5! @,  cpgNumber of filesystem cylinders per group. Usually 16 or 8.㿐.` ժa(!0)#%   #\#`R ?? @4ɒa  24 8@4’a  FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).㿐.`  ` `(!*` Ր"b   , @@3 2 ,` 'Ւ@ܐ"P !,`  @4Za +)'% ` #\#`b"Κ ?ꀤ?8@4C ` ,`  mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' 㿘. `E A ? = ;.#!ր /@ @r@3. *&@a(@  h@3a@` (֔ `   @3a ``@3. 2N@  @F&@ 㿘 2 @@ 2  2@ `?@OuCan't stat deviceioctl DIOCGDINFO8@? ֒b @ @qs! #ea(@ `r@G 6 &@`e@@ 6&@֒b8@Ӑ &[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. 㿘  ֐"cH 2 g ?* : `3dא"L*` €2(U#& (,& ,0& 04& 48& 8<Q& <`2`(B#& (`,& ,`0& 0`4& 4`8& 8`<>& <2(/#Ȁ`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ #@2a0 @2a\^0]^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0]T^0^0^0^0^0^0^0^0^0^0^0^0\^0]^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0]T㿘 " " " "  ;;"bԐ" &  & 㿘@8Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`"쀢?"@ ?LLL $""!"# "` r#bِ"X( € א#"a$" @e !  $" "!ה@H "쀢R!l`N @ K"쀦  א# "a$"&@d!  $" "!הЖ@H̐ " $"쀢+!l`' @t $"쀦  א# "a$" @d! $" "!ה@H  "ؐ  """쀢 ?1!Ȁ "L@  "!!Ȕ@H L "@ 6   "!!ؔ0@Hv "< @ !ؒ`H@H: "@/??$"$@2 "a@   @" $  @ ?2 $2 $ "!`2$ `2$  `! ""bs#!|iِ"D*` €c?  `!"#Z"a|` @>c? !"!|"a| ! !|>"#?;"c !!  : `@a# 0@%!?"!|%1>$!|!|  : `@a  0@!|   $!| ?!| &#&#""c"|% $ eHdddda a ab0b%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿀b쀢   LL"!`"`"a # "`#!`'?`" * " @/͐ !@n#bp@#c L @v  <    4 0 @Za$c `!܀` !# @ #@Κ @!`"`2 L! @0" @"aL ?$L  "ࠀ`"b "b! f"!`!`'?`" * " @/Q $!` !!aؖऒb@m@>"a`!@Kn"Ѐ  b؀   @^M% @mz0!@KO"耢 %`!bbᘘ?`#\#`#d@m`#h@B$`?c"`b   %#?@? 4$Unable to truncate archive file㿘""b 1"  @    "@NI    "!ڔx@FD ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘"`Lے` @E ?!` !|!ؒ`X@Eݐ ? Failed read on archive volume %dEnd of archive volume %d reached㿘" 3" b@t |L  "" !"|L"!b@b L "` $" "!"@E 0"ےa0@E Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘" b @  L"`"6$"$"" @ & : !b  @ .  > b b@M: $  $"  "!?倢` E0  "!  ےbH@D $"C    $"  "L "`  ےbx@Dڐ 0' "ےa0@Dѐ 0  "!"@D 0 ``"@y ےb@D 0c@D Cannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐L `g?b b `? WaL L "`" 4=# 9L  # 2$b7  a'@- 6&$% # b %"%  @  > @]@ d@   $#  ܒb@D'  ܒa@D! ?Foward positioning operation on archive failed㿘  >2@ `(= " 45"`21 !"  @o   L @ 0C 4 2 > 4(>0@ b >0  "@R    "!ܐ @C?$b?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐" 6" K  { `(y$ @Cna@p? !n `(l$"  @ْ    "!ݐ @CpX?b "`ݐ @CGaI?    "@ B  "!ݐ @Cc7?@r 1 "!|0 `(.$ :`@\@ @Ca? 7@Z' a@    "! @C- ?$?$ Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?c" `'?c @p? 4   "!ޔ@BӐ }?  7'!  @q!    "!ޔ@B h?7'!@`  ? "!ޔ@B W?#@7?   "!ޔ@B F?@)? 4   "!ޔ@B 6? 7'# a@,   "!ޔ@By #?!%b@w ݒa@B> ? 7@'a@    "!8@BW ?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈a @  "!ޔ@Aj  @ܔ  L "!ޔ@A[ L`  "`ؤ @E"耢 @@  @Ec a@Ec {" w u  "a@@ΐ @@@ː h "a@@Đ @@ `?  @@  ;ߐ $# @@!;75/߰9!+3')@@a@@@@@h@@ᐐ@@, @Ea  O ?%ؐa@@'""!`O 2!Ѐ`Y `s`S!0 `y!a a@@m@@i"'ߐ!@@d"@@]"8'!ߐ# @@V@@SX@@Q"@@`, ߒa@EU O ?ߐ!%@@<#"8"! 2@@3"ؒb@E; @@)"@>,@@ "Q !# @a$#@( X$a? "%c@@1 ?could not pipecould not fork-c-dccould not exec㿐@ c@ڇ @`"#c@| @ڰ0@ڬ@@0" @ڢ @ڟ  c@ښ @ڗ c@@@# c@L ?#p@f@ \ `D T``  N!` @  E@  @@.  x %@ (`@+ #`@0g @+C `@, `2@Δ @B ``(a @ *@*Cannot chdir to %sCan't fchdir to starting directory?#p@@  `D ``  @7 !쀢`@5@ @ f/@/  x @#a ?!`8?#@[l 0a a 8 #@ ( xq@a  ? `@(  `` `8 V`@* `@+Ӑ ` @3c x E@at  !x`B?#@[ 9at !x`8 +@ ( %x@at  ? `@( `8  `@`x @ @B0!   @ǐ  @' "a  "  "@   " @>   6 4? @@ x @ @ @fB`@2ɐᴀ n!`j  `?"`@* "@@&֐ Y$!@ѐ ` x @ @ @9B@20F? < @ᴀ `!`  `?"`@* "@@& $!`2 ?# x @ @B     @a䀢  "!@> @א `@) ``(ᤔ @h t@6@)9Unable to open %s to read㿈 ?`'@1 @m   `,  쀢` 0@3 @  /5@Ґ@1       @Y  ' "! @=0@*Q @w@1` !d` @  @d@1ΐ0!   @  @&]  "a``ŀ"` @A|` a !`  `?"`@* "@@% $a@"0H  @ @a  !`  `?"`@* "@@% $a 6耢   @耢 ( x`  ` x @ `@ `@- !?+'@2 $` `4@9ᤔ @F R @5@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done.  ?cp@    b@@7 9@3 4!쀢`@1` +@G50!??"'@, % 2 `!`? `* :  /@`?"  a@;8`0`@ @<#@  *l@W| !-@ a  8@ @@ a  @@ 8@ @T@/ ɒ@' Ē?c@ @) at  !x`(`@W8 2"!t !x` 8@ @@ !t  @@ 8@ a    @#` "a`!̒`"`@ @6 ! f!`b  `?R"`0U @  ? @А @Ӑ !@/ ! @ @V ?b  ' "!@ @:0 @ 6@@.0"@@H@s! !`  `?"`@* "@@" $!@p  @ߐ @3E@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 L` ? ' 5-19 "b?  @ `P  A @9Ғ# @䀥 ` $€ #`` ``8 % `   @9 H `@ Ӑ` "`8@ 0c= ?` @9 ?a`  "a`Cannot identify format. Searching...Sorry, unable to determine archive format.㿘#"` !*` * & 6@ Lo?@* @*`@"@Yc a " 97瀦 T@ N"  a K? @9(` @ 4 c@ !cL!@*` *  . `@  2  ? @8`  @ϔ""@Ơ"a¤ b@8 ?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘a M! "a `&!!? `  !a    "" aX  @8?0a""a|  !0 ! ?!  @8"a#!  Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘 Ma"!!? b c "@81?04a   ?a|!  #! :#a M? "!|"cCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘!Ѐ``@ ᄀ  !|"ᄪ "c|"#  s !  " c  @ :; F@O@R&  @c :@ D" E@d (!`%!c@$ @ %! | - ! $  "  : c $ %!c$ @ %!a@cb  %|;a88   "` `x @7^?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘#`L  `c@73 C? ! 7? ;  !B@ "!8"a (   :!#  : !Fc    c8@6 0p ! ?㿘a " "a @㿐  p?a  " :   2 @!   ! @fU%! !| :`@P" @N@Q  :?@ f @ B D (8. ! "@:`   ` @:   2@! !   d%! a!  㿘#a a !! "@a !c@$a 㿘`$" '#%a "@  @@ @?a @Ka &@@$a ` 㿘`$'#a "@  @N &@ a @!a &@$a 㿘' ! "  @ec &!?< 2 @   @  @ < f $ ` Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive8 H@' ! "  @c &G>: 2 @    @T   @ :d $ 4`8   "!  a @5q !>@zВ   "!H@5 >?8 a`@5Q > Unable to obtain block size for file %sActual crc does not match expected crc %s( H@  '@z "  ؀ 2   O> "!8 @5G  >'/0- :2 @    #\@ !d` :!   #!   : $   @ d `  "@%@ Ē   H`4   `@ 4 ` !d ?!d`2   @c` @4  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(HP  * 2`  *` '     "2  @   @y  "؀ 2  '!8 @4x'#'a@ #\@ښ <@ Ea@㐠 怦! "  @4K 0 H    @   b @4  @yj   8 " @@4)   bX @3   H`4 `@Ғ㿘c  )  $% # !~   :a#  "a? a> B@"!8"a User specified archive volume byte limit reached.㿘!! ` 4+  1%!!!  !'% @3'a@3w ,     =ai"#!   "a@=a] && %'   =a M "a&& 㐢@ `a <`B=a !@B㐐 &"a $  "! a@ <`C &!=a@%$! ` @$! @gْ  "aа?Unable to allocate memory for user id cache table㿘!#䀢  1# 2?!=@Yޒ  $#  # &#`h@2ِ ?Unable to allocate memory for group id cache table㿘!#耢  1# 2? @Y  $#  # &#a@2 ?Unable to allocate memory for user name cache table㿘!#쀢  1# 2?!=@Y  $#  # &#a@2 ?Unable to allocate memory for group name cache table㿘!#  1 2?!=@Y_  $#    & b`@2Z ?%lu㿘#`Y >1!=@fi#* @ "!`$! $2 !`29 `2'14 #܀  @ #ܒ`$#܀ @| (@5   & & $@E_ `21#2& $  @2ߔ  &. #㿘#`* >1 @f#* @ "!`$! $2 !`29 `2'14 #  @Z #`$# @|7 (@   & & $@E `21#2& $  @2  &. #㿘@ "\?N Wc쀢   &O?@*!=* @ #  @6]  # 8?! $c܀  @Ր cܒ`$c܀  @*͔!=@{Ґ (, "@  @ ?` &@ @2/ @ , #  $` $ $&@ $?㿘@' "\?N Wc   &O?@* * @ #  @5  # 8?! $c  @ c`$c  @*k @{p (, "@  @$ ?` &@ @1͐ @, #  $` $ $&@ $?㿘@$TRAILER!!!㿘a@5   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@$t ? %?p#` @~T $a`" 4 ` $a ` `t` $$, $ 4 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘lc@0 ? 2 L 2N   c@0 ?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H   @   4!  H H@ @/Β`h? H,   @"&, `,@ N,  `@/ ?070707㿘`K a@4a   ?㿘 L h! x   :` @  & `  @  & ` @  6` @  $& ` @  (& `$ @  "6 `* @y  ,& `0 @s  @&  H 8&  0& `A@Ԓ : `;@b ` &0 < (  @ &,., W z?  W㿘@%File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@&, ư?``x   :`,& ",    A4  #`H  A @  `c A @   !ǒ @  ~#`   @   t`   @   k`    @   b`$   @ ߖ  Y`(   @ ֖  P`"   $@ ͖  G`,   *@ Ė  >`8   0@   5 ; @   -  L  `  ``c     2 ,, 6 ``@.:  ? `8@.2  070701㿘`m c@2ݔ   ?070702㿘`m c@2͔   ?㿘 @!"ad㿘!d` n ђ n ! x  :` @   & ` @   6` @   $& ` @   (& `. @   @&  8&  0& `6 @ D  H:`& @ є  "6 `> @ ˔ `F @ Ɣ ,`@ &`N @  `V @  ,`@ ,&`f @   &`^ @   ??&x 8 n ` "  .< (  @   @  b  `:&,.,    @  b  ` ?  |㿘 @$"adFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@$O? #?` ``,&!d`!’ @ P  `   ! @ C    @ ;  ` "(`x  (x% #x#`H   `  b `x ;@ 6 @   `c0,   ;x   ;@ 6 @   %   @       @   $   @   (   @ ؖ  8   .@ ϖ  x"   &@ Ɩ  o `  >@   e F  @   \, `  N@   R V  @   I ^ @   A n    n  $ /  "cX    # 2! ,ǐ, & , $    6 c@,   ? c@,  ` (:`((!Dž0: 2`(0 ?(   (?㿘ڒ  !(! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``*#`8`@`0& `B&& :` 2 3` < @ (@ `H   &,.,   `  b`x ;    @  b  ` ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@!ٔ !D?  ?  ,& ؀ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) a, x; ;  , ; *  ` **   : .`.`.`.` )x   :(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8: ::*` @ `*  * (`(`(`J(`<  *` @ (` ?(`K  E       "a8    $ 2" ,&,   , "  l 6  a`@)j  ? a@)a  Unable to create %s㿘%   c*`.@E4` 6*@ !?! " a ( $ @А  @)[  ?&@Eg4 &Unable to close file descriptor on %s㿘`@ @v   "! @)4 !耢`  ( $ @, a  ``  36   @m  ` ` 08  @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @E   "!  @(ې ?<   @g a@@( ?㿘`    @P  Unable to copy %s, file would overwrite itself8 @DÒ !`  2    bX@(Y   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@D >% "!`2Q @@`@ c@(! @?<   @i % "  "@;. % "+  "!@@(1 "?X@() ?#  ` @`   @ a԰ %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8  c# !!  @ ``!Ԁ`  $ ( @3  P@' ް? ` >!*` € ,2`@CŐ 75  ,  *2` @ ,  *2` @ ,2`@   ` , @H  a(@'F ? "!耢`` $( @( @[`ra  !  36 !  @%`H)!@+!h @@h  )!@CJ  "! p@'*`2`@s  c@ma!  6 @ )    ` @  2 `"  08 @  `< << %s 8!` a @H@d0o `@>1 !2  ` ;!@@!!@Q` @ߡ @ /` : ` ` #` #\a(@H ` ?   `a@ `@Hv`0aP@HoaX@Hi `  `a`2ah, @HX0?`& * & @ @d,%s%s %s @!  8;a @ 4!!%8@ݐ@- @ "/  @=#h@   * ` " J@ @ " *  **   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0*2   0*2    0* :* ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? %s: unknown option %c %s: %c argument missing 㿘!@ " "a`4`I?"@J@ - aD *aD "aJ!D`@Af3@ . :  "@"@'?@ q  :2J @!` :2. ሀ @!`@F  ?*@$"ሱ. > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@: /`"!`@$!!@$H"P @0!@$>"h @:0"x$!ؐ@Wab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  5O-`8J <*` €E# "a@!$!`=acX@ @X5 "ah/ "a* "!"a$ "a  "a@ "a "a "a@  0 "!-* : `#*` €"  " ""# "   "a  "aLcp@ @ L  ӤѤ "@ !a ɤ "!ä  "!   "! @! "!!'" @@ H "`!c@E  #@ga '+@!@E>  `H!@Yc0P#"al! "@Q!: !  ac@ @a a c @ "@] "!W ! "! @"ؐ  ?J"c@߫! D"c` @ 0 "@a 7 "!1   "!+ @"!&  "@,a  "@a  "!p  "!t   "!x @$@?O(??B  sې "` !%qȐ   @@  !  @  ! " % @@א@  `#8"``A#*` €!!!7! *@@ !@! $!0&!@`H@> @?. @"a!! *H@ !@! $!"#L  @ @ @  @ @ @ @ @ @ @  @  0   P h               , L   l              4  H \  p    x        b:cef:hmopqruts:vwxzBC:HLOPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-C-TrUnable to open file '%s' for readProblem with file '%s'TAPE㿘 "   %)/-`J!4*` €# "a@!` $!acX@` @X!* $! }$z"# " aJ@ -2 J` "!k "!g d" @!H ^ @0Z  "aT" P"aܐ M$ "@a H@DA$a <"a 8"a " 3$# "!+"a '"a #"a!%` "ap!X"al!h !x !!!!"a@! ?c?ሀ*`@ &  2! %?  @iӐ ?  " "`#8 "`a@ @   X '5/-+<):`@ q 2-@`@ >`@ƒ %@ @b @y %@Ȁ `@p@ @$_H` @@h"H@` @` `@V@  `@ 5 2@`@ 2$Ȁ`he"!!Ȁ P#\  K#@7H@S  6C@@.?@@@ b 20@`@ B`@bb %@b @ @ %0 @ @ @#H`@bH@ @  ` 6@@@ "$c@Βb 2`@ 2`$c!! "J @f"` $!J !h$!@Tdt| ddp 4/%s8"`%+ "@J@lL `?,@6 a @6! h@Z ?<  h @{  ?` /,`ϐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdinP !?#$! ""a#a"#!     /9ڀ`D *` € "a"&! "ah %` "a̐ &" "`%` %` "a "`%`& "aw#А ~%`z"a "@yat"a! "!@b  %!b @ @ %@ @A @"H`V!bH@ @O "aJ - J !B%!?%! "!!'" @;ʖ H /"`!c@r  #@a %)@@@k  `H@#@ "a!X "al!"`@@:h?@?!`* `G@ *` €@ ? @t` 6@@@ 2@01@  `H@ @x@"a `@o@ @i"#%!  @ P H  c@ @T@R  $8888888888DP`8x8L8888888@888888888888t@8888@88@ (8888%s: Invalid combination of options: -%c㿘!!a@?!  !J 6 a@?!@g 2@ !`?"`! * $!@" 㿘@Q@Ȁ   ȁThese format options are not supported %s = %s 㿘!Ȁ`b@P !1!@?O" 2@ Invalid option nameUnable to allocate space for option listInvalid options format㿘 N  ch@q c@ :?cc@  @b0?L@ ", '@Œ , 2,@ = @bf 䀤,"@ "`"` Ȁ "" `$L@ ې 㿐 @O  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @1 @  㿐@   2  J?` '@a  @d\@* "aH  usage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘!! @#h @#% @# cؒ@ @# @  @ 8 @ X @ @ @  @}  @y  @u! @q!@@n# a`@i @e! @a! @]! @Y!@V " @R@d? usage: tar -{txru}[cevfbmopqswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] [-T file] file1 file2... 㿘!! @)#  @%@d usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘!! @ǐ  @Ð  @! @!H !@@c Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘  N`  b8@  \bX@_  ` bx@< i?,@K  @H$ b@( @_S?,N @ 2 *@@;@_ *bX$@ `$`J@ + @% *:  P"` g G" `0  p"`0` $` $`@@_,@ ?`J@  @c耢 $`c " "c"#"c Empty pattern stringUnable to allocate memory for pattern string㿘  N  a(@_"   a@@ ?$@b$ $ $ `$ $ c " "c"#" WARNING! These patterns were not matched:%s 㿘#  ) '%   2 `2 @r"  @;sP  2 Pattern select out of memoryPattern list inconsistant㿘#`  !܀`   \$  W !`22# 2 *`2)#2*@   $ b@%  ` /*@6$  ` /*@$ @b?$ J / * $ $ & #       2    @^" & b@ ?㿘c  &!܀`/!h`4?2   #@.         J@ /2 @u 2  ahah`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ !`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  Removing leading / from absolute path names in the archive㿘 `! N  /N    . .  @`@aڐ&ࠀ    $ࠒc@ ࠀ )N, /% `N, 2,  . ., , @`@a,&,ࠀ 4   $ࠒc@Ð #耢` @D  )     , ,@4 !쀢`@j     ,, @ , ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐!@"0-+)'#!@h@b@"@, %@Ѐ @b0@_,O@#0〢  .@ڐ# "  O  @ϐ#0 ?#X@Ȓ @%,&,`? 㿘 @ ? ` ,, @ ? File name %s/%s, too long㿘N@`/ "@l$&@aH@ ?  ?*@  * . ?*@ .  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s ?#Pc@PPA X/ @D? .\  ,@` @* @ @e 6 @ U@? X d@\"  L  ΐ2ƨ?@0,@` @@L  @,@L  $b8@  % OP OP  !b`@8 OP!bx@7OP  ޔ,&., 㿘 C:  & \"*L@ / 94 *?Ѐ.`, @*:  \2 .L@ \ @ &2. `. ` `  " ' 4  ?:& @* `&.Can't open current working directory.can not gzip while appending㿘@(5 @,"  "a "! @ 3@x +@  % `#*` €i!l`bH@  Ԗg!ЁClC CC,C\Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "a "c@ 0c@ @ !`@@^ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @\Ւ   ?@ @\ʒ   ?@ @\   ?@ @\ 2?@ސ @Z X   "@   ?؄ܒؔ"!  '''@\V   Ȁ    @\K Z " @\D  Ȁ    @\9 H " @\2  Ȁ    @\' 6 " @\   Ȁ    @\ $ " @\  Ȁ    @\  " 'ؐ @[ @[     "!@i ?㿘 `@ 2  `@ 2   耢`" @B   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "S?N #`   !=@5  $`8`N # \N  #" @ 2 `H@ΐ ,?  @ @C!=@B`, @ " 2@Y!  ``h@ ?, "  "" 㿘 $!=@B`* `"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "S?N #`   !=@5M  $`8bXN # \N  #" @wn 2 b@: ,?  @s @w!=@BS`, @ " 2@X  `b@ ?, "  "" 㿘 (!=@B*`* `"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N `@W / "N,@`N & ?А , *: * :  .2` 2` @ n J 2 @WՐ  `` L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ a@ 5 S`L@  @@誐 N$`$ @ 6  a@ $ (L $@~  6   a`@ @W$  $  @ a@  @W?`耢 $ " "`  ` " "`a@ ߐ ?耢`A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@L@ R . "$@, @Zr 2a?L?Г* @L *`В@ `=$@T?@Z`?`8N?#ܓ*` €N?Г* @N *`А@ D$` d$` N?Г* @N *`А@ $`?$` N?Г* @N *`В@`$`  N?Г* @N *`В@`$` N?Г* @N *`В@ `;$`@N&@?? SRS\RS,RRRRCannot allocate memory for hard link table㿘1!4 2 )@2  &!4 `@  ?Hard link table out of memory㿘!4`o%`"`d )@@a4-  `7` ````@ 2``@ 2``, @꫔,&,`,   & ` ? $` `$@V;@@V9$ @V  @  $@``$` `"$` - a4 $` @ $` "@ @V`@  ?㿘!!4 8#`"`3` / - +`@?)!4*  "  2  `   @ 2  @ 2   #@U@Uא㿘a4   4*@  "@`@U@U`24Cannot allocate memory for file time table/tmp/paxXXXXXXXXXXCannot allocate memory for temporary file nameUnable to create temporary file: %s㿘!!8 2 1!G@1  $!8c@  %?@8    @ ݒ`0!8@Uq?0@U "aL@@Uf   "!`@  @U[?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐!8`  1@G8- @`;+ "-@2&``!!L  @W ` ` !Lah@  [?@W&E@ ```2@`  8`  ?$`= @T  .!!L  @W  <`!L@V " 8- 8 $`$@ $`" ! "!@ P  ` "!a@  `?@T?Cannot allocate memory for interactive rename table㿘1!< 2 "@0  &!< `0@  ?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘!<``@ Đ I @&"a<, @`0` `@@ 2```@ + @T9`@ &``@T @ &@@  &`a<,   &` " @T@@Ta@ | ?㿘!!< @@ؔ"!<* @ @F 2   T&@. 2Cannot allocate memory for device mapping table㿘1!@ 2 !=@0<  &!@ c@ : ?㿘` @  ? Device map table out of memory㿘!@`-!=@=>a@, @` `2` " @Sp  a@, ""  "" c@  Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘!@ ` }  @ 2  " *     +2$`& `W& `R y  B`25"5@R 9"" "$ 5P  &PP\  P @!S  `  &PaP @RԐ  aP"" "$  &   &` @Q `@M  Cannot allocate space for directory access time table㿘1!D 2 !=@/,  &!D c@@* ?㿘aD   D*@       2<DDirectory access time reset table ran out of memory㿘!D`6!=@<D,`@     2  2  @RK  @+  $D,`$ $ $ $  $ " @R^`@@Ð 㿘!!D &!=@;ސ!D*      "  2  2     "@ & &@R1@R/0?Cannot allocate memory for temporary filenameUnable to create temporary file for directory times: %s㿘!!H?  @Ɛ  b@k ?@  $!HbH@_ @Q?@w@Q Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sx!H /  @T  ?c@% 0"`' !H7'' @S'؀ !H@S aP "aPcP@ Unable to set mode and times for created directoriespaH R  9'@S >ؖ !H @TX 6!H @SЀ .ؖ !H @TH &!`쀢 I ` `ࠖ P !H??@T$  !H@S!HP? $!H`h@ 㿐`@  @6` `   *  `'  * @:㿘 _$ $  J" ?`   " @ 2(* * * *( ( 0(2    0( :( ?   @  2*( ( ( (* * + 3` ` 03 *   0*:* ?  !    ustar㿘a$?N ap!@ i    䵔 Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘-)'+/$%@ J ! @ D   b@] 8 "`? h @P  ? %X ۢ! 㿘" #? `& `"6`& ,#&,`d 4  /` 6`l - `$& `t ' `(&  `|䍒 `H :  ``@& `   ;`8&`0& `x:N` `1`21``5"",., ` , & `ݔ,&,,(` &  , 6`Δ,&,,  96@` & 6 6., .&,., &,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ` -"*` €!X`$%ǰ  b( bX b b, d, b%   c b  c x : ,`c d@Q,? /,  2  1,, ؔ c, l   g"! d @Q,H l  Vc" @  b a:!   `dp < $  `lg 3 (  `t^ * 8  `U  !!` K  1!  |  ?       c @p  s|sstssssst㿘 ?  ?㿘a ?І  ?㿘a$?N ap!@  2?  ? \"? ?㿘ߒ"  ?# `"6  `& `& &NaY   aY+ /,  , "&,`d   /` 6 `| k `H :  ``@& `8& `0& `(.aHa)ѥ 6`$`t  &`$.a(a 6 ``l ٔ &``x  ;@ :`,& ., &,N``7h#*` €  @ 6 s&     "  &6  6 L /2b &^,N` 4 `  ` `  ` & 6 aI ፔ  aQሔ , `,<& N` 2 `  (` &  6 `   `"` &  6 6 , `N,&,,`H@`  a"@   b  6` `x& ` a: : { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { zzzzyy{ Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠`  `0``    , c, #` @. `x   @ :,@Y  /,@`Y @O  c` ?` a, c "*` € 5,   d@O :,!I ` 4 3,   d@Ov `, !I *  !Q  !  (  6,   d@OZ ,!I ` 1 2, ,  c? ,!,!I,!J,!K,!L,!M,!N,!O,!P,!Q,!R,!S,!T,!U,!V,!W,!X  |   9 `  0 7,  d @O% #`H @" a  b `x ;@,!I,!J,!K,!L,!M,!N,!O,!P,!Q,!R,!S,!T,!U,!V,!W,!X |   `b`ap !` !#`    d  J`$ l   A`( t   8`8     2/w  ߸! ɒ  ߱!)!  s  Y!  ʤ `?       `@  ~D~d~d ~  `c`  H /" J J/2 J" `4 ` /dev/ttywrFatal error, cannot open %s㿘 "@   @@b!  $! b@8  "a@ 0!@M6!쀢`  bb@3 ?㿘!!'H'L'P'T'X H@'@C !Ё㿘` !Ԁ@ 2. ?@ϒ 2* %s: 㿘'L'P'T'X L "a!` !1! @B`!@#n &!!ؠ!!`X@&@'S@#_  <%s>㿘'P'T'X P "a!` 1!! @B`!@#A $!!ذ!!`X@&@'&` !!!@@&@#( 㿘@Ӕicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom@  !//"@Lc''/ '!b@q   @  "cd!b(@ @: @u# "@6%@,+b Ȕ'|'X'\'`'d'h'P/;'x'T'l'p't 3%* 8@€a @ʔ  #cl!abP@q L $/$LL @$L@  L!!"x@ @q `$L@ !a@* L@a 2 !ab@qy  / -  -  - L"$La@7P  =bbȁ !ab@qX "Ё b@  b!!"@M @qF b؁)=bL ~$L/ y%@ " a!!"x@1 @q*  @@ g!!ab@q L ]$LLa@ >$LV!L Q$LL M$LL I$La @ 'b!ab@p ?#@9!!ac@p L $La@ )'!ac0@p L $La@ /!acH@pӐ L!$La @   "!acx@p @ !@%0??a* & @ @ bD"͖`"`""P’    H`D" @K[@ *P-`@5 #c`@ѐ 2 !c@p -` @JL @ "#`/L  b!c@pl ` "` @G' L!c@   b @,`@@I?cL ̀""(`< 8 㐐 %#cx dcx+cx *" "" @M  L!c@X L @?dc @ L ?dc @ L <` 8 㐐 %$LL d $ d!c@o %d  @˘ #<* @ *@@ "cc, `4 4 4 , ` $ , $ L <` 8  "`(@oŐ   '///d | @ ( 6"@u `@J 㐀 d X @  "`x@֐ 㐀 d \ @s  "`@Ɛ 㐀 d  @c   "`@  'd!?#`#d@z` "`@ @d#h`@B  d"`@ ?hc@4  ```c`'@qP"`b@*`"b@*`@H{ %#@Hw %@Hs @2L 2d@d 2 * @FV  !c@Q t#'L  @ ''@Iѐd 2 * +  & x  @ L 'd T@l  p "᐀ L"@䩐a0L'@IJ T@Y @IB #l`Lh L@F'@@I XXXX<XXpXXXXX$<XXXXXXXXXXXXXXXXXXXXX4DX$㿘 "!@D%c@Gɐ cl#H@  ͒` @rs $#h`  @  `" *"*`@G @qS$㿘! "!@M $!ping: sendtoping: wrote %s %d chars, ret=%d 㿈+b -- "|H* 5 `5 "H, 4 5 #̢c@/Ő: @/   @*@* ,@ @?''b** * * * * **"`@cL  5 #`5 @5 cd#P @՚  @L`6%@㩐##`& @EL  b @GB packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xx @ `*`@ #La !&'"@ґ@0&@  (@ hc   V"h  / / / / / / //?" "@ ''Вb@ ??*`" * "* *Ⱚ :@B:Ⱄ@Pb " "B;b(8" "1 @"|:1"|#@.: L@. <  t #h`?"t'#h@.u: "|@.q   *@ , #L`j`b @F9 y!&'@"0@&&@""Pc`!&"X #@J  @ؖ# @  `&@"p"  `E& @ b@"xb  7)&#&  2 @" @bb  &  ޒ`#La  *  @&@ !&@"@@s#L+)&  "&   & `E "&& @"ؠ   ` '&#&'` ?"`* "@ነ     *   @ *   *  @o@@hb`Ӥz    nb 'b@  '#L  '&@A# S%'b$b@E&$b&@/#  '&#&`'3` ?"`* "@"     *   @ *   *  @@?@b𤄿Բ`@#(@"  `@#0   ?5 #L  ``?"`  * $ @ܐ @; `  ` `? (?888* 2 --- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms 㿀 `"@  * $@k @: !#`)@Y !#H)@T 8h) @N X ct`)@F p#H#h ")@< *` *  !)  @b|7 8b|@3 -͠"  @:o  @:kb ͠"  @:^  @:Zb  @^ "  2@b @b| Βx`@ b`@:`  "a 12 2@b84 Βx` @ b` @9` 2@ԐbH@;! 㿘#`H?!@9" @  $"?$`H$`HsocketSIOCGIFFLAGSSIOCGIFMETRIC㿘`<͢" !04`@L !@9 6V 4@ !?"bxb!@9 6 4@ "!T"!Tb0a~@9 6 "!"! getifaddrs%s: no such interface 㿐@k   4a@  `{ Φ!x `@F  2m@`@e ,` ` ͠!X @:{!  `"!!$ $ $ $ $ $ $ ` @J`  @9u @` ` 2 ``y &?@@ 9 @4 25@` `΀`!t`"*@!t  2` T   @ ` `\ `\` T   2 $ @  $ 2` ` ` " @` @l􀤠 4ΐ!a@x@:& 㿘X !`"X" 4""|!t8  2`error in parsing address string: %ssource and destination address families do not matchSIOCSIFPHYADDRaddress family not supported㾸ΐ  t????R'ܐ@ " !5@=N @^  @ " !5@=@ @^  `  @`5`@^ܐ `508 @@9Δ ax@o@!/ @!* b   x@!Δ ax@W0@! L@! b @8@aF 5@+ 0@(!@@invalid SAmissing SPIinvalid security protocolbad SPIbad security protocolSIOCSENCDSTSASIOCSENCSRCSASIOCSENCCLEARSAX 4@ՐΒax @ݐ@ / 5c@^` ,@`L@ /5c@^V @ڒ / 2,5c@^M L 5c @^D   @ז " !5@< @^6 @ @x @,'J  /5c@@^ @ `/J@  @8u 2 5cH@^ /b@7  !K "54!L!J50  50 @x#`0@u#p0@r#㿘 !Jo㿘 !Kh㿘 !La㿘!t` € 㿘!t` € 㿘@  ͐ ""|"`4㿘!X`!!  `6$!!t` ` @7m `$!͒ ""|"4""|Note: trailers are no longer sent, but always received 㿘6@# 㿘!t aX #aXSIOCSIFFLAGSxΒ!@ɔ b 0a@6 4`@ Βax @W͔`""x @@"xx  7a@6ה 6c@k ` ̈́d dd d㿘1#p@㿘1#h@invalid %s%s not allowed for the AF㿐@H @ @7a@\ !tR`17a@\ ch@ 1͐#@" p " h@cp ͐#@" t" lSIOCSIFMETRIC㿘!Π!Βax @k@D$ b @6[a 7@F"SIOCSIFMTU㿘!Π!Βax @P@)$ b @6@a 7@+"xSIOCS80211NWIDx  ???? @/!Π!Βax @(b0$ @6a怢 7@" nwid %s pΠ!"!Βax $ $ $ $ $ $ $ @b0a@5/ 7#@SGIOCGIFMEDIA%s: no link type?p!``#Ζ  ?????Βax @ِb0 @5̒a6   "!`8`@Z "!\!\ 8Β` x@\ SIOCSIFMEDIA㿘!``"#a\b * !Π!$a\Βax @預a\b$ 0a5@5 8a@% only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘!`  8a@[̐ %8a@[Ɛ \ `4`@,`$\only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘W!`  8bx@[ 8b@[ a\@ "bonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘%!`  8c@@[e 8cp@[_ a\@R "bonly one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘!`  9`@[- '9`8@[' \?# @ ` `@`9``@[ *` $\  @x@p`hXIEEE802.11FDDItokenTokenRingetherEthernet ####$$$$%%%%&&x'h'`(P(H)8)0* *++,,,---..//00x1h1`CPCHD8D0E EFFccddeeDS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect  xphXH@@(@ @@@@``adhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplex9 ` @2```2@:#9`";  @2` 2```2@; unknown %s media subtype: %s㿘9!@D? !; @Y strdup,unknown %s media option: %s㿘@  ;a@4 #;",@?2 !;!@X  @_)a :@0=㿘  "?` 2   @  2   2?%s %s%smedia %smediaopt instance %d㿘`  !;"HF@ ;"P;"X;"`P@:b,  -?# #;-;+;);`2  @ 2 ` Phbpb`@P`!b`@  @@    26 `;@Ɛ"6 physical address inet%s %s --> %s p;ج"`//! @Βax @  @ 0ΨaH!@10HaHaG!"@1͔ 3 ` `@ ` ! #\! @4ɚ ``";#"@1  ` 2 `@ɐ `#\! @4 ;#@c `@no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: p΢ <ax@"z<<" @(!T`<@Ր"!`<@ΐ" ``?"` * $@Ɛ @ ax'͐  ????? @#0 a6@0ߔ  <"@퀦`@.i*  <b@~d a6@0' 6<<b@~Y @" m @;`?"`` * $@u `?"`` (* $@c ( A `?"`` )* $@M )`?"` * $@? 耊 U-<@0#<l @ 7   '<t )*!l;<; @2 @2 bP`  ` ` @  *@`2іt <@#`?"` * $@ P )   @  /<-<+<  2@Ȑ  @Ő8  @c@`@ $ݢ @-`!t 2 @ 0 \` \Π!  ,  € $ 2 ߐ  inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀͐ b    "!`+4`@}: #Ϊ!ax @㝐!>  ''''@ '@M @㆐"0a%@/z  "!`1>@` $$ $$a8" 'bx . #$aa$ 0"$ $ a"@/S? 6 "!`12>$a$ $ $ @4 ᠒ax @F`!> '@@8 >@ x`0#$aa$ 0"$ $ a#@/? 6 "!`1>$a$ $ $ @ ᠒ax@    '!> @@ɐ`?"`਒ * "@ 㿘!t`€  "`@`??` *` "`*`  inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime p b    "!`+C4`@|    ! #\ ! @1 "?; "`/?@1 bx؀ H)Β ! @/!x @` 0H a"' ' ' ' $' (''@.F  "!`1" ?@+   ?  ?//?'P !#\! @14 "?; "`/? @ ! @/@!x @ 0H a%' ' ' ' $' (''@.  !? "!`1 ?@    Ȓ @@ ! @/!x @ 0H aI' ' ' ' $' (''@-Ҕ   "!`1?@ ` ?@ 耊 ?@!耊 ?@!耊 ?@y! `?!0@s D`b ! @.ʐ!x @ᤐ (0H ' aQ' ' ' ' $'@-' 6  "!`1"@<?@n!@;< 耢 "4<@ ?@9!X`@?!h@U"@?!p@*??@%!x?@"!`@?!h@>"@?!p@<?@!x<@ #@㿘!XSIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%d㿈> b    "!`+4`@z Π!"! ax $ $ $ $ $ $ $ @0a!@, 6! "! 1 /2 @ ] $ " " " @א"! x@  ?? ` `@ " @ bx # 0a"@,ʔ 6! "!`1>& $ $ $ @ !x@པ  "@ # @x bx  Π! @ #0@l `?"`਒ * "@e  ns %s 㿈 b    "!`+4`@z Π!"! ax $ $ $ $ $ $ $ @t0a!@,h a "! 1 /2 @ c $ " " " @D"a !x@V` 7 !A7 !7 7 7 @'Y7@bx .0a"@,1 a "!`12>$`& & & @ a!x @$  !>7  7 7 7 7 @'(7@Ӑ`?"`਒ * "@̐  0 ipx %s SNAPframe %s X b    "!`+4`@yu Π!"! ax $ $ $ $ $ $ $ @ѐ0a!@+Ŕ a "! 1 /2 @  $ " " " @"a !x@߳` / !A/ #/ / / / / / / / / @*0/@Ubx :0a"@+ a "!`12>$`& & & @c a!x @u  !>/  / / / / / / / / / / @)/@ '1c0 '' 1c '1('̐ ''1cB !7'ܔ''''` # " ``` "`@2```B@ ``?"`` * $`@ݐ SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh b    "!`+4`@x{ Τ  Ȫ ax?????? @ِ"0 a!@*͔  "! 1 /2 B g????@# ax@޼!B#@)%@w"0 a%@* 6!B "!`1 B  ??? ?@# ͠#@)@Y"x`""0 a"@* ax "!`12 B  ????@e#ax @x!> @(@4`?"`਒ * "@- %s: bad value㿐 L.`  `, ,  @O @_ @*o 0@,   #@ @*$ Cbh@P %s=%o%s=%x㿘  N  C.`C#@@ٕ2C, #H@ҕ2r ``?"``` <* &`@Đ * &`@g >㿘 \.`  `*@ *`` @B Cbh@O 㿘 \.`  @  Cbh@Oϐ `, ,    @* 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  AppleTalk does not use netmasks%u.%u%s: illegal address㿐͒ "*"`,`Dc@OY Dc@V D` ?#@  (`Dc@O<  4`,`%hu-%hu%s: illegal net range: %u-%u㿐 {77E`@VR  E@ E`@O !h2 2 12%s: illegal phase㿘Ea8@ Eΐ *aha@@ Eΐ *ahaH@N  atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘# ah ah ,ah  2  4 4  E !  @ ah   8E  Ea@N ah6  6  6 Attempt to set XNS netmask will be ineffectual 㿈 l.`   ,, #@@# 耦`4 4 4 4 4 4 E@~ސ"ȁAttempt to set IPX netmask will be ineffectual 㿈 |.`   , ,#@@& , 逦`, , , , , , , , , , , 24 E@~#㿘.`  @% @( `  ,,  , ,㿘@"`negative NSEL length is absurdsetting NSEL length valid only for iso㿘@ "`8F`@M !t FR  a@M  ;* 㿘!    usage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ dstsa address/spi/protocol ] [ srcsa address/spi/protocol ] [ clearsa address/spi/protocol ] [ giftunnel srcaddress dstaddress ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] 㿘Fa@!@(  vlan: %d parent interface: %s 㿀 @bΖ0a: @&"?` G PG p@}} SIOCGETVLANSIOCSETVLAN㿀@,2  ""ࠐ@f ΰ!#b0& a:@&?bGa@t$  7a9@&?Ga@t must specify both vlan tag and device㿀 `Ga@Lΐ @1 ΢!%0a:$`@&\?Ga@s  @Y`7 a9@&J?Ga@sސ 㿀@  ΢!%0a:$`@&4? Ga@sǐ @ a9@&%7?Ga@s %dd%dh%dm%ds%lu㿘!͠ XGx@삒!㿘@㿘 @@`@㿘 @@`@㿘`< < ` 4   ? $`$  ?㿘`< < ` 4?    $`$ ? 㿘`< < ` 4   ? `  ?㿘`< < ` 4?    ` ? 㿘`< < (`( 4   ? ,`,  ?|㿘`< < (`( 4?    ,`, ? i㿘`< <00@4 2  <44@( < `<00@4? 44@?>㿘`< <00@4?2  <44@( <?`<00@4  44@ COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿀'H@   !'H@#O#x @"a`h @$ `"!Β "!"<9ΐ "b -@r   "a'Δ#)71/3;+'~%΀ GyJ* @€ '"%!$b8 %%!'"$j$b8 $b8&%!'"$b% %!$%\'" $%!'"$b8U% &$b8'"O% &!K%, %,G&! C"a ?@  =&b   8" "3&b  /"b$ +"$ 'b&' ""b  " "< "b %a "  "@ %a "b(@HH@　?~?!H*b8'H`& b b8 b8쀢  b8b b8a " b8  䀢  b(쀢 " b( 2 b8  ΀b@Bbb &!: 'bb $a H  ">  ": G42, H,a$! H&H#\ H  "  " GcP, H ! HaG$" Lx O b8 M`d"! O"aN"ȀH@f!@_ @$b0 $ & & & & & & & & & & & & & & & % & $ & & %| & & & & & % & & & & & % &@ &\ & & &x & & & & & & & & & % & %\ % & % & & % & % $ % %D & & & &0 &L &l %l & & %( %s: %s: %s: directory causes a cycle%s: %sfts_read㿘"$` L"t@BA   @p @D@r !䀢`d" ` `  @L5 " ":J  "N`@0B6 "5`0= . !V`2 !耢`3!Ѐ J`@y"  J`@y" $!В@DB@0  @D* 0"@w`@0 `!J@(#`@@wΐ "b0@BӐ 2`4 Jc@pF %u-%lu%qu'H'D`H "` 'h"8` !`H 'hH''' ''|'x't'p  'l4 D@۠@J@wQ $ ""0 2 L@2&!䀢`2&$ .2 &!耢`2& $  8'h  <`8`< (``<` 8'`  8'`08 `0`4`0"8` v'!`K! `   @荐K! ` @膔  ` @2 `@2 @#p4'p@# t 4'tb  @/S`DM K!(@"x@ 4'x    @q    @om  @.$   @($ `<    '| `  $ @M`-"$@l$l 'l2-4l`L'h'H 0'|#K''̢a0 @@"'t x''@@"' @@"'K 8@@"p?!ȟ@"8ΐ  "aH@㿘`4"2 @ 4`+ `  ` #   ? < R`2 !䀢`2 ΀`  ?!̒ €㿘@ 㿘  "  @ ` ?"`* "@ʐ   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd xR 2`""8`!` b!M  @@w+M)<9M5M7M/M3M-M ""`<  @wo`!` ; `8 @ 8@두C @wZ``@<  ` #\ $ , @wK#`b 8 @wC `  2  `@@w6 `΀    (`0"@ `P@w+` (`@w%`0",`@<`0 !`@5`(0@2` @v@a쀢  "` `  2`@``(  @*` ?"`* "@ 2n 㿘"`   !`  !쀢`2"`!`*  @א&@@Ӑܐ 㿐͒ # a܀@!!@*` @tƐ 0| &$a` !` .`"```2` @@ 2R 2`"8`!` b!M @ؐ@vf B7)     `?`$``@  * % @O ؓ,  @ِ ` ?"` * % @. Ĥ㿘Τ" `<M` @v!`!M?`8  ;` ; @@3  @u@]@a쀢 "` <`  @`㿘'D@,D#`  L?`&  @  `* $` @В  $ "@`   L?`&  @  `* $` @  $ U`D;!@y    L?`&  @  `* $` @  $ 0```?"``` * $`@t    L?`&  @  `* $` @]  $ ``?"``` * $`@G total %llu 㿐R mR 2`"8`!`b!O "@  @u  >' 6􀥀` ? "`* $@   ٬􀥀    `?`$``@ * $@ 2 `?"`਒ * $@ϐ 㿘"`   !`  !쀢`2 `M%` E >` ,?"``* $@ , `&a ` ?"`* $@  ` ?"``* $@s   H ``2` `?"` * $@[ 㿘<(@- @@ I0L0@-8@8 I0D`?"``M /F /`?"``@ |9 |`?"``3 @, @`?"``% = =`?"`` % %`?"`` *਒ ** "@  %s%s/%s ls: %s: %s -> 㷘V 2 2  P @@t$  P @@j$@̔#P "a!#P!@Jc@ 0, @s#@㿘N *%#LJ `*b<  ?*:  `?"``  * # @~  N  usage: ls [-1ACFLRSTWacdfiklmnopqrstux] [file ...] 㿘Qa8@!@ΐ 㿘@{$OpenBSD: sysctl.c,v 1.53 2000/06/30 16:00:10 millert Exp $vfsddbusermachdephwdebugnetfsvmkernmsgbufsizearandomsysvshmsysvsemsysvmsgfsyncnosuidcoredumprandomusermountsominconnsomaxconnosversiontimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypeswapencryptuvmexppsstringsloadavgvmmeterposixkeysipencapnatmisdnpipinet6ipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetunixdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathvsyncblankled_blinkconsolepanictab_stop_widthmax_linemax_widthradixAanw㿘@#)'%!R+"  n A 0 w  0  $b %" $$@ =@ﻔ#?〢 aa* @ b "  @β @ " Pb @@ `@ 2 @@ @@A `@ 2@@ 㻘@ ##@η/@` . , `!@. @`"`@"@` &@must specify -w to set variablestop%s: class is not implementedsecond%s: kernel is not compiled for profiling%s = %s offrunninguse pstat to view %s informationuse ps to view %s informationuse xntpdc to view %s information%s = %.2f %.2f %.2f can't find ps strings%p use vmstat or systat to view %s informationuse netstat to view %s informationuse nfsstat to view %s informationnfsillegal top level value: %dname %s in %s is unknown%s: illegal value: %s%s: value %s out of range%qd%s: value is not available%s: specification is incomplete%s: type is unknown to this program%stick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s%ld 0x%x %u %s: %u -> %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %s%s: = %s%hd, -> %d %s: %d -> %s: %s -> %qd %s: %qd -> %s: unknown structure returned%s: unknown type returned㺘Ȓ''#@̀'/ǐ@` =  '%S*!"` =Sa@?ʐ @N**`L'   ` ' @ `  @Y''"@A?I '@ @'",   "S@n !01 Sb@e 0'aؐ@? , @'Ȕ `? ''X |* €̒?`X *` € ''АȒ  @[ ?π`"`SS!@oS@͐!0"`S`"S" S"({ `Sϐ"0`Sʐ"X`SŐ"x״ մ Ӵ Ѵ"̀   @4b S"@oqS"@oe#\0)  'Ȓ  @ ?π`"`SS!@oLS@n"0"`SS"@o@S@o<"0} `Ȗ@!; rSi"̀ * Ȓ@ b'Ѐ``Ԁ `fԀ c` ] "#\@R Ȗ@ 9'E `Ȗ@̘ +S"#  '1'Ȗ@ ('0̀  Ȗ@^'Ȗ@'  `SS#0@lҒcX0S#`@l͒ 0`S#@lŔ0 7  )$2 ""!@3 '@E 'J`S #! "S#@l0  'Sc@E@ ''$'Ȗ` @Ȁ?$` "! "T  T H -2TS#T  @ T H@lg0"`TS"@n6T̐ P@n.0o"` T!T'| @m|@n0^@n 0Z  "`2TS"@n T"`TȐ @mT@m 0:_"`@S"@m@;?p0;8?h;;h;`h;p ;x;;; ;(;;Tp t l%T@m#\HH, @ @m   ,  ,  @m   ,  ,  @m   , T@m!0ڀ nb  T`!T!T!  @m ") 1T-T%T, 2~2 * Ȓ `@.@  +  !(08@mj2 *`2 #  ) T!@@ޒ  " 3T1T-T, 2~2 *  `.  +  a(!08@m?2 *`2 #  `?"`  * o% @2 0k?`cW#*` €  "`2TS"@mT"`TȐ!P@mT@m!H0C  "`S"@l@05"`T!`@l@0*  "`S"@lܒT"`TȐ!x@lВT@!p @lɔ 0 T!@jޒ0T!@jْ _ ^t ^ _P _ T T T T T S X( X( X( X( T X( X( X( T X( X( X( X( X( T X( X( X( X( X( T S T Wl V< WX X( X( X( X( Wkernel does contain bad dynamic port tables, cannot mix +/- with full listinvalid port, range is %d to %d㿐@ɒ + !@Ɍ - ]!ΐ @'"H @ ?`\ XS!@lPX@r 0s ;X%X-5X + -@;ڐ @T`~* 2 ! + "@;̖# *`2 >2* ,@@ $ 2 >2`*` ,@*$  ;`@c 7bHJ@  @1bH"H @g @@ * 2 !*Xa "@;#22*bH  * @#   X`@cʐ bHJ@ bH& @'㿀" (`(Hb# ( β "' ' $ %''  @Y ?$$&cHconfmaxtypenumdoasyncfreedoreallocblksdoclusterwritedoclusterreadiothreadsnfsstatsvfsinitffsmountsX" P`   ''''  @ !ϒ`*`@6' $" @*!@**  $"@K0 @*!@*  $"@<@:0n @*  ( cH' N'# θc4" 5Y3Y1S?'  @ƚ   "!`-/@i?@ b0@@P`Ѐ  ""`@E#X  ""`ԑ- ⠠"@@ub "@@"`@:  bY"cH ؔ ""#?b# "P"Tthirdvfs print%s has %d mounted instance%s sh ";0>"Yc@6 &&  ('̐& Ж̘ @I   "!`-"Y@h#0耢"`Y cY#T!8 @0T aH@ ?No variables defined for file system %s㿘"* @  @$Z!@h| ? Yؒ ?@c?b* + &&@   '?setuid㿘 Yc\?!c@d#\  &#\*`  '?keysdeletedkeyscreatedenable㿘 Yc|?!c@:#|  &#|*`  '?etheripmobileipahespgreudpegptcpipipggpigmpicmpipmtudisctimeoutmtudiscipsec-auth-algipsec-enc-algipsec-firstuseipsec-soft-firstuseipsec-soft-timeoutipsec-timeoutipsec-bytesipsec-soft-bytesipsec-allocsipsec-soft-allocsipsec-pfsipsec-invalid-lifeipsec-expire-acquireencdebugmaxqueueporthilastporthifirstportlastportfirstdirected-broadcastsourceroutettlredirectforwardingerrppslimitbmcastechomaskreplallowrstppslimitmssdfltsackidentsendspacerecvspacebaddynamicslowhzkeepintvlkeepidlekeepinittimerfc1323checksum%s: no variables defined for this protocolfourth㿘@ Y`9?c@F.`a & *`  @  [@g"8?@ [p?bh@!  & *`  '?pim6icmp6ipsec6ip6udp6tcp6rr_pruneuse_deprecatedkame_versiondefmcasthlimauto_flowlabeldad_counthdrnestlimitlog_intervalkeepfaithaccept_rtadvsourcecheck_logintsourcecheckmaxfragpacketsmrtprotoforwsrcrtmtuhlimnd6_maxnudhintnodeinfond6_useloopbacknd6_mmaxtriesnd6_umaxtriesnd6_delaynd6_pruneredirtimeoutrediraccept㿘@ Y`49?c4@.`g & <*`  @  [@f_"8?@ [?bh@l  & *`  '?spxnetbios㿘@ Yc9?c@H.` &#*`  @  [@f"8?@ [r?bh@#  & *`  '?.%s: incomplete specification%s level name %s in %s is invalid㿘  \@_cx  \#@eՒ? . @`" @ 2 \#@e?usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A㿘]]]]]`xఘ ؚ`@Ԑ!@ 㿘@sumo:12illegal argument to -o option%sstdin㿐@c'D]aX@ `8]@ȁa` ^__" a_#aC͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?c` 8"`  !] #4`0 @ * *` ,`(  $ ?@ 4ߤ  &]# 4`@3`*` * ,`+`4  8&@  8% %lu %lu %s 㿘_!(@eg "__!0@e`_@e]!8㿘_!(@eT2 "__!0@eM_@eJ!8㿘_!(@eA2 "__!0@e:_@e7!8?c  ?#@`2@ 4`  ?@3 4  &@& ?c    @@`?@ 4  ?# @4`@ @4` &@&  㿘@tsetJ뀠0 J@, @`L  * PJ ( P"J@"2  J` J@ @ `L (P* 8 @`L@ *`P"(8"tset: 㿘!!`H'H'L'P'T'Xa@А@=`@Ȓa@א 㿘`a@!@@͐ write to stderr㻘 @   @ K?2`ߐ!@ Y$ Ԑ@ 㿘!`? "`` *:  ! * #!@ Terminal type? [%s] Terminal type? 㿘 P @`@ba@q %'+`)`-``b@U@P"@1P!@?P 2 `2@?@N @ 2*LP `"b ( 2 K n  , X   `  % K K K  23040011520057600384001920096004800240018001200600300200150134.513411075500unknown baud rate %s㿘N B  `#` ` 2  `2 a!0ڒ malloc><@=!:illegal -m option format: %s㿘@@   aҐ!` $"`" `""`a$ a@v$  $ K$ @2$  @?ߑ* : `a#*` € : $  4 $     $ `*:  : "a `@ : .@u`$ ` $ , 8 $    "$ a!N$   , , , , , , , , , , , , , , , , , , , , , , , , , , , 㿘 G  " @Ӓ 2; `1b!*` €+ R` @$`?R  @  R  @  R  @    R  @    `"  2  L p ,TERMunknownTERMCAPTERMCAP=tset: unknown terminal type %s tset: can't initialize terminal type %s (error %d) 㿐 2bb@ ! @e  " b@`~@$p "b !tb@ !Ȁ .J /"+N' "ሢ `"$N+b a@  ሒ`",` `` "@N ``N ? !N    !%b#b!@00!@,b  @q 㿘Р P @  "  `,    ,   `,    ,   `,    ,   `,    ,   `,    ,   ,  ? ?  c @ # k!, $$ $ $  @6F 㿘1 J `"  ܀ "  @  2   `J㿘Р P ` & `P ,  `, `P  a & `Pa a  `*`P  a  a a  `*ДPP ! P`Ȅ" " H  `H`Ȅ >"# P`H*  P  P  㿘@I a$!  a耢 `0@b    a쀢 `0@bu    a `̀ " d   a`?"``! * $!@ @!@h# 㿘 Ȧ`b I ` E a`?"``! * $!@} `  `0@b `  #d!@`Ȓ  @b"0 !!`?"``! * $!@N  %s %s isset todelete. backspace. control-%c (^%c). %c. 㿘В`|В` @ P  @: d!耢ad!d! @r `d@kb0" `܀`` @@ `J` `d@Xb0 d`@b @O 0db8@I-q-e^H-i^C-k^U㿘 >'d%d#d!dJ@ -  J 2J@(h -2)   "J`J -2! J` e i k2 J` 2 J i" cx k ep  # @R&  2usage: %s [-IQVrs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘e`!@@   "H^ aH?  aHstandard errorreseta:d:e:Ii:k:m:np:qQSrsVarpanetdialupplugboard%s Terminal type is %s. EraseKillInterrupt%s No termcap entry for %s, only terminfo.SHELLcshset noglob histchars=; setenv TERM %s; setenv TERMCAP set noglob histchars=; setenv TERM %s; unset noglob histchars; TERM=%s; TERMCAP=export TERMCAP TERM; TERM=%s; export TERMCAP; '; 㻐Р P@  @ `Pe!X`P  |" | "` "` "`  "` "` "` "` $"`  ("`("`$@2`@]/@e@ ah   *a      L!e`4Gg t*` €B  "!em!< "!ef!5)* : -"a+  * : $"a* : "a "!I  "!eB!      @$I @ݙL@@t!p??!*`& @ @3@@ &/ <'1 !R`R@ & $ `h @|`       `77`g@f "`JВ |`P@ͼ ,  @3 @@ e!@^e!a@ke!Ȓ Ք e!В Д e!ؒ ˔ O  e!@]@fe!mAe@d" "e@#e?@b  eO e"(e"`e"e"b@]O`! `?"``  '* $ @ '@%e#@+ @(   |  ( D ` ( ()%'&*+#   $ "!$"#%&!     tsr2  u0kbok p r3iv4jzj`% w.-/f l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPcQRU>8Z[\]^_`abcd1vwxPJOIQKRMHdLg*)hstuiN!\~]ye"}qAB&()C*Xe|~+,z{|DEFG@lmnoZ-S[6hg/x.'7y8TUVpWXqY9Yf{}#$:;<=>^?_5 !"#$%&'(a%#&(*  )$ '+!"$ "% !  #&tsr0123b ku  v4jzw56789:;{!"} <#=>$?%&'()@*ABC|~D+EF,G-./f0123+,456789:;<=>?@ABCDEFGH    IJKLMNOPcQRSTUVWXYZ[\]^_`abcdefHIJKLMdgN*)hijkOlmnoPpQqrRstiuvwxyez{|}~Slmnohg/TUx-.VpyWqXYZ[\]^_` !"#$%&'(a() !"#$%    '&*+  $"#%&  !hgn ijk    fl+,copqdpez{|}~mq/.rrytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs&5 k  j%)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}ylmno+#-( !"#$%&'(,$- i㿘     @& & @ @& * 㿘`na& 0@ג㿘@ @}R ",  "R  0! 0R ! `"! `  R " `"ԓ*  SVr1SVR1UltrixHPAIXBSD, , :\ :%s: sorting by term structure order %s: sorting by terminfo name order %s: sorting by C variable order %s: sorting by termcap name order %s: width = %d, tversion = %d, outform = %d 㿘Т*`"̀ 5" xnb@ nb@ nb@ n b@ؐ n b@ϐ n  @ƒb А "` к" а`I" o#.` €cXІ!# #` nalxLІ!# #` n#n#n# "ann"`Ԗ# !#` #$!Ѐ"  0E- 0@>!n!@c(7 !n!@tcPggg!Ha  !n!@dcxiii! aX!n!@Uckkk Вa"# #`  !n`x!`c@=  $ l $    0  0 H ? *` P? ?  *` ? Pp(" ` 0A 0>`< : `"` 1 ````(& "瀢`݀ `   0  0         |  @㿘!! А "Ȑ $ ā㿘@Тa@  Ā`  x@ @ !!Р ԒאԐĐ$ā%?%pe%? %%%%c without %%?%%; without %%?㿘pb@n    @F 2pb@b@ N +Ц` 7p*`:  e"$  p ;"j  ? % 9 \  9 t   `a    9`pb *?@є   -p  #p bD ? = 9 n  -p%p` - ? & " N ?~`P`2NNN@INA9Ѐ` `  *? -p3p b ?   0+p@ܐ" 9Ѐ``-p  *?#p` bڔ ?  Ӕ  9В  ˔ N F@%s@%s#%dim=ei=%s=!!! %s WILL NOT CONVERT !!!..%s=%s=%s=meml=%smemu=%slqkxjmwuvtnbox1=x?#?'Tc*@  "@` o"! c!Р Ԑ !  " ? ܶ"P5?#7q +  ` -  +  " " $ * @ ,    (  "(`  L O L T"  @@6 @804X    +Ā " =  V?#+q%q &  ` -  &  $  "" $  * @ ,    *  "(`  L O L T"  @?,  R@@b@0@~H 4    &`Ā -@o 2  2  &,`"  Ȁ "  @O 2  "  a쀢 "  @Cf, 2  "!  ?#ж !  ` -  !  & "" $$@   * !,   2    "(` L OL T"  )   Ѐ`ᰀ   ,  |@   q "P਀@    q"X ^' @?/  ,    ?  ?c@"@ qb@@7   ^"V4 m, RT @@} <  ?qb`@6  c qb@@ @*` ,!` \L : \, ,2 @ @ ,` @ *` ,`  qb@^   @_@֐,  T@`? qb Ѐ` #   ` @@5 `  ? *   &l ?#qb@  &pDq?#b@09 ;` "H?5 3q?#@  `L@`  @H " , ,q"?"ccc7  ' T`?@ @H `9Ж    ԐJ?`  J?  ?"  Ԓ J :J J  J \ ?" А` `* "?ܖ@`ԁolder termcapterminfo# (untranslatable capabilities removed to fit entry within %d bytes) # (sgr removed to fit entry within %d bytes) # (acsc removed to fit entry within %d bytes) # (terminfo-only capabilities suppressed to fit entry within %d bytes) warning: %s entry is %d bytes long # WARNING: this entry, %d bytes long, may core-dump %s libraries! 㿘 ` t!# @y t"#   V` St@O" Ftb "`bH"b @O t"bH"@O #3` &`t@O"{ #!ta@q0#@ۖt#0@Or&`"" "bH`@`%s%suse=tc=Р   ?#`u`aXu!`u!h@ ?#  @Ȓ` ` comparing booleans. comparing numbers. comparing strings. use㿘2`u!@`` 5 +  ` ,  + `"`" #`* @ +   ` "(`  J OJ T"`  ` р +2`u"@f`` 7 &  ` ,  & `$``"" # `* @ +   ` "(`  J OJ T"`  ` π &2` u"0@%``  9u!  ` ,  !`&` `$" `"#@  `* !+   ` "(`  J OJ T"`   `  ̀!uH   㿘  ? " @s *  @ld `"  2 D !? " @_ *  @lP `"  2 F f(? 2  `Ȁ? " "f( "  f,? 2 a쀢" a耢? 2  a? 2 "f, "! R`B?2 R`? `  ? 22`B  !  `v@(!`?, )  8? " @ *  @k `"  2 H "? @ *  @kݐ ` 2 J㾘 "H?[ Y  * :     "H J` 2J *  `< !@  H `H J@ +@   HJ `2H  ,`K@ "  "H*@   H *@  (K@  "H*@   "H*@ TERMCAPTERMPATHHOME%s/%s.termcap /usr/share/misc/termcap@x >w@Ð! wL /.w@! @E>$)$@w@! "L "@j !# wwa@Y$@wa@E$*@E$$@`O  J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @= +?'t@=t t t@DԔ$@C : ?L 2,? t ? ?@? ?termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@ : 'x@CK Px*x`'D)x!-x x`@ 2  x @L` @D@ 2N `?"``  :* L @ `   N  `2 oWN倢`E?x#*` €x@L% x@L" FNx@L ANx@L 8!@1p"@03.2 + ( & # !              ؐ 2`Ԑ ے ~ݐ ?'ٚ #"T"''//aa (' ' ' ' ' ' ' ' ' $''`@͒ ?2$WARNING: terminal cannot %s㿐!@`  Ѐ`{'#p@/kLINESliCOLUMNSco㿐`䀢?  z#@U  $  $   @`h  {"!@$#Ѐ "{@f@ #"aa   "a `h@  {򀢠"! @# "{@f@ #"a a  P"a krklkukdkPkNkh@7kDhЮ|!H'@   1Т"ؒ@ܐ@  ,@  ,@ @ϒ@  ,@ |!P'@ o "ؒ@@o  ,@  ,@ @@b  ,@ |!X'@ P 3Т"ؒ@@O  ,@aH@@E  ,  |!`'@ 3 "ؒ@@3  ,@aH@@w@)` , `|!h'@   aH@@d@` ,@`|!p'@   aH@@R@` ,@`|!x'@   "ؐ@@@  ,@ |!'@   "ؐ@.@  ,@ |!@ '̦ "ؐ //Ҧђ@@ʐ  ,  , @ @  , a˨ //ђ/@@ a ,a쀢   //@@ , aH@@@UTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐}@X!؀ }!@ ܐ 4 }} /?}@ !@.,}@ ""a}@ ""a}@ ""a} @ ""a\} @ " ؀ "`"``#!"a#a"h "  l"!Dђh} '@ Ð"(Ҁ`" h @* }@ "0Ҁ "`}"8"`}@ "@Ҁ "`}"8"`!!Ҁ`# Ѐ`2  }@ "H$ }"P@ $` `}"8$ ` 2}}"8$`}@ ~"XҠ " `}J@ 2 }}V"`}"8$ }@ g"x!\Ҁ`"  }J 2 }}<"}"8$ }@ M"Ҡ " |`}J@ 2 }}%"}"$ |}@ 6"Ҩ " x`}J@ }"8% x"ap "ap}@ "Ң" `2}}"8$`}@ "ȒҠ" `2}}"8$ }@ "Ҁ"` 2}`"`}@ "Ҁ"` } "`}"@ Ҁ" }` " "@ Ӑ"Ҁ "`}"8"`}"@ ȒҀ"ࠀ 2}` " "@ "Ҁ "`}"8"`}@ "Ҁ"` 2}}"8"`}@ I# }#}@ #Ҁ "`J }}#"`}#@ ` x}"8 xJ@ }"8  @0 @Đ@u @'}} @r0"`l}#8@ \` x}"8 xJ@ }"8! @ @@H @'}}@@Eh"`t}#p@ /`}}"8}#x@ # a}"8aЀ  " p}}@8"`p  pJ`"!| 㿘!!@Ff$  㿘N  N@ 2Nϐ "N@  ݐ6㿘!``#!#a@F8`@F3a "`㿘!`% `#!#a@F`@Fa$㿘`l@F 㿘`p@F㿘`t@E 㿘`x@? @E 㿘!`@@*Y 㿘 J`! @EՔ㿘`|@E˔㿘`@E’ 㿘!\``@E 0`@E 㿘`@E 㿘`@E 㿘`@E 㿘`@E 㿘`@E 㿘`@Ew 㿘`@En 㿘`@Ee 㿘#!#` @E[@)ϐ `@EU 㿘`@EL Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@*?@  "!  !@v ? 0񀦠@  #H @) 0#   @A ?@D$?쀢 @)Ò seek errorread errorWaiting for data㿘Ң  `$  2 `( @+` 2 `  ?`a0    !耢 `@ 2$!0` $ & & `Ȥ  $ *` @ @Ҧ ? 4`2?@(?``2``` 2` y ?@쇖 ? `Ȁ2 : "p@)E g?:  ?   $`Ȓ # @'   `  ?*#  ?怤  "@)! j  Ԁ   `@z `Ȓ <  B;  & !` ; 0 "@)? @w  !Ā`2?`` "` "& &" "`  ( j`Ȑ  ch_ungetchar overrun㿘? ! ?"@(ɒ $ Finishing logfile㿘`Ԁ $  # `0?`4? ""X@( !@?!Ā @RԒ?$$`܁Warning: log file is incomplete㿘 Ȫ`cB  gB 3` +    )'``Ȁ@2 ` #@(m    2@` @ʒ``ȁ"  2  2 㿘@ U? 4Y @ 8T  cF  Ȣ3` + @ 1 @*`Ð %```42 `8,  `@?!Ā```2 `@ `Ș  $+   cF + 3` @* @ ( 㿘1 ` @`  :0@;? 1  2 @B?!İ 㿘 w   2  `Ș@&  2`Ȱ "`("`$?0?$(( 8㿘 Ƞ$@ (  ?  ?`(#4`$ "`("`( "`$㿘 Ȱ`( ?"`(`$$#?`     ?# $" (" $ $@ ( @ Cannot allocate %d buffers㿐!#  @6 @I   Ȑ`` & @''  `2    seek error to 0㿘`  ??#:0  ?"  2"  @`  Ș :0  :"$"(  @ ?!8@&ޒ 㿘 @Ï$  Ȓ?   " """"@" 㿘 @   # @" @  `" 㿘  @ۖ ?  㿘#@$`Ҡ  "`Ȓ 8@E ?  ??" : " : 0$ " "" " " $" (Ր  ` "``@  ` ?""` d㿘 Ȣ`  `Ƞ `` 2   2`@ ` `Ȑ?"`  @``$`@֒ ȁ8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘N ؀` : +*:  9   06,  . a0 b ca0     * N?? @% R Ҧ!%@*,@@%ے G ,@? ` N Ґ!؀@,@`@*,@invalid charset name㿘 "  N   0 `  @E "   2"h@%  㿘c@M  L  `ؔ  J ` * "* *  *s<%X> J*J*"J ksd  , u ,  ,  ,  ,  ,  (LESSBINFMTLESSCHARSETLESSCHARDEF㿘@ X@ hv @ x  J@  0Ґ  Ґ  %cESC^%c㿘   !a0 !a8@   @ܐ  !a@@  !(!Ҕ@ а Ё҄""T("bP"X㿘@y!؁㿘Ҧ bT!؀@J !$TJ"P@c"PT"@$"P. N 2 P@jP@TN *: @$8@@ N@`P@LP@!p`  T!؀@M!؀   㿘1"TJ " f"T`@$ &"T@P @"P㿘Ҡ"T a؀ ("TJ? "T "TJ? 0؀ J?   o"TJ?  㿘bTJ  "TJ@ 0 "TJ@   㿘%TҐ!؀@!bT$bTJ@箰"P"@$"PN  TbT 㿘J!؀`  bT4*!p `?㿘1"TJ " "T`@#t&"T@|P @"P㿘TҐ!؀@"TJ!@g"P"@$"PyN    p㿘!p`̰ 08 !p ` @" !p ` "Ґ!"bTN %bT *bTuJ@@%P@$P@#bT $bTN`T *㿘ap * Ҥ@ !؀ #apap  @؀ 2apap  ap$ $`$ `""`ap"`㿘!p @?a4  `@ Đ`#X*` €@"!0R"!0"T"a0J``  "T,"TJ@  "TJ` { "TJ@  0rT a"!0  K? "T "TaJ? "Ta؀ U J? %  "T(K J? E "!0@T"!0J@  "TJ@  0/"!0, "!0'"!0"G"!0*"!0l"!0Ґ "bX"!0  @ "!0  " " ! ! " " "D "X " " # # #4 #D #4 #4 # 㿘Ҩ!@ uK!"P_@"P   $"P@P "@|$P0G@T  , T? : T* $TTJ?`%?0L@a @@ @ؐP$@@ P@VG 0@! L P@ ӢP@ 㿘 *`:   (L   㿘bTJ   !Ҁ "T"TJ@  !@ "Ta؀  J " "T!؀@  N?   ? N? 2?㿘%\ @ $\ '`Ҁ`""d@ !"T " "T"@;$`"T @@ *@"T$\*@?㿘   1 # @"l@"l㿘!0` !"\`2  ""hҐ"l@N$a0 Ґ"bh "hː$"h%T bd  "T"d@h b`$a09 $a0d 㿘bX "bX@<      㿘@X!؁㿘@ @乐P@"Pҁ!㿘@ q㿘O""G܀ @ @*!/?㿘b   Ґ ("b"!!" !" @!" !!aD!done|done㿘bܒ`*e *` €"@:0YL@!L@ +"` "` "L@@L@ D$ @$ "!L"@m8,"" L`WL@00" L@PL`0)@0&L@ ! !!| @@ 9$!|!| @p"@l"@ G 0 Jb@ْ"@ >  + ,x ,x ,x + + ,x ,x ,x ,x + ,x ,x ,x ,x ,x ,x ,x ,x ,x ,x ,x + ,x ,x ,x ,x ,x ,x ,x + + ,X ,x ,x ,x ,x ,x ,x ,x ,x ,x +㿐"܀`/#*` €?Ѐ v@  dr "b$ !Ȁ d!T `ҢJ"耢  + -X + -! "Ґ "bҐ "b쀢 ,b@  Lb"@bP Lb耢 + -1,b@  -/// / 8   *  @ !0 0 @! b  "b0  M   ?݀    ̰  - /< /< /< /< . -\ /< /< /< /< /< /< /< /< . /< /< /< /< /< /< - /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< -[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘!x`Ґ"x@Z@ I    ?    @ ٖ  @  `!! @+$!$!!` !` @ %`Ā a E!!  T@ `X$!@# @e :0C@w!`@p Aless version %s㿐a'"@@㿘x`Ґ"x@"xJ"x @ "܀   g   0 @(ungetcc overflow㿘!!x !xҐ"x$!x!xҐ"܀@ # @}  !x* $!x㿘@? Lݠ?:LPattern not found㿘Ң b Āa `@ @ 0b  >$b%@Ɛ  @ؐ  ` @%  b 逊 `#@&  @ 튐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈aҐ 2  ؑ:    ""H+%3)ٮ1Z%b!$䀢  .b@&!`#?!Ā !Ā b܀ "/  b܀ "/[  '/'@D쀢 ` ``c/ t*` €a l !䀢`"!t䀢 @M$U @ Y 0䀢`"!t䀢 @:$B @  0}䀢  $6=䀢  $-?䀢  $$+ 䀢  $, @ !ِ ؠ " "a  @  !Ā  A$!䀢 4%HH @  05䀢 4%HH @ G 0* @@ p䀢  $@ ўH䀢 &$䀢 d d$@ 0䀢 @ 䀢 &$ؒ :@ -d0@ 'Ő!   $$ `$ $  $` $& 0  ?  ? "   ?  ? "@ $` $[ $@!$L!`x0@!F@  0!Xa D 0!@  @גa0 2[!8#$`T!X'a4@ @F@ Ā ]댐 0Y䀢  $@䀢 P!`!`w 䀢 $!"'!䀢  $@䀢 0䀢 !"'!@0"䀢  $@䀢 !@ْ 0a0 /֔ Ґ $"baȔ ͐  aȠ !T b@ 0aА  0!la 0aؔ  aȠ !T ؀ ր @0a  aȠ !T   @0a z %aȠ !T    .@i !l*a] %0aW 0b܀  bN m0! ؐ |"a 8 84 9 : 7 >4 @X 9 8l 7 9` : :L 9 ? < < : @$ =| : 9 > > : 8 8 :  @X @X 9 :l @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X 6\㿘!@)!L"@= C@O㿘  @z  @&""" ?Warning: some commands disabled㿘#ߔ "@ Warning: some edit commands disabled㿘#ǔ "@ @ 4J@K)`J@ g`"#!" ?J`g2J@ fJ@`J@`J@2``@ И  d㿘 d     d"㿘c㿘cH"H("@㿘@J J ?l 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0ĐC S'@6?  㿘@Ӓ H @z  @}    @ ?  @ @k)?@.@c< "N@? N  M N  +N  Glz .lessCannot use lesskey file "%s"㿐@:#H   #P'@p@Ðx!Ȥ I !T C `` ܲ` `$--,   ` 6 d` "  d   d  d ܀  M`0 㿘z@ܽ&@@  & N@ ".@ `@*N@㿘`@ܥ@ @   N@ "`@  `2 @ J"?8J?   ?J?8?㿈`Ā " @耢?쀢?@7@L#c$ " $@%b@@c$$c$$ā㿘  @0 @-%s"%s" may be a binary file. See it anyway? 㿈 Ā `Ā  " @'@   S c@ #  H'@ϐ '# @Q@ؤ쀤`@@؜@_r @<  '@'# @4@؇䀤`!x`@ @s #('@s쀢 y Y@Ȁ`" "#$"b@%``@`ؒ "8f ܀`#a @  !y ̀@X`?a `$ @@ @  !`'# @Ғ 㿈#`Ē  @    @' Ħ @   @ Ā     㿘" @  㿘" @ 㿘 Ā`  @? ` 㿘 Ā`  @?Ґ ` 㿘 @z "  @Missing filename ("less -\?" for help)㿘@c "  p@+ 旐 #㿘0@?@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 H@ @ٞ  ؀` O!'@1!? 0$* "@€!@F"` @ƒ !$ Ԓ  @ ? Ԁ @o Ԓ? $ " !P@ א? Ԁ '!@ RD R R R R R R R R R R R R R R( R R R R R R R R R R R R R R R R R RD R R R R R R R R R R R R R R( R R%s/%s㿘 % L@ !@@  @   c@t@P @֢ @HOME㿘@% XВ  LESSHELP/usr/share/misc/more.help㿘@  d㿘L@ # @'%*`:  # %2 Ā 0 Ȁ G4@x`@٨`L@  @ I L@  @1'*`:  # %2, @W`@sҐ@ل `L@  @,%s*㿘@s  @tdb8@@Z @  @ X  !  @ ?2    @ @  y @   㿘  @ؽ ??? 㿘 dɒ  d@ ,,佐@s[@չ@ , ? $@W  $` ݒ$,SHELL%s -c "%s"r㿘@`@" @ܐ 䃒 @s̖@  P N `h@ǐ@Đ k `X@s@d`h@葐@\echo %s㿘!` |@N`@@0@=LESSOPEN-㿐 ?@վ!ࠒ " !@n ". L |    `T @9  @軐 O&&@ 2@謐N@` LESSCLOSE㿘"@@y" P@8@| @)'!x`# < @   @ Ð @rac(@ @  㵐 @rSc8@}78@v Đ 㿘!`gq㿘!`!Ā`@??  @ a "a㿘a @<"a...skipping... 㿘    a?4 !  a?   F)!`a?Ea@   #P Ѷ 0#)@G? @ @ '@ @Wa  '7?#P '@J!('-?@> &#P 3ـ?a a  #` a#`aؐ  "aa @x? ` ͢ @?Ǣ Ő¤ @ߐ ?ጀ "! !Ā`a "a %#P"%#P@i%#P@ ?㿘@   a?ش "!@Ғ`&@? @1? `@)@ܐ?㿘!`!` w  E[ 0A@d??5 3` ! @ )!`@   @E     @=??  ra  "a 㿘@! ?  `@?@PU|   #?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘+ #x@O 0@#@a ᘐ a@pc@ґ@[  @4 @҇X   " 2 㿘`2@#X@ && @" `&@& c "c㿘 ?" "c?"c㿘 (I 4& ??> & ʐ㿘 ! Ā@#$ Ӑ@. @, XX  X X 㿘 2  㿘#X#X "   @> 22  㿘  "   @: `:  :@ :` "   " 㿘?؀%!D`#*` : @ F @, @@? @?Z? +#٤ (#B? @ ! `! ?  B? aĀ ̀ ?y!ذ  @`! 0aĀ p  ?[ 㿘 `!D`#*` :  @ @ f   @|F? q!`'-42US  -%Ā ZF  ?-0N `B Ā D0 ? = 2 @Ǩ@Ғ1/B? @   2" @Ð D@?Ā @? ?D  @Cannot seek to end of file㿘W  `@4 0I?   !  @”0!  @Cannot seek to beginning of fileCannot seek to line number %d㿐@x?  粒  !d@0,  X@d!@ 0'!0@ݒ㿈@@@rDetermining length of fileDon't know length of file㿘!?  "0@ ?  "P@ 0> @ɖ @. d   2@ 8ؚD?!d @ 㿘=  ?  @Cannot seek to that file position㿘@@Z & @ΐ?   ?@Ɛ   g  #@< 0}@  @??   @ @8;'+ـa@8 "?   0N#? ހ@a"a""%?  0/+ـ4 @  0a? h? 瀤@ " @sa?   "# "c"*%6d㿘!؀`B@q1#!ؔ!xb@m>#@Bcِ   "cҚ#c * ?`#c! ؐ #!!!xc1Ӣ !##&# , , @$# ##"#      0   0  l      0   0  h㿘 &? ! #`  Ґ#J ` `#`Ґ#J 㿘#Ҕ#J ؖx##J !#"@$#㿘`B @% 2 !``ؒ@ @@ 4J Ӷ## B %#Ҁ`?xJ ` cN `Y   ?." `5ӒcJ   `2 cT  ?&c* x*  &㿘J#` #  @ ",   !`,:# @㿘#c  /!#!xJ . :`@$c   _ _   - Uؐ G  # $# $ !     0|8y  * r l#`k   f$c a   $a!1Ӑ    N#`$##@a  J ڐ 7!``ɖڐa,{@Ёؒ@@ @@4' N "!ӑ*: і #  $#N`   c "c 㿘J#` ` Ӏ 2 #  2 c !` !` !`؀` Ҙax + *"ax*@*~ "@X H ҄H "@x ӄ  㿘??  ?ذ? ?!x, `   !w B?,ax&㿘 42 ?`ÐF? ٰ??  !x?<,, ?8?a`B 2&ӆH Ӓ  #H՘& c    @#c   8"& 8ӄ   @ b ; 㿘# # Oc   4 #@ 8 #@  @5##@!"!"`:`"@"`$  &@ #c c   `   4 2  8` 2 #a " "@Calculating line numbers㿘#@   "c㿘!!   d$!@ $!` ?$!㿘!؀`?   2 `#  # # #  4 @8 x@ u@ # Հ "a   b@ f 46 4 2Y "! Ġ8 ?"E @"#421@.0+q 2( "! Ġ ? T@"#ې㿘`Ӱ a # #   & R @ # "     "@$@ !   25? 6 %ِ İ& ? "!?"  2?  %ِ( İ ??? ?q㿘@ ⃢ ? ? ?a  @ ?   !& ?Ò@"?! /dev/ttySHELL%s -c "%s"sh㿘N -  ,@ t!@ r@ o! G ް@ 8W @ @ @u !@ 6@@ʘ!Т  L@  N @K@H  aؔ@h7  N 2!@@ڐ@9 @a@5@\   Hؐ "` ݐ @; 㿘@͐ 7?@ א ?   @ ̐? .   4 ??   @Cannot seek to start positionwCannot create pipe㿘ʒ   `@܏  @  {?Q@!@@!ٰ?@a؀ @̐  @"  `E 4' @# P?  ?` $  @ . :    * $@g&Ӏ #?!+? ?` $  @ . :    * $@g߀ @ܙ @ɐ @n  Z  " @T ՄА?? 38֐"??: Invalid mark letter㿘? . 1ӑ*  ? #@^  . 1ԑ* "Cannot seek to end of fileMark not set㿘 '"3 . $0.! ^+ İ  > & 3"K ) İa> & #aհ> & ""  ?  ? @@  㿘`?㿈  @ 0> &> 㿈@ $耢?쀢?  "#";`;`㿈 &֐b ?2  ?2  `!d"b  ; #  ? ?`Ā@"& EMark not in current file㿘T   @ "@ ??Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 %  0-0*)"  #P Ԁ`#hֶQ]"޿< Ԁ`#@C 0 '#@<㿘 "`ؐÒLine number is required after -l㿐  l'@d 2`  @ 0"c蛐Cannot use lesskey file "%s"㿐  ' '!@@㿘  0)'"#L@N!䀢` > @?   L  : 0!d e Tags file "%s"㿐   ""!0"a!'"`@/㿘   "#(%"%s㿐 )  "N@0,+N@ M" m = !$ ذ!( `!,`!`!$@ծ &aؐ!$* '#@`㿘   !)!$!㿘   @ 㿘   x զ Use "h" for help㿘!`    @" 0հ ب@T "`Ձ t4There is no %s flag ("less -\?" for help)㿐 'D֦" " J@ € $$Ⰰ  DJ ?`0+'D#ԓ*` €DJ@ +`?`f`d'D D"J + 'D"`M D@O'DD z?'D@ 2  @'!X@    "`   `, # D&     `?"N   @[`? J@  @'DD@  "@  €DJ`2J 0  There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@f @'  ` @ @ڐ'  2 ! @ΐ' @0   HJ`"  ` @ V "m``  "&   a`> 5[`"Q` "` R`" `N` `?H"` `?C"@":` "N@;`" N@7`` @`@b`?` )"@4(`$ "`  ``H@ 2 ``  "`"@! @c 05`  €H`  @ `  "`   ``  *@> '@7`` ؐ "`` @  ` -%s㿘!#"`@b㿘@n    S@ 㿘@b  ` 2`@ String is required after %s㿐͐'!@㿘"J@㿘N A $2``*@J@  @ Number is required after %s㿐 L -2    ?А  &%?'"`@   А  * .  @*`: В@ Ѐ$&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenH  "    J2 H㨒J   ( P  J򀠀  㿘'D'H'L@" @!ؐ $ D?H@L $ " @햐 ?㿘֐"@Ӓ 㿐@R%s: %s㿘 "a@jT@@ П `@_#?㿘!  `@   @Ė d<   . `@   d@ . 6` .`@B2`* @ *`B2*@ *@ 㿐!Ā`ؐ m"`  M>    0  l z ֈN       D R `&  `v@9D 2   0  0 .>㿘%֠"ࢢ@ ̀`  @ؐ "`$㿘! א"@ a<  ս"a< * $ 㿘N  * : N`㿈6 2 @Ւ 0,@   -, $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘!#`̒`"! J] `̀`q 0' U! @ $@  q F   ?@! ؐ "`2㿘$T 0%!ؐ "a<㿘! ̀ q@  ̀   0 ԧ!  @ ؐ "`??? P 08P*   P:a P(8  P*: P8  P??( ;㿈ᜢ b$ `P  @c@t Pa???ak a$ P$耢?쀢? P*  :?P4 ?   6?P42 ( ?㿘! @  P*     @ P 2`"``"@??: ᜐ $ ᜀ6?㿘Ԑ X!$!$!$ΐ $ ʐ $ Ɛ!H"a#H c"cH c%qd㿘cc@] %d㿘c@\c㿘cה"͇ ?( 㿘? ? ?a  ?   a& ?} -㿘?. > `6U"*` €#גb耢@ J@ 7 C!o`@xa88!!؀`3 L!?8  $* 0(&!8? 7 4 ` , ?2    `Ā@   D L h x D l㿘?`6!*` €4? V0ta0ph``8 Aո B 8 4`2  -?0Lߞ՜ ? 4ȞՈ   0$Оה"耢@ J  c? "cJ? c0 -`Ā r  h x  d  J:" ?." \ J2 02 0?㿘N l"   p b" 0"! ?* : `2#*` €&@?&@? &@? &@ad&@&@? t h `㿐צא""N` 1T N :( ? %' .2c* \c* ($c c*@`!$c N n 2 E N ?Zs N Ā :؀@ "!8  `*@@ "㿘a 㿘!! `ؒ"@$*"@  J@ @&   倢  L`* *` @2* (**`J@ @*J L   J  @ 㿘#耦 `4 %#!p`*%#a ?# ڐ   А @  ݒdAa?%#No previous regular expression㿘  x, 0  `?"Invalid pattern㿘 n @  1@f    ?! "&!@&! 㿘!! "$!@$!㿈a @ `? &@ & 㿘! "?@+ ??:$a:D- 耠2' "" 42 2" 4 2 ( 2 㿘`@@ 2 ` @` ` 42` " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@0&@#㿐    6    >    2 J@ 2J@> J@ `'@`J`C '`JC `Ҁ J ̀ 㿀'PD'T A'PT  B PT "@@ 8 F :`@ F :`:`HT(N  ٶP۔T P!`` 1@'&!`2@㿘 `!L"`㿈耢?쀢? ? @g 㿘!D׀"c㿘   ( ?"  э!P`  ? ad    㿈\`/Ā ? 4 2(<y      ? ـ !؀??<S!؀` @, $J `   @ "0쒏 @ 2 `  "Ā  ĺ`!D` 쀥2= Nothing to search㿈`N@ , 2R x!D`% !D 3c耢 "5&c&c1&cؠaL  Ȕ h O? " L " L" !D` "#!D ߐ???2 #\`%"R  ?#\#`??  !D  Đ 0 !d!D    㿈#c #? `?#??" #@ #`@##? @??O*  ; B?D #?#?? #2` (*  ; B  ?? #`*` :  c@*   * @ :`@ f #?Dc:  2 #@c  #: @ c @? @ 2#=(=#\#`  @? @4 2=(===#㿘`@ ` "㿘`\@x ` "㿘`@g ` "㿘  `@S `\@O `@K 0 @H  @E  @B Line numbers turned off㿘!Ā Q ""!Ē @/ I aƀ  @$  @! @@s `\@ p ˬؐ "` #%a ^a  ؐ 2  : ؒ "H" c ؀ "cؐ "`"ؐ!P tagsrNo tags fileNo such tag in tags file㿐a@abЦ " {"!@3)f-ؒ@p 2aL  2[ت "`Ф @%!"Ԓ'J@ K %!'J   *` Ż''J`3 `)$$J@`'J@ ^`'%`J \`'  *'J@  2J@J $"*@tѐ0 @- @tƐ" %!Tag not found㿐 Ԁ "  w5 !0 ?/?Œ   /-+Ā 韔   ؀" "`@~@pH ā/dev/tty㿘 @"@؀ "`ؐ "`؁㿐#ؠ `ؒ1 ? ?O O "/ `㿘@ ِ ـ x p h ` X P H @ 8 0 (     @      ظ  ذ@nfsv2porttcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3port=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernel%snqnfs 1/mount_nfs:nfssvc err %m@! #$"b'x't@< X)'! "|+xt97; F* @€"耢  a@P w$쀢 "`a@F   =%"j$`!@]V |J@ 6`!a@/ @$`8S$`bؐ O%b` K$`!@]7 |J@ 4`!b@ @$`@4$``(0$`!@] |J@ 4`!b @ @$`($`` @$`!@] |J@ 4`!b8@ڐ @$`<$``@ $`!@іt`bؐ %b؀`t` $`t t`($`t t` @$`t  "耢  bP@ܥ $t@ 쀢 "`bP@ܘ   =%"$`t @@` $`t 2'"$ "耢 "`bp@  !$$`t(t` $`t@  $` &t@!@Q4b@*ߐ 2b't"耢 "`bp@W  !${$`!@\g |J@ !b@@ g"!@\S |J@ 4`!b@, $`$ Q$`` M$`  $` H&!@\4 |J@ 4`!b@  $`, 2$`!@\ |J@ 4`!b@ $`  $`!@\ |J@ 4`!b@ $`0 $`'"@@>᠀?s?a* & @ @@@` 2@ x@  "!`-c@ۮ c@@ސ `%4b؀ @  ?cH@͐ @p @i@M @K @I @cPX @#H ' !᐀ Q @!Ւh!@߻  "@K ( D ݰ  \ ܸ 4 ݠ h < no : or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2can't access %s: %sh?!'ܠ"P Z@h, Z@hn @ @hh : @ Z / ٢!*@w `$ @c  2  @ 2!@ 8  @ "耢` ' ` Ԑ =$b&`'   'خ ٢";'b `'b5٬+a)b 7"  o- 5`   ؐ@ ub,  "؀ 2}b@WC!8xb"2`''` 2  bܘ @R  ''b@Pܠ  "؀ 2Rb@W!HMb@;$`'耊$'  $$'' #\b@bԐ  " "؀ "쀢`paX@U_a@ڒ@"؀ 2ba`@UR@@ b @ @$bb? #$b!"؀  ?@$"؀  ?ap@ @ @ݷ@ @ @ @#P"ؒ`$"@U <b Ebb"؀` "@ "!!!x@YĐ @; ِ!2  &`&`&` ِP&`D&` 㿘'HH@c $㿐@a/ J @ "`E    >  &` `@bI 6@`` "1 `  ?+@b;` &@` ! @@` `@"` `2  ` P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘` @x `@ϐ!@ސ ,-o %s: option not supported㿘@N  @& ;' n L  o  @fj = 2*`"@N 2    @2   "*@ "#`2 aX@ظ  @P 2L@㿘@eMemory exhausted㿘@V @FH"Ё㿘@Ð @F>"Ё㿘@ @F3"Ё2 (@  (2 *@  ("@ 2 (@  (*"@    ("  `8 `     㿘#H` 6HcH, @ cH" `cHH``, `* "`H*`H"@H@"ڄ #cP L"T+#XL   L   L   L   L   DL   L   L   L J  L   L     :blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@#d@ #`@h`? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [X  -dD#` @?`"#`r%d!x* € d  @Dڐ#   #L` !ch?!! ڐ!"h! #L]d`Y``J `)` `J@ \2LJ` )GL @d `J `|  `J@ \LJ` |1L(d `J$` #L }ڐ!"ch"lȰ! r#L nڐ!"ch! e#L aڐ!"ch! X#L Tڐ!"ch! K#L Gڐ!"ch! >#L :ڐ!"ch! 1#L -ڐ!"chz!#Ld#ڑ2` ڀ`#l`ڐ!"chc! #L`#l`ڐ! "chQ! #Ldڑ2` ڀ`#l`ڐ! "ch:! #L2   ڀ#l`U`?d?@*`: +` *  ?АВ`@ ". J@?Ѐ  @@ "& J@ ,2! `@ J@?Ѐ  @* : +  *  ?АВ`@  J@?Ѐ  @@ @ J@ }ڀ`#4ڀ  ~dڢ` "#t# @Co`d ?А &` "%d $ctct*` * ?$ctd  `# "?@CQ`d  ?&` %d ,@CB  ,Gctd  `# "o?@C4`d ?А &` %dڐ?0"cx"#x #x*` * ?$#xd  `# "N?@C`d  ?&` %d#x` ct@ L@B L"#xL@ } \@B d  `# "#?@B`d  &`%d }@Bא ڐ! "h"cl$! #L$2ڑ2    #L$2ڀ 2ڀ(ڒ ڐ! "l"h! cL2   #pڐ  ڒ!##p#cl"h!cL2`   #p2@ڔڐ!##p"ch"lװ! ڠrx#cL @  cXTcL "ڐ M"#l e#L aڠؐP %#`L @ ` _2 $  `L W2n$l?j$l ?ڠ/d   ( @B/`d @?`&` ^%d  ` ( o@B` ' @d`?&`%d'93/ڀ [T \cL N   H# a!)+ړ, Ң 4#T @ !    @#`@@%#`cd"@`%cd ( " ?@A#`cd  %#`%cd,`ē, \dcL d  c` ( "?@Ac`d  &c`%dd  c` ( "?@Ac`d @?`&c`-A%d  c` ( "А?@Ac`d  &c` ]%d?&`+%d \dcL  c` ( "?@Aic`d  &c`%dd  c` ( "?@AXc`d  &c`%d////ɰ Т//@} 4) @}Ȁ 4# #T` L  `  * @ R`    *@ R`  $/ ] [  #La cX+"#l#TڀO"cl%L @ `GǒL@ `  ,`@ R`  ,`@ R`!%"#h  d@"h"h"h  "h"hڐ?"ch?  $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ d 4 $ $  $ $          $ $ $ $ $ \ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ ( $ $ X $ ( $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ 㿘#H``!`* "`cH *`cH"` cH?  *`"` " +  €#?cH` "`# $#cH#@4"               Unbalanced (㿘!#| !!! ! !!!!!c|$c|$#|@ #|!@?Đ `$#|!㿘#H` ,  ?! !  ! !  ?  ? $ 㿘` . !#H Z@ 㿘!#|> H+#|! 8cH`cH`x `";! ct  4!t 6 #x˒*! t #x !! #x Q%|K$#|#|> #|㿘ڠ#|! #|!!  㿘c|!  #$#| ߐ!#|ې! #|! No syntax specifiedUnbalanced )㿘#Pڒ?ڐ  \"d##h"l#H ` #cp@>#!$#|"# #|?" @>ې  8!   !  & `  @+ @ "@@"`&@` ` ` @@: `  + @* `@+ @2 ` " `#h#l#`@+ @@#` h#d"@l"`#h`d#l#㿘 `` ; ) +`@.`  ` `% :``@.`  ` `@( `  `@.``  ``6` &@`6 @) `.`@`&`'  `` &@ +`.`@`&`'  ` &   6 "    *@2 # *@  "  "  &㿘@ `@    @?@  ( 8 $  @2, ``&K` 2# K` @2    @@@   `Ј  ,@  . *`$ ,@* @ $:*`$ $ $* "@`(*  $@"` $@` $ @*`  $*  $@*` $*  $@"``6p (   @  * @ V!  @` `24 $@` `2% $` `2 $` $ `2 $  $" $ $@ ` *` $ `2`@  *`  "2 ` $ *  $@ *``` ( $ (㿀` * `6  , $@`  ,   a,  ` *@ T!R!4Q ' '' ''* @ `?;  $@ ` *` >`Ő"*` €      ' ,  '''ƒ `0*  * ?  &@      h & 4* '  * '  * ' Г*`  * ' * '  *`̑*   @ .`% `@ &.`  * ' ג  @  & 0 .`  ?` ǐ!|*` €` %$%@ ''@6`,` 0*` *` ? ` * * %  *` ? 6 ** 0*`  0*`"  0*` @ϡ,` a  %?`'' * ?@ 6'ȡ,`@ 0*` E@*` ? `@ * * % @ *` ? 6@ @** 0*`] @ 0*`" @ 0*`Ē @ϡ,`? " %* ?  $*  ,` @@""?* $?  ?@ %?3 @%$? ? "%? %?`? !`?"$%@$?' $' %  0.`" ` ` @&   @6+' .`@ !!$  0.`=' 0 @ 6 0* 0"@ 0*@ `@& ' @' .'`@      `2  `0 2  & ,& (} & $ @`@^@\@Z@X@V@T  @ @ @ @ @ @ @    @   ?b؝c0'D ?#t'H'L" "c0 '!%L `@ ``_2`S``$L cXK#!?#ؤbD#@*#H  $D *  `@6H##l"#p"? c`@"@#h"cL@#P"@#D? *  ,`@ #@ ?P" `?cp@@H"`  *` ?# ?!H?a* ? #ؐ ?#l ?Hh`$ J `  ? cX?#ג ?Hh`$?l J ` @ ??!ِ#ؘ#     "?Hh`$?l J `  ??ْcؘ"     *@" ?Hh$?#l J `   ??ْcؘ"      "?L   ?ؔ   - `"  ??#t ?+ ? ?  #   #d #  ?c H*  @ ? x?? #؄  @   @`"  `??cH?@㘐#ض   "@ @,@*   * #  `"?@ ?㸐@ H  * ?t*$  *?t?t"?#H?+ @ @"@?#d? cH#`@@  "@?t ` ` r ?t 9??#`?*L ?LH f* ?t*"  "  ??t??tcP"@@@ ?p## ?H#@ $`D *  @ =DH!?0* #H% ** #H% 4 T  $ `     2  0 2  2   2 ?# H u ` H m  ?cH  a  L ` `,``_ L``"@  X*  "@L? "? 6"?#t @ Q?#?#\?"T??X?"#8"#?#H"?\,`"?<?,`#D "` :" 3?@ H0*` `!?ccc@,*`   &&H@ 0*   &@?cH@@@ ͪ`H4 "?$ `??〠ㄤ`- @ @$`$H $`&`?X?< cX @ ?\ ?T?#    `2  `0 2 ???٘#X#<  @ ?#8     @"  ?c   ??` ` 2  ` 2   ?㐠 H @ ` H 8  ?#H  ,  L??#<  -L- - @   - :  X@ " `L_L*"@4*L" L??D#t@ ??#t @!?,` @P`?ct@@@ ,`!?#@E #@B㿘`<#+`8 @6&`<`@,` "`H@. `@ "`8@&`H"`8`@&`@&`<`<. ``L&`<"`$* @J`  ``$ `$*` J ` 2`L `$"`$`L@ "@`$*` J ` @`$`$*` J ` 2`L `$"`$`L@ "@`$*` J ` @0* J ` 2`L0`L@ "@Ð$h ,``8` -*&`8  `D`ﵓ*``8`H&`@*`&`D&`H`8`L﨓*`&`L`8`P*``8  &`P`@, " `H " `8&`@`Η,` cX?* `P*"@ cX* $`$@ ` "`@`H"㿘 & 8& < a & @ 8 Z& D 8& Ha*` 8& L]*`& P 㿘 #X4  "4 L4  `*_   4( " `8 2`@`@٨#4   .* @ .`` * @, `  `.``H ` `L* @   `.`$* @J` @ &'@@   ? '` `@? , `P@㿘 & ̐ && & ǐ & & T& & & & & 4& 8out of memory㿘#T`;@t  @4 ( $cT L`  `* , ,  * А@u@Đ& &&&& $cTa0 @U㿘@S @Q  (6 $  $ @`@F` (& $ $@?  6 0 0, @ " @3  & 0 0@+  86 D @,  " H@  8 " 8@ 8 & @ D " H@  H " P@ P " L@ L " T@ T   @ @ 2 㿘` @:   @0 @@ @` `@;i㿘ِ 㿘@ @W۔  N  㿘 @㿘    @$  㿘 "B ɐ 2.@9     * ` ,` &$`"` 2@b@?`@v*`  ,`&" @R0 㿘  `"< @  22$5 *`:`@Sj   N J  N J " 8 *` @SM:`  ` " N 㿘 `  ,`@  @Qg `㿘  `2 @Ő  2&+ A'   "@ ",@ Ɛ)@ː `@ 2,`2@㿘   **@*㿘  c@*    `#8`#8   "@"`"`"` `  @( @e $@b $ @_ $ @\  @$  <  8`6`*@**" @ ߠ   @( -`@! " !!!?~ 0 !!   ! ?0瀤?0    @V " * @ * : `"+J@2 + `J`"+J@"`+@p@m   @  JJ  `@JJ@"`  $ * *  @@$ *`"  @"@@`@ 2 @V "} 0{ y p$J " J`" ݐ a \@$@ O J`"   D$ J`* 8$ J@    J@ ")* "$ "*% #!   **@+ * *`* $ `@ܤ@ " @ $@@  @8$  T& T$   @`us q o  @ @word-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanullno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s 㿘` !#Ѡ!`P@C6@v  !``@vې "` 㿘ߒ@ memory exhausted㿘@B  ѐ! 㿘 @s`@-` ѐ!Ւ 㿘 NА   ?N c@Z &@㿘 8  @ @A @  &@ 8@   8@ 8"@  fstatlseek㿘 8`#`(@{ `(@w @8  8`(@o @"@ " $9@S $8@@ * @k )8@d8"@@ , %ۀ% $ $(@D  (   `ۀ  "` ѐ!?  "`4",@z  "! "0C ` < <7 < /ۀ`ې  :@  @h :@@  @ "! "0@ :`P  8   @h; @`?" H" H 㿐`4ۺ $"  "  5!#%a7%8@Ԑ 8@ϐ8"@ <  ?@ 88@ d@g`$ @C @C   @ " !#%7$*  :% $% $ $*` @  $% $ $ @* (  (  `$ (` $` ѐ!v  $`  `"@@,$0 ( $H`I"8 @ b `@  `@`<8"@U&@` ,`   $@#\@ ? P P@&H @@@ `, @   "! "@'! "`  $,@ ! ` `6  @ $` B >@"`4㿘 !`B : #`@V& 2$`X/ @g( `0. @e  $ @2 %s%cwriting output㿘 h`  \!@9  l`ࠔ`B :"  p` 0&  :@ C!  &@@ `@ "!k!" 㿘 ` 0$ `   %`  `$`@Ӕ& `  -`   `--㿘 c` ``-  `ɐ ` G+  0 t 6t ,@   ; @  L 2 @ t c x`@c  @@@@o#x@,&@r< D -@*&@ ,<@_&@   ` 2* :@   & `   : `  x  "%c㿐ۤ #` ')   g  `  0) \ &@ d@-`N: @d@dd  ;Binary file %s matches 㿘 #` c` ` <   @I  "!M@?  : "`   ;`#  o     "! ``& Ұ  X  ``- `- ۀ` 0 ? 4 @" 2 ` X  `@""`  #!s/ۖ"  J- : @"  4@  4N 2 4"& ``l    d`f ` t  `0  - :   J 2   22$`0  4" "@lC > ɒ 2`0 "! `#`  ``0 %$ 4" @ `*`0 "$ 4`` 4 `""@8%@  ' `  @"(standard input)%d 㿘  1 "ې#("` F @g{ !  81 "!  `ې@g]` !"_ @rZ `V  `2  @gB`  `<  = "  2  |` h` \Ӑ!@ :Ր#@@ۀ `?.  "  ` \Ӑ!@p ` 3 "@ a`Ð%s: warning: %s: %s recursive directory loopMemory exhausted0@   ` @2`@2 2e `p@q!] 2 `<   @+   "!  `2Gt B! @V  J /@  ۴`h b?'"`hL   /@< `@2@@2{,@@N@` h B?`%h@ʐ@ȐUsage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE -Z, --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . 㿘 #!!`֒c@nB`@n=c0! @Ӑ  @ϐ 8@̐ @ɐ!@Ɛ#@Ð H@ p@꽐# @0conflicting matchers specified㿘۠#l " $#l@K "$#lڐ ! 㿘#`" %#@KА 2    $`$ 2   `L " J`L 2J# + "  L2*@ (8*@\`J *J *@̒`㿘 (@ʐ  @  * &@&$ * $`$  GREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-rwithout-matchunknown binary-files type%s (GNU grep) %s 2.4.1 Copyright 1988, 1992-1999, 2000 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. default㿐'D@]'HH  "`@དྷ / `@ි / "? '!#%,`$`x'$ \$t@ "D=H  ' %۸'-+;7%/!ݐ `* €.*  ?' x ڐ"ْ   t ڐ"̒  "   ڐ" 'b" ' "cv "p # |%`@JTЀ %`@JL"؀ ڐ %`@JC { ڐ"~ @F @- -@J)# @: P` c "Y 8, (, h ?2` , ]`   $  @弖 4`P@@@M@]J?` Y .V  R" N##x ?'`&H%` &%`C'` ?"`l %`;&ଐ 8%` 4" 0# d ,"c| ("t%# \"*#`@I $X@I" ڐ $X@I ڐ $X#(Ӓ k ##D @HӀ`x "`xt "t#l `##l #lڔ`@'#H!ڠ#h@#@ #p@#@@ c  ,  2?d "dD H* %@H Z#l  T`H @ €D" `   # hD@6ڢ H* @I  ے# @D`@%#ϐ @M`?2 " !`  @ q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q m8 m8 m8 m8 m8 m8 m8 m8 m8 m8 q q q q q q q mT m m q m n n n4 q q q px q q q q q q q q q n@ q nP q q q q q q q q qd n` np n n o0 q pX ph q q p q p q q p p p q q p p q ph q q q q q q q( J(8  J  㿘3aༀ@.@,(`'@ @'@/`/ @ &@`@ / @&@ `@@ۆ'@` " "`POSIXLY_CORRECT㿘!"`"# @F#" N - +ې "` `"   " ې "`--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument 㿘!۪'D'P"c!#h ۀD %aDT $#h۬ "J P a@ $ `  $`` ( ` @   a 2$`DD "  *@J`-2J  $ aD@ !*`@ @G`X aa`  @  %a` D` @Da$`D$ %aaD  *` @2%aR?@J`-J 2P C?"%a> J   -`?`%P a* @J `- `"J  X  P L ?L  =2P` @@Fu$ 2`@@$2 `@   !` a*`@ !@@h``@ ?a@%%a"ga%aL , M"c!`*?J`- @!@hq` @!J`@hh@J ? @%" &D *@"#%a!` *@@!@hE`@( @%"N ? :"{ :0y@ @%'`2- l `a* @J`-J '!`a* @J`- @!@h a a@!Ja(@haޒaH %%a"9 ? @`. :%iJ a %a :2J!` ` @!aP@gі . @!ap@gɖ. : "b ? W `;ő*`J    aې "c$%aaD*!`@!a@g""N`:۰ ?ٰ :, @"#%ac%L@  =2`P  @E0$@ 2@[$@݀2    !` a*`@ !@@gXa@: ?a@%%a"P%L@  `6"!`@!@g6a@ ?@r% !aD *@"#%a!` *@@!@g`@ ?@%N@ @%'`"D   @"@> W*`:  :28. J : J@  a+"#J@ aې ""%aaD*!` ޗ. @!a@fї:. : "bN:  ? :@"#%a%. > 㿘   㿘 㿘 㿘%H Fk "@  $ , "@` 6 @    $  ( $ (    *  " " $ $  $ 0 $ # 0"  0"` 0?"  0"` 0"  0"`$ 4$ 8$%D$%<@O memory exhausted8@( 0%D`@ @@''   @  Ȕ  "@ :" "@  ` ` 2"@ 2  " 6 @v     &  ( & (    *  " " & &  (& $$   " 6 @Q    &  ( & (    *  " " & &  & $ 1İ#@# "  "` ,`"  "`  " "`, ,    "@ "``,`,` J`   2@  ` ? `  *`  J` `g,`   *` *  2Y `*`Q* J` ? `0=`*     0  "#+ /*  `@*   `""`*` * ` ""`"#J " *` J 8`?+ * @c@a* `""    ,*  $ , & , 4@&& 4 8@4& 8 㿘    @" &@㿘 . `"# ``  `  :`@`"` ` `"``#``2` " 㿘   @*.㿘`2@&  "! `   `  @  ` :     ` @ 㿘     * &@㺐 4    < 7*@   ( 7  ,  < *@   (*@  , 2Z 0%D 2V 0   4" 6 @   &  ( & (    *  " " & &  &%< 4& ?  0`%< *@ `?  4 6 4%<  @  7 " (  4 &%@%<@ J K@2 " &%@  &J u%D'`5!<` 4$` 4$``.``` 0` "`  5` 2 @`  " &$ @ "  `  " 4$   2 ` `2` 0 ` `` @4$``` 4$`` `2` +   "@ 0%%D + *   #@  %D    " %D  +@   ( 0  *@   (  㿘 42 %<%<J@q&(@%@*  <@K@" @G? @ ? @# ? @ ? @ ? @ ? @ ? @ ? @  ? @ ? @ ? @?2Ӱ 4A&?@   & @ " 4/&? @ @ 4'  ? @ @?2 4?@   & @ "  @߰  㿘 4 a%D!< <   0X)  M K"@@?@@@@@@ @*@`@ 21"@(!`@@@  :  @ 2  8"@ W  8"@4"@ C @ 2:"@(3"`@@@"   :   @@ @   "@ "@6‚@`0#@#`#`㿘 , %D   && 4&(㿘@  @㿘" `"/ ( * & & `& && ( $`& "@`& & @&@& &` (* *@& ( 㿘" `"/ (  & &  & && $& (`& "@`& & @&@& &` (* *@& ( 㿘  "@<@`d@    ( 6  € $@ 2& "@& $ & $   4 ? `*  * #? +`€ $! (  `   *   (2  2  (`$  ( &  @ (@* & (& &   : *@ 㿘    € $ ( @  (@& (: (* (`& & & & @1㿘    € $ ( @  (@& (: (* (`& & & & @  memory exhausted㿘!!@"ؐ!x@]3 @b 㿘b  !ۢ Ȕ!@  L   `2,@   Ȓ  * _$d d,Hex D_alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit"'D'L@'̀    '' & **  '*@ L&'& &&  @ &@ &  @ 0 &    '̐  ?`r !4*` €D̐@ L2  @ Ԕ *   р`$@  (%@@ *`&&@ & $@$@@ %@ %@`%@@$@  ݀@ M ̀ L`2 L@ *   `$@  (%@@ R*`&&@\ ^& $@$@@ %@ %@`%@@$@  ݀@  L a`  L   X``+@ `? ̐@   =    '̐  *#L` + ?` \̀   '̐` ` + ?2'̐?'̒ `+@ `? ̐@ @ @ǘ  +` l$@  *%@@ ȑ*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ ?M J?`.M.@`&%#`/` "K M M `%`L @ `% @ {`  `% @ r$@  *%@@ ^*`&&@h j& $@$@@ %@ %@`%@@$@  ݀@  $@@ G/`   `$@  (%@@ $*`&&@. 0& $@$@@ %@ %@`%@@$@  ݀@ @  ̢`$@  )%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ ̀ $@ "  +%@@*`&&@ & $$@@@ %@ %@`"%@@$@ "  ڐ$@  )%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@̔J``^  *J@ ^2`'$@̐  )'%@@K*`&&@U W& $@$@@ %@ %@`%@@$@  ݀@ ,@` @ ` L@ ` ,`̀@` @'̐ L  \]` `'̐` `2` @ ` * ,@ ]Ȑ`2 -#K ]耢-2KD? DK? ["K? * KK? [2KK? ^K ]LK -LK  ] '̐L@ J @0ꀊ[22K :22 '̀ ̀@` @'̐  :J` ]` `  +`/:v,J`]2r⠒ @:`?/"@:`?/ @:`?/⸒ @:`?/"@:`?/Ȓ @:`?/"В@:`?/ؒ @:x`?/"@:p`?/"@:h`?/w"@:``?"/o@:X`?/g@:P K̒@:J E̒@:D > @:= 7"@:6 1̒@:0 +̒@:* $ؒ @:# ̒@: Ȓ @: "@:  @: ̀ ' '\'X      o wg  \`L @ ` X `L @ `    `L @ `  ` 2  @ (@,@ ``L @  ` `L   `` `L @   `L @J  2 @ (  ,@``L @  `L @  `L @   `L   `D` 2 @ (  ,@`L"  @  22` 2` @ `(  ,@  h\  `   ̒ `  ' `  `` ,` ,`2 @  * @,@ ִ  ,  ?` @L@7 `LÀ`L`L`L @YL`L" @р`0̀"   ـ`U'#ܓ*` €L׀`' 쀢 &**@@~*` '* '*` $ * "*` * % ""* @*` Đ$@" * * Ē@?"`* * $@ @"`$@  &%@@O*`&&@~Y [& $@@%@ %@`%@@$@  ߀@ ,@Ģ`,@`,@`  '  L@M @EE:$@  * 3@@*`&&@~  & $@$@@ %@ %@`%@@$@  ݀@ ,@`$@  @ݒ  ?L`@} 0* @*` '  ?  *` * ` ~Đ"* $@  (%@@*`&&@} & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`,@D`L!L$`$@  *$@%@@^*`&&@}h j& $@$@@ %@ %@`%@@$@  ݀@$@@I  `$@@3 $@  '%@@!*`&&@}+ -& $@@%@ %@`%@@$@  ߀@` ΦLb+" @@&D ̀@̰?? ?L    ' @`'̀ А  & . * ̐ @?Ѐ,2'̀  ' '̀ А  & , *  ̐ ?Ѐ  #  #LLL@ \ẁ|  '̐  } L @|g 0  L _  6 $@  (%@@Z*`&&@|d f& $@$@@ %@ %@`%@@$@  ݀@$@ @F`  $@ (%@@#*`&&@|- /&@ $@$@@ %@ %@`%@@$@ ݀@ `$ $? @ @  ˢ`?% @`$@ @` '  '̐ L`D@ `J \`0L@`$@  )%@@*`&&@{ & $@$@@ %@ %@`%@@$@  ݀@n L`$@  )%@@{*`&&@{ & $@$@@ %@ %@`%@@$@  ݀@9 L`$@  (%@@G*`&&@{Q S& $@$@@ %@ %@`%@@$@  ݀@ L@U`$@  (%@@*`&&@{ & $@$@@ %@ %@`%@@$@  ݀@ѐ L!`$@  (%@@ߑ*`&&@z & $@$@@ %@ %@`%@@$@  ݀@ L퀥`$@  (%@@*`&&@z & $@$@@ %@ %@`%@@$@  ݀@i L@`$@  (%@@w*`&&@z & $@$@@ %@ %@`%@@$@  ݀@5 L`$@  (%@@C*`&&@zM O& $@$@@ %@ %@`%@@$@  ݀@ ,@`LO`Ē`@ '?@Б*  ?`$@  )%@@*`&&@z & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`L`  `"4 @@  2.`*J`*&`^#L `\ LK  + ?0`+`?LEK { ? \2;K  {27$@  )3@@*`&&@y & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`$@  (*,@3@@X*`&&@yb d& $@$@@ %@ %@`%@@$@  ݀@,@` @ -@̀r$@ @, #@y 0Y@y 0V@y 0S@y  0O@y 0K@y 0G@x 0CB @x 0=< L@2$@  ( %@@*`&&@x & $@@%@ %@`%@@$@  ߀@ ,@`@x $@& Ť L t ǰ Ǡ ǰ ǰ ǰ ǰ ǰ | | | | | | | | | ǰ ǰ ǰ d Ǡ ǰ ǰ  ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ 4 ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ $ D | H 8  8  H *@*`:*`*@*`:*`*`:*`㿘   .㿘   ??? /ِ H\`?J`(  2 2  `| 2 2 J  \`?     )` J@)"  `J|"  0 `J@|"   * (   㿀@2 C `// @@&//    //@I 4(`@Iݒ耢 4"``:`:   :    !"@ ?",* ``(/㿈    ` '? '' @zn! @  *@&  ``  2* * @& *' ߠ "*` €   &   ,@ * ? ͠   : *  " : 2,@  *    ,@ $,@ * ?   : *  " : ",@  ے Ȗ J@ ",@   ۘ Ȗ   K`2,@  ~ L`  `*? 6* @2 n,` u oL  *  g  b  L *   W*@PM'L  *   "쀢#*@ *`"@ 8;?*#*@x` '* '* "  '   & `    L * @` ?Ī     @v  2* * @&   ֬ d t ֤ ֤ P   դ դ    p  ֜ T Ԍ ̀ `(#`"`"@ "``(#`"`"@"`㿈#\#`#d @ 㿐\ `d4?  4$  `   `  ` 4? ``2   `j?`r?`KJ  E 3 &$&@` # @O@ ? # @O@  #? # O@`#&@&`" @J   2 #\`"#\ 6?#\#`@- ? " ?$ ? ??㿐#\#` @ 㿐\`#\#`@@'D ! `'''H 'L@`''T'X'Բ!'' ` ' '쀢`2'*  ?#`#`#`#`#`#`#`#`#`'''''`}' zx v t`r p`nX^?'''''ȸ  ' XQ?LT K̰ 7!Ȅc;=#c0 İ """"  "̀ T` LHL 'T'H'LLH T '''L" 'L X XH XL "؀@2 @UL`  H  ܔ ܒ@ `? @  `k̖ '' c   " " V`2\H (̰      "" \`D2` X2` # ̒`* \*`#@s'\@#`@s*`\ $  `D`* @ D "\\  :@"*@s'\#`@`@s*`\ $  i`Z?\@ `X@ "\ H$ L$"@ ۆ?3 Ț @   \\  " ""@ L  H @"@L" " \L`  H"L" "@  \  *̀ X?\.    " "  \X܀@ $L& "@H"@ `w`!*` € @Ѐ``k@ Ц  @@]`? W@LL@@K`?  -@  "@`4@D` @ Ѐ"L J` "Ѐ " L K`    -@  "@`j  `?  @@Ѐ`" @ @ *`  2  :@ `2 Ӣ@ ̖ Ȕ-@  "@`/ ' @* 2``2 @ؔ'@@ @0* * * @%  @*` 2   @ !Ȁ @ $ @*  @ @ *  % @*` * %  @`' @*` 2    !Ȁ  Ā" @* ' @ *` * % @!!` @`?  `*` 2  " !!+  2  Ԑ2 ؀ ' ' `  ` `  ` J *  ''䀦 '  2 ` 2 ` @@2} *` 2` &@*@% @ `*" @:" @ `  `' `J* `' *  " @ #c*` * " L*#'*@s` B'* '" c-@*" '@*" '@*`" '`*`"`'*`"`'* # `'* " `' @ە-@ !Ȁ@ ` ~L   H@ L L   -H@ @`? -܀  - %@@K@%@$4Ѐ ''@ ''@9 * ɦ Ŕ-@  "@`LH T`2LD 2  D `  D2  f2LN 퀢 D  TL`HIT C ?L` @* &@`*`  " !`%*` * " -*#''*@rӐ` !'* '" @-@*" '@*" '@*`" '`*"@'*"'*`# L` @* `'؀@  @  `ؒ@ ' @ `؀  &@  &@   &@ * @`" :"@ %*` * " *#''*@rW` '* '" @-@*" '@*" '@*`" '`*"@'*"'*`# '* " L` @* `ؐ    ?    @  @'  D ` / .   `     "  ,u  o *``? `  2  :@ ` `?V V `  *  I2  :@ `C     6 "   "(*  @  @@   @ `@ @@@ @ `  "`@  @2 ,   .,'*  *`' @  +`?'*  @#'*` # *`' # ? L` @* `x@&@ * @`" " %*` * " m*#''*@q` a'* '" -@*" '@*" '@*`" '`*"@'*"'*`# '* " '&@ * @`" % %*` * " *#''*@p` '* '?" -@*" '@*" '@*`" '`*"@'*"'*`# '* " 'L` `*  ?`,@> ,``,`,`L` `* ?,`> &,``L` @* `@' @L`* `*> *`LH T`@@ے Ȁ@@2 JȐ `? 2 J `? ]L H T ے Ȁ@@2 JȐ `? 2 J `? (ے Ȁ2 J@ L H T  @@@2 J L H T}Tzے Ȁ@@2 J 2k2 J@  0WV@ۀ 2 J@ B : 6-@  "@` ,@ۀ 2 J@    -@  "@`t @mVg* ' 2'*  '*  * ' @ `+`?'*  @#'*` #'*` #?`ʈ ؀@ :'H @    H H `' `J *` `@' @ "H @  ؀(  @ H? ݼ $ 8 @     8  < P  @ ` ( \㿐 R' ? A' J *` ?'' J`* '  2'   @/*  (@' @ J? ?*` @*    '& @/*  " 􀢀*  㿐'  @*   'J  *` '*  㿐@'  `B'!t*` € q, 2` 2,*0*@* &%*J  *`  ' #'' K * '' J*  ' *` 2      ' $@ ` H H H H H ` H ( ` ` ` ` H H H H H H H H P H H ` ` ` ` @ JJ` 2  㿘** @@ #d"%  "X*` 1" 㿘"@"$$ $ @jҐ!$ @j͐! $ H 6  L @ `   *@  L6$ @  ?$ ! @*@$   `**` $ @n͖ "     ?@j $ h@m 2`  @  *@ * 7   ` * *`  ' * ' (''''' ''@jO. '' .@'? Ȁ         & & @jM6 㿘 @j. bX@ "@m @l*@l㿘 " @j$ &&  & @j  *@& & @j & 㿘@"S`D @iِ ?@#F #0 . J )   $@m<&@@  `2@0D 4d@8d@i "@@ @ @& 2J.@@# 0@# @i fgrepawkegrepgrepdefault㿘/ memory exhausted㿘#x`! L`!Ж  `*   (  x !А M $#T 0 㿘۠b T @ ) Tb' X #T$X@l{ "ڒ 2b T 2#T@la " 2*#T ζ ^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$㿘+x `+۔4 %Ώ | 't E@hԐ`2 " ,@t  "( ` "(,@ `,` `,`,`| b0@kY @l4@@kR|`bH@@kI t  @ "`"` ,@ +  + + @l ې 0 D^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$㿘cl@"`  !.!x x `7  n#x `-#۔4` % | 't A@hK`2 " ,@t    ,@ ,`,`| `@jҔ @k@@j˔|`` @@j” t  @ 8 8 ,@ + + @k ېɕ 0ɏ 㿀ۦ #`'L۴#4*`;#T 2$ e谒 ? @S$ " N? ?#XN? 2?#X bܒ  ȳ䀢 ,# bܔ  Ȥ䰒 ,? @R͔$ "N? ?N? 2?pۤbж ?c $&    Yct"#|`TO#|`D?)#` @ ? L ` _5@  L ` _+ @$@ oД`@` $$@ `@"`ŀ` >  L@"@㿘!ے@@ J@  `@ #TN@ 2`#Tc&@ @’ *`@ )#T ̵ 㿈۔ [ #` ,: +ۨcT$ d谒 M#t`,N?2?  B,N :@26 : #|`4+3뀦 ?* `L `2cT_  cT,   ?`L `_ސ    ,:`@Q$  &N?  ?N? 2? @*J@ `?㿘@㿘@3?`X@m `@j@ N ( /@` /?"``* "@ /` ?"`* "@u @i Հ ` N 2 ?N /"? .@?*N /2?  @i@i@ "@  ".@>b@i usage: basename string [suffix] 㿘b@B!@i 㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@3$ @\/+)-# "5'%7%9 0 * L@€  %c%#a %4 b@ @a $@@<p?ؐ?ሓ* @   @  4  @" "@@E   @@ 2 `@ @i  l l l l l l l l l l l l l l l l l l l l l l l l l l  l l l l  l $ l l l l l l l l l l l 4 l `/㿐@  2 @= " ,`* * * % T@t Z @g D @, T 2 >X%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCx@8' @6 h< @   @ٔh  h!)@!#h @ǒ  2! @   @ 2 @  !@ 2@  b@  !ې@ @  ,@ @,@ޒ :  @, :, @! #`"@#`2f !#@Ӑ "0@Y "@  2S O#@L ,  ? ?/7  @h ?`'\'`'ab''d @\ @ А"8( @>$ '`'x'|'d #\"0  @bH   @ @ getmntinfo㿐@   @Q"7 @64  ``@Z ` `D@f~  T2`@D T 2` `D@fh  @Ҡ! 㿘!4  c`?  #@    2c@ empty type list㿘 N  nc@^  N  oې "c "# %  @В , ` @cv*  $4 @r $@ , `$@  @ , 2*@, $@㿘 ۠# "- @Y "( @ . " *#@L 2  @E " @ . "  *#@8   # 㿘'HH@W$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘a@?!@f 㿘@Grsh8KLdel:nwrlogin/usr/bin/rloginrsh: can't exec %s. rsh: must be setuid root. rsh: unknown user id. shelltcprsh: shell/tcp: unknown service. RSHrsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿈@/ @ ''@ /       @bh@ " ' ,` `J@ -",`' `?  ,*`    "! @y,`@ p@9&??!!  $!*@$!`'@`!* @ "&@@r!@"@n@d@>!b@>Ք@e @g@ !@>ʒb@eِ @T@֤  !@>b@eː "@@ِ"@̒b 2 !@>b@e @#  )@#\@Z# #@e   !@>c(@e *'? @   # "!!#!@ cH@>u# @    ! "!#!@ cH@>b@@@ΐ  @c˒   `@cŐ  @c’   `@c  @c   `@c `2@ 6 "!!#!@ kc`@>,@e; ! #"~@c"~@c@O`@c  $X $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $X $X $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $4 $X $P $P $P $P $P $P $< $P $H $P $P $P $P $P $P $P $P $Xrsh: select: %s. 8 PM@c# ""! @cx$ <  @d6* @ *@$@  @ɘ 6@ "! "!# !@ բa0@=@d : ؐ@c/ & "Ĥ΢! #ɐ@ @d @ؒ  @dq# 2 * +@6$ * +  $ ؒ@cg '㠀     @u  "! "K6@  !@=Ca0@dR 2*  :  5 "&@b$  #㠐 2`*@ `* *&@ @b 6* : % "$@b̔$   #  @**@&@@b 6* : 㠓2 *` :@`؁㿐! "!/#@b $!rsh: %s. 㿘@   @@c `@`@`8 !# !`@  @<@cА @ @@@@L 2 `  , `@ 2@usage: rsh [-nd%s]%s[-l login] host [command] 㿘   a(0@<!@c 㿘@mkfifom:invalid file mode.㿘@-"  b@gc `8 @@b`?) "% + m@p! 2 b@ @p!@_ߐ@@6?倢 ?a* @ @&@ѐ `  `J`p   &``@`"!@ ,@{2@c(@&2@c"node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐`J c b  `@@ `@ `@" J@  ``@ ` @ ` @" J@  `@ .@ 2 2 ",  `@ @@=2`  @`@  㿘@  .! @@26 6`@@R  `@ usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p 㿘  # 8 !@;`b`0 !!`8 b@;X `8@;Sb@bb 㿘@,hms:t:/dev/%s%stcsetattrTIOCSDTRTIOCSETD%sslip.%s.pid/var/run/w%d Failed to create pid file %s: %m`@+#'+! -/ ; 597Ā`5 #*` €@@,@ "@յa $0 "@a%c4@@5#`??* & @ @@h@   !ܠ# p@'" @0  6k@Ȑ@aސ  '0/'''/@/}@C   cx@$ `y@`   c@ `@`{c4  c@ @ c@a @`  @`  @`~&@avN@ /`4N@ /"` # @ ##$@&ǐ  @. #@  & @:nc@V ' cؔ@ /#'@Đ0 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4X 4 4 4 4 4d 4 4 4 4 4 4p 4unable to delete pid file: %m㿘J#`#@&1 6 ,# "!` c@̞ ,#@a slipstrip㿘`X@ڐ   @Ғ``  @usage: slattach [-t ldisc] [-hm] [-s baudrate] ttyname 㿘`@9ސ!@` 㿘@o_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘a`@9!@` a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@*!+7)#%5-'/%耢` "*` € "!$ p %`t &ؐ %# "@a "ch "@a"cl@3הa耢?ؒ?& ~* @`` p&%d %$|#   '''  @`O ?a@u   b@  ""$ p#Ԁ @"d@"(|@"8 p@"H p@ %`t p@b  p@b`  %`tbh@ d@ƒ |@_ؐ  @- |b@( @ڒ @_Ɛ @^؀`2"@|b@ސ  @-ݔ |b@  "@_  2bb@ @x@^*耢 b@ @^q ;0 ; ; ; ;| ; ; ;@ ; ; ; ; ; ;L ; ; ; ; ;d ; ; ;Xnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8#8@r "   8  "   #@ 0@- "@ @V8 # @0HȚaB + cB + 3`  *`  @7  #0@s01@]s: Ȁ̀@n#H0@]`t      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" " 8     @ # l" h"c#X` #  #@P@Z@\|3 cԠ" x @# t`#  @  @ 8 x 8@&@ t@a &&  `  %s: devread: lseek%s: devread: read㿘. >@\ 2@c0@ @[cH@ statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block㽐@+ b@A @o c@7 ch F #ܒ""l#h" `h * "`hx c@ #Ԁ` @@ `h @'%#h, ԑ* l`"  @, `h @#hԀ @  (04`0@0   `8@)  `@@ @5I `h@ѐ @S c @Ȑ @[Lܦc x  @X0 `@ ฐ@RO@Q༠@RH* @Q @BR@R<x`* d0 , ߒ@BBxcܑ* 0@"0 ;  @ C@(8  x @ c@?  h"@Ԁ   @ ( (  `3/,dԛ*`l`"  @    `2Ԁ `@p (`>Ԁ  @g X0 }t "+)d,* `l "  @K t  `2dԀ `@8 (`c@͐  㿘@eroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !bX@4]!!bx@4X@4Tb@[c route: %s: %s 㿘 "a!c8@4D c@@4=!#H@t@45@[D nqdtv/dev/nullsocket㿐@$ ' /+)'!%#795;-怢 * P@€ %`H  % @  $  $ 8 $ @.c??ሓ* @ @Y۰&@}'" 8`&Ԑc@)" %$  @ %$$ 6@c@ @H?`)*` €&Ԑ@9'&Ԑ@[0 @ D@0U@@Z QX Q QX Q QX Q Q Q Q Q QT Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Ql Px P P P P P P P P P PH P P PT P P Pl P P`must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done x"Ԁ`  " "aߐ"c$ @) B >`@J@ -9@`?`3#*` € ,"c ("c $"c  "c "c "c "c "a#!a@(#P@2#x@0@   ?''''   @Z 6"܀ @V/ 2t"  @Y 6g"ܪc  @D#c @#8@;`` [-# " @  ,J#` L ` 2C ` >"̀`2; , $@X$  @`*# @ d# #`@l@S@ @ `? @`@Z@c@ # @Uϐ T@ TP Tp T T T T T T T T T T T T T T T T T T T T T T T T T T`  Q( o:* ` 0  .*  ?** *`defaultinvalidiso %s(%d) %s``4  "`4"p@ ! 2 ,p@  . @ ` ,p  2  :ap?`#*` €  ' ` ` H`̒ @  @ e . bp@z` ",@!p`̐@'@ h k, H`  !  ???ؒ'@W  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф!p#\! @Z3 -`@ $!(!p@l$@ @T! @U #ap@}!! #ap@o!!!p Yt [ [ [ [\ [ [ [ [ [ [ [ [ [ [ [ [| [ [ [ [ [l ZLaf %d: %sh ?` #4*` €  (! H`$! 0?    ??   !:@ 2:@` 2``2 @X  2  #p'@@  k, H`  !  ???ؒ'@V  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф#p#\! @Ye -`@ V!(#p@$@ @T-! @T #cp@! ! XA#cp@!#p \ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ]㿐 `$' *` €# # # # #  #  # @#И <`L "<؀ c "c؀ 2"@ʮ$ _ `< `< `< `< `< _ `< `< `< `< `< `< `< `< `< `< `< `< `< `< _ `< `< `< `< `< `< `< _ `< ` `0 `< ` `< `0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐"a8 ('7 " &4"@M g"?c$@z ? )5'9`@J@ -@ ې`?`-!*` €          *   ,   """Ȑ %"Ƣ wĢd "c "`L &`@ @@abh?2`@ `@ ?2`@ `@ ?2`@ `@  ?2`@ `@ @Ŕ }??2`@~ `@ @@n?2`@p `@ @ 4 _$4`@@?  $4U $4R ?2`@T `@yG?@K B? D    @7  @y1?@M ? @ @@ ha@  !HaP@"h   %"Ȁ   @ 2%"@!@!%"@ @I ? 4` 2 4 2 ``"Ȁ "` )'# 2$MM@ " M`"M` "`  @TD &M@ ᐀ 3߀ #M g @@U; /!!!ؐ @M@` !@  #` !! @  @! `" `7`"0 "0 """ @@|"8@  c e d e d e e d d e c e c c d8 d` c4 c@ c c c c c c e e e eH e c c eX d d e c e e ch e e e d0 cT c| d(D  D '  ? ( ?* ??* ? *  ? ???"`"`(*``H 8 *@64128㿈    2   2   2    2 !@    ?? @}  "Ȗ"ЀD `@"DInternal Error%s: bad value route: %s: bad value H#`'  $"`D?㬢 "`D#* €#T #"#   c(,# ,`,@ Đ ? "',   0n  0k4 "4  b ,`"*` €  ?ؐ ??? '''a@@  ` `  !c@,@S ` @R? ? ? ?    $4  @ 0  >` >2`D *ܖ2 $`D2 2 2 2 2 2 * #@@N Ȱ 444Γ*`4Ѐ`4 4     J J 2 `D2` 2` **`$`D*`*`*`2`2`2` 2` 2`*`#@@P  ,,,,,, , , , , ,`,  @P@R   2   ,@"@ J@ ""@ ,@O;} @   @sq ,,@j "&@ /   @@,@?   @`N ,@@? 2$ 4` $'@R8  7 @Ӑ? #`@S   !   @ '& `  ,`` @Q0 !c@+t@R  q q q q nl pL q q p q q q q q q p p q q q q o8 m` lP l\ l lh l l l lt l l l l l l l l l l l l l l l l l l l l l l l l㿘@ D ` " D!c@+'@R6  *ܒܔ `*`"`>  $`$` $`  @R ?#:,D ޒ   "D  (*( (܁ *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7  7 7 * 77777+  2+` 2 2,2 211D  p`@쐐0= >@   Ȑ 8@ؔ  2  Р #` `    #\ `@j,2 `@`/К1 p@!2*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx ? / / // 7  / / / / / / // ////2 2 2씓211Z !b@0S J@V  ,  Ȑ D@K  2  , 1#'%# b #` b  #\ `@ؐLb,`01#%    K 0 *  2b@뼐b!,b!b@!2actual retrieval of interface tablex   ?''''   @P 6d"܀ &@M 2X"  @Pۚ 6K!@ܢ @*@Mgot message of size %d on %s㷐" "c @P )'#$@O"(@ݐ '@J@p@X#$uwriting to routing socketroute: read from routing socket: %s 㿘 " "a  @P5"L a c  g  #    5D  &D *+#5 < P `$ D``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @D % #T ?   cT@Nc   @rc D   ?   `@N̔ `@Xc D  #܀ ?   cܐ@N `@>c D  " ?   b@N `@$c D  # ?   c@N~ `@ c D  #( ?   c(@Nd `@c  P% 5P@H"̀`25 c$ @M  @3#('?2% %$@M"L   `@$`Ѐ@$ !!#!@WcH@( @ ܐ?(܀@J@@"@ +#D8T t(cT #ܖ 4U # (? * #܆#ܔ#V@  ? @@ *@cT"( l l l l l lRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘# `D `"  @#0;P* !@   "  2  !@   @@ @ T0 !@q 0  @ @ 0 !  H@a   @֔@r route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘!!!q#T@      !@&Rc0!!a@&H   !#!!@{a @&;0  L 3!9-/!5!7!+;!  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !!"@ #`H $`H!!"@$`H`   !!"0@v ! "H@o @mb` @ x@fp $ 4   L@] $  8 L@U $  < L@M @#@B! $ @  L@A D#@B! $   L@5 $  , L@- $  ( L@% 0`" $@  0"@& 0 $b 0   L@ # `" @%0?H!@"ؠ  @{ ?`$   * ' @  locks: inits: 㿘"@#0!# $ `@X"@ڐ#@ @Q @  L sockaddrs: %s㿘`@"@Ő#` @8 ?`$ ` * $`@淐  %""@ ?  @ ``?"`` * $`@擐 @@ѐ`㿘`Y ?>@ 6  , < ?`&  @  * & @o !  ?`&  @  * & @X 4  8  ?`&  @ >* &@4 >㿘! " @^ 2  %s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; 㾀 ?`Z*`$ t €!#"@H*!#"@H $ !#'"@բ!#"  @Ԯ! !# " 7 7 7 777@E@ƒ# !# " / / / / / / / / / ///@H@@?  D ` ` ` , ` ` ` ` ` ` ` ` ` `  ` ` ` ` d㿘@@ @J    `А *`: ?А *`: ? *`: ?ɀ`2    $!,  €* ,`  *  **".@ $OpenBSD: show.c,v 1.18 2000/09/24 01:02:24 millert Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x   ?''''   @J  $@I"@J_ ܀ "$@F 2$@ސ"@JQ   @Jy 6$@-"@JC @$@ʐ"Ѐ` @ @- @F%-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐%%`08%%#\#`     @ %-6.6s 㿘 L   @P" 2  @ $ @  L ?  M@ P @  % @G``?"`਒ * "@g InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: 㿘?`%"*` €%!%!%!% !% !%!%! `%@!0%!@  l l l 0 H l l T l l l l l ` l l l l l l < $link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s  x x  "9 u "C o     2  % c@   `  % @ wc)%'%@@# `@ `h@EƐd `%^# XT `  `  `   `ܐ%# @ : 4@H/@H*&%  @㡒c( z:)%'%@㔒#0  @㌒8 *%#@@;0 H`%#H@20%#P@+ p$R"JЀ` "JR@"` `*`R@  *@  xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘 @G *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @_6`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@4c/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!@("@ג`x( `(" @ʒ` (` "(@ $  "(`@ 5"!İ#`"@` 2  2  "(`@`?"aĀ (J (( @    @   @೐#  "!"aXinternal error: unknown type %d.㿘! ! %4# `"$!##` "2  ("@0(#XJ#X ((@   @  "$$!type㿘( ``"`H 㿘( p`"`> 㿘( 8`"`4 We only support %s mode, sorry. 㿘")`@@8?"aāWe only support %s format, sorry. 㿘")`@?"aāWe only support %s structure, sorry. 㿘")`@Ҕ(?"aālocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘 'D'H ` 'D&` D  )PD@=H D  D)`D@<H D $ HH")@ap ``@>` H?D"a`"H`""`H@J a " )!)!)!  #  @`H"`   H@q H"`H  @  @!̐H @Alocal-filesusage: %s local-files Continue withmput%s: not found`'H 'D)D@# "@ g @  " )!)!@   Ȁ  @ N #a\ 2  ! Ȕ ))$ Ȑ#@X)-b@Z#)"!-##Ф#,|aL@%"!.#xp @."`0f!d! . X(#@% ."@" x  P."@ @` `"!āusage: %s [ on | off ] %s %s. 㿘  `? & -`@Ca   & -`@7a  &"/@@`? "!/ @Bell mode㿘/"aāEPSV/EPRT on IPv4㿘/d"a"Packet tracing㿘/Dh"aāusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿐  # `?:"#"/@)b-`@ٲa - ("c`@٨a 2`"#@䀔 #@J  "/`b@?!"a "#,"31"!/c_"@ c /#,"@c"/@# c"!āVerbose mode㿘0 "aāUse of PORT/LPRT cmds㿘0x"aāProgress bar㿘0L("aāInteractive mode㿘0ٖh"aāusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. 㿘  "0@@a?a"aĀ  !` `?-"!` -`@a    "a` -`@a  "!`!@ض`"c(!"` @8 "ah"`, !!` !h "J "0@Ga$!`"-"X!`!hJ 2-"#(@2!`"!āGlobbing㿘0A"aāPreserve modification times㿘1H-"aāusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐 "1@'``+-`@Pa - $"c`@Fa 2`"#@ J "1``@?#"a# `?"#1# a aؐ ?"a"!1# #@#   "!āremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'H  'D1 D@4ВH HD  H"1@cb8?%"aH1`@"X``!Ā!`!䀢 H"1@i"`H1`@"` "cusage: %s local-directory Local directory now %s getcwd: %s㻘  # &`  "1@@c`@6*` ?("a@gP`  `+@ǐ"?"aĐ@y$  1"c@1`@#"!`@9yusage: %s remote-file DELE %s㿘'H  'D)`D@44H HD  H"2@ǒ`?"aH2`@!mdelete㿐'H 'D,D@4H HH",@c?I"aH "\,##0b@;  '@F!-H !&"!\!\ "H@5L 2!@ڒ!\ H 1 Ȕ )2& Ȑ#@55a !\ $!\& H @49 2N@:ѐ "!\from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'H  'D2 D@3H HD  20D@3H D  HH"2@#c8? "a2`@w#X H2`@p#`-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:㿘   &`  3 8&`   "3@@`@3@@`h 33 p x`!3@ 8 " `@4` 2`?1"aĒ 8@ +`J |"`@4А` 3`@4| +? "a``X @A @0"`@8.@8)usage: %s remote-files local-file 㿈'H  'D,D@2H HD 3)PD@2גH  DH"3@mb(!3H*  ?`8''"?@9耢 HJ |H@4l 3@4 H?P"a "\,##0b@9 '@D!!\+  a w/H,`@3 x @Ě 3a\  1 Ȑ H& @)@3ߐ#Ѐ a\ &a\& !\` D?@Ҁ`@9x "!\耢@@7 SHELL/bin/shsh-c%sTry again later㻐 @9Z  @9V @F T @9̐   @9H  @9E 4@7 4 @ / " -/ @픔#4`@/  +/#  !"@ː"@& @/"  4#@ 4@ 4 @R?"a@: @t7@8 @8 ?4@; "!"!āusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'H 'D 4D@1HD?  H"4@:b?U"aH4`@" 7 D  H4@S֐#H"`D 'DH4`@y# # D H!"4@3#@."P O@ߐ@9?,H" D 'DH4` @W#(  "4@#00  D 2 ?H4` @B#(?"bPWDPWD command not recognized, trying XPWD. XPWD㿘!! 5$!@$! 2$!!Ā!2 $!"5@ݐ!5@!8$!Local directory %s getcwd㻘@"$  5"a@5@\!"!ādirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'H  'D5(D@0ВH HD  H"5@cb8?"aH5`@"X !Ā!!䀢 H"5@l"`H5`@"RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'H  'D5(D@0H HD  H"5@b8?"aH5`@n#x !Ā!!䀢 H"5@$#H5`@Y#command line to sendusage: %s line-to-send 㿘'H 'D6D@0DH (H"6@ڒ`?"a(D#@.Harguments to SITE commandSITE㿘'H 'D6HD@0H 6H"6@`?"a6D!h@H㻘@x#`/@8  #" @j @8s/    *@ . 4 /@֒ @Z modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'H  'D6D@/H HD  6ȐD@/H D  HH"6@:b?"a6`"@`SITE UMASKSITE UMASK %s㿘!!  $!6#6#@t`$!SITE IDLESITE IDLE %s㿘!!  $!7 07 @@Z`$!HELPHELP %s㿘!!  $!7 7 @D`$!㿘!"  @ @!~ "  @ @7 QUIT㿘#b 7@$!8!# "@#H?"`$#$b" usage: %s [password] Account:㿘  "7@@a? "a27`@QG!Ȓ4@#(㿘@5s #H @!+ "  "a"!@!  @A commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'H 'D7D@.H  HH"7@GbPH@' ? '!"7@\"@,"h"! !"7@M"@, "2J`  !"7@@"@,"%@@ ؀  7b8@5 @  J " !"-@!"@+"@  @5l ?("aIJ"`7c@a  `@6ΐ"@7DH? €`"  "a"!@ t @5B Case mapping㿘8lP"aāCarriage Return stripping㿘8͖"aāNtrans off. 㿘  "!8!@ѻ$##"!` !!""㤐@c  ,  *#|!#|`@W , c| 瀠&cؖJ!$J J@` J2`@  c| @* 2  * J *cNmap off. mapoutusage: %s [mapin mapout] 㿘'H  'D"!8#`@P$  C"!Ā  D8pD@-H D   H"8@cx?*"a1"a# @"cH`  L " &#@蹒 ,##@̐"H L " !X@”#nmap: unbalanced brackets. "H   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   K +`" JaX1耢 #.#aXJ [  \ $+2+J ٖ +J $1  L   "* J 0?L  @`+J@  f +` ` @ "Z  +@  Q  *`A: :  \ $921J L   ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J ^  J2J 2J  ]`\J <EJ ,b ]"4^ L   ")+J 0?L ! @`+J@  +`  @ "  +@   J  +N#؀ #0"9@Ϝ Passive mode㿘!`!:" "aāStore unique㿘:t"aāReceive unique㿘:@d@"aāCDUPCDUP command not recognized, trying XCUP. XCUP㿘:@#``!Ā!`!䀢 ":":@;#:@r#` "crestart: offset not specified. restart: invalid offset. Restarting at %qd. Execute get, put orappend to initiate transfer 㿐 ";@ H0` @V1 > J ";@ h0";`@ ǖ> SYST㿘;@!pLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘! 'H 'D";!  D;D@*͒H D  H";@ `a Ȁ  ";@w! #*`H cP*  @# *` * `*   "@ ";@Z"(x"!" " `$ o"Ē*`  * @  "@  cP* * ` @'%P`? "`@N P  "P?Α. :  .@ cP*` *   @ȐN "Ɩ.@`Ȁ@3`P`? "`@$ `P  &`P ?23ꀦ?`P`?  "`@  3`P  ` &`P";"P@?"aāfilenameusage: %s filename %s %qd 㿘'H  'D<D@*H HD  H"<@ a?"aH @+ ?  H<"a@ "!ā%s %s㿐'H  'D<D@)ВH HD  H"<@ ca?"aH @, ?'H"!<`"@@/@ I"!āSTAT %sSTAT㿘 <#p<#x@ `Local file "%s" is newer than remote file "%s". 㿘+X? <"c`@ `PAGERmoreCan't allocate memory for $PAGER|%s㿘'H  'D<D@)[H HD  H"<@ a H @*  =??"a@/ 0 =L = 8@1@.<  ==`@@W `h@̥%H !#` # a++  0"<$a@L$#@.@H<<$#@ $a@.5 ?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'H 'D  >D@((H   H">`  1  HcP  @b 2  0H">`@ ?"ab`@ɐ/P,`* ` @ Ѐ#`L  2 N+ Tb`*`:  $ \"B A `L@  %*`    * ,  * :`  ?D?#?H,  @ʀH :  i2D  H,@nH@0@.@`N 2 N @ .@#b@ c `">@> Q"!2N` "> ! "  ">! @'?9"a!䀢 !"@b`"@v b!` €"H# N`  "`?"``@* "@@y @"`@ ?"Hb'D@'HP* `@2 6#뀦D#/unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnect%sRequesting %s (via %s) GET %s HTTP/1.0 Requesting %s Can't allocate memory.GET /%s HTTP/1.0 Host: [%s]%s%s :GET /%s HTTP/1.0 Host: %s%s%s Writing HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s??!'@? ?#" ` ?a@S ??a@9  ??+?a@)   ?? ?a@   ??  #?a@S @4 /  L@ 2,@ 2@?,"` L@  2@?"8?c@"@@V6?"? H  ` g@?"`@0vJ@ȇ? "?b@Sf ??a@ȱ  2??# ?a@ȡ  ???L  /?"@0<,@༒ / ?L@ 2,@?#@( 'Ԁ???"@0#P@@%<?2 0??:??@䧒b耢 ?&@!?c@  "@?R  ?c" @7$! 2?Eb8@, c, ?c:#   ;bP@(8?Q?P@B :P& ?c@@@,-? 2# 7!L 24?"P +"P2 @&" #`?"``@* "@@ ##, :P@ F P@(@"0"?#ؒ@Ԓ@+ 2# H!L C"P`"P<  8#,"P :` "P2 "?`"@  #* "@Ǯ #"?`" * " @Ǟ @!"?@#0+@' L [@y ] " J ``:2* @y : , #  ??"cH@Řؐ @,  ''#!?#$@`#`#0?p  P@@h  !?#x@0 @E0Q?#$?'ԀJ)??cؠ  #\  @.X"?c@q@w 'Ԁ??'#@д ? "! @+I??'c㸔   #\ @.'  )??)?#$@Ԁ ??#@0j# !䀢 ?"c@ #?@@bQ?!䀢 ?"c@ @Ȓ : +#@T ?c@Q6 @޺ % 2*#ؒ@@ @ (@ 0#\@ 0#\ @,@(q?@@ 8@ (@ 0#\@ 0#\ @?#ؠ@@+Ԓ@*_@@z `0 @+??#ؒ@&0:./Ԓ@*_  @L   ./@V ̠ @`x@C  @ @@0Ð @+ Ԓ@*7  @L  2 `    ?#ؐ/ ?cؐ */L   * R  c2 @`@ܔ  2 L (  @?c  w' * @Ќ : !:!!Ѐ ?h@  c?# J ^@???:??@b耢 ?&@J!?c@ "@??@~Ő"0<R  ?c" @4i!  E?#@ '@ @)] 0"a@)Y c, ?c:#   ;bP@%s?Q?P@B :P& ?c@@@)h? 2# 7!L 24?"P +"P2 @&" #`?"``@* "@@? ##, :P@ F P@(@k"?#ؒ@Ԓ@)9 2# H!L C"P`"P<  8#,"P :` "P2 "?`"@  #* "@ #"?`" * " @ِ @"@@} 0f@$Ɛ !Ѐ!?"P"P @ !䀢 M"@@0 0G!䀢 "?"?@&#(?#@@(r @(?R ?@(?# ?c@@&t@?@&o/ @} 0????@}#0@!(@}}Ԁ??@(??c@@&F@?@&A? http fetch aborted. 㿘@' !"E@!@"!@3!  file fetch aborted. 㿘@'s !"E@Ĭ" @l"!@3  ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetp'D'H'L"'@2  "  f  ^a,@' ^aH@' E@&G"pE@&C"{ ܪ H* @@g   Eb@NG ?aؐ@Õ   ?a@Î   ?L/?P0La@  O L??0; /@ۡ @@۝ :@ۙ $`!@``,`   *@L `J`  `EH*` @|m"0 `@o : `. @_ :`L@ `.@``N@  @uI /  * #  E"b#\#`@v#ؐ@J 8@"    8'''耦  N !'' !  $  @"  $  @ 2 E"@{0  EE# c(? '귒#  #  ` N@ Ec0@@  `L Ec0@ 2 `N@ `E# ' ''ꃒ# K"J?L D?!䀢  "E`#8@ 0 @ޖ` EP@$E#X''䀤` '耥  L!E Ȑ#`'$ Ȑ i $ Ȁ " ''  -!@c d ܰ @$:ܐ '܀ D 6 ܒ :H* @V x" ? ￒ :/㿘?a@  ?aؐ@  ?a@  G@vbX   unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt@G""a)  @' ؒ  @'  ''''@ۖ.`Gb/@ܐ Gb@֐  GG @> Oc@Ȑ  OG @0 PO @` !GG#@z #(@*Z@z?"a ` @ٗ! ؒ@ّ! %$* G?     #\! @( G"c0@  @ʡ 6 G%#@@   "! " ``     #\! @(X G#H@z5G@%ac`?  `6  G@z%#h?@"w   @%` @'b'@ʐ 6 G@z #pE G '  @M  GG@y#Gc@!$#Gc@## $c`2G@yՐ##!䀢 G"c@@ # "c@c @?"aĐ '?c!@    # G@y#!@$ڐ 㿘@#Ɛ !"?`" * " @v @"` `""@/M ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘#!'H'L'P'T'X 7$ 3bI@!xIH!@B  IIb@!b!@5  bIb@!b@b?`" * " @  @Ib3c  II@y!?"a& `@#ɐ c@HcI@n!@.c "4I@a@%`? ƀ @# %c%c%c421 Service not available, remote server has closed connection. %s:㻘"H @%$9I @#     "!İ ֦ '@#`΀` `@#!I#c  4!@#!I#c  @@#!` @ !䀢 !I"@#@"!"a ` >!䀢`45 541"@ ,!܀  ` "J"`@"`? "`` ,`:  @* "@@-  L `   đ*` * ?А"Ā  !Đ?    !Ā " d   L `  2   d` `)"---  d`("  `- "!Ĭ "!,!@#` '`!䀢 4 !? 5"@ !"`?"``@* "@@@"$d8$!"0@Ԕ, !Ā`"# 1,"#4 @"[!Ā!a@   쀥@`"?П@  ?Ĵ@"@  "aİ 㿐''   @ߘ send aborted waiting for remote to finish abort. 㿘@! !"K"\"@Ð!@""X@-$ sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout#,L :K'!  ??#<"P8'D'H'L?`'  LJ -K"b @JL`K"b0@AL#H DH@ L0yaX!   Gc'p"X''x't@,'| ,K #4 ! x@"?$ x @! t @!y | @!s ?"!L:"Ēa@!i 'xXb@!d '|KH@Ēb@  HL P`a'_"LJ@ |'G @!L H'tGc@2 'G#h@vx@!; t@!8 |@!5 aL ""aL!|6'H@c 'HK@vn"Hx@! |@! *R` '@ <  "HK"@bXx@  |@  @p:@q x@  |@  t @  ?"!"L€0@+Ր"X ax!  `@LKD@.bp  KD@'bx @L!?` @o     R` @!  !HK@u"H  :J"L  Ky"    < ;"LK < 'pLDKc" 2x@ v |@ s "!Lt @ j `4@00GH#h x@ [ |@ X t"!L @ O  @0@ $p '@i? @ > a`;'t`` ""!R "P <`B;"P` R@ O 4$@# ;!L !Ѐ 4"P"P *   !" #`?"``@* "@@ ##, : B?"P@P"R@ $ # M`!L !Ѐ C`"P`"P<`  8`#,"P :` "P2 "?`"@  #* "@ː #"?`" * " @ @"` KH@tϐ"H  "!_#3 "P"P 49   0" #`?"``@* "@@ #@"#, :# B?  !L !Ѐ ` @= `?`"@@* "@@S P`B :P ? "` ,`:  @* "@@5P`B :P@6` # B!L !Ѐ ;"P"P   "?`"@  #* "@ #"?`" * " @ @%" @KH@s"H @  "! K@s"??:P@Ð "!L€@ x@ |@ t @ "P`"PJ  F@ 0Bx@r |@o t"!L @f #4 !?+"a @?$ @Ő  ?"a `€ "P`"P  @B  receive aborted waiting for remote to finish abort. 㿘@ !"O"\"@Ɛ!@""0@)' receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s#,? :L?'pH'l?O'D  :!O ;P'H'L'P'Xb'@`?''h 'd '\!䀢  H X`2J -K"b @&HLK"@b0#H   DH@ L0Q '` 'X'T @ '@(u"0 )O #4 ! X@?$ X @\ \  @V p"aLl?"H"Ēa@I 'XXb@D X '\KH@աb@ hHJ |dH@   UH@ku / "!  HK@ro"HlX 2,H  O " O"(@   /, HK@rP"HMX#@  "! H@H! HK@r;"H8X#@  "! @ wH  'H)X#@ @ lH 'H  !   0aX!  ݒ L@ :@6  X@ \@ ?y"a@'"0 *p   ` K" eL  DK"xL  X0%Gq#h  XG@a# 'dX`XKH@ݒb@ X 'h6"aH%PHJ |  @d H'T Gc@- 'hG#h@qpaL ""aLa|"!H'`@ H 'hKH@q"Hp* '`hR`@!  !$'!!؀@#a܀ @@@ $aO@qi"0$!$!<  aL ""aL"!H@0?! ", * (   h R@ 6 "HK@q8"Hp"!Ll` "aH`@h0 ""!^  !ܔh@@R2  "!   $ PbP <`#B <;bP!L !Ѐ 4"P"P *  䀢 !" #`?"``@* "@@ ##, : B?"P@"!d@S  # M`!L !Ѐ C`"P`"P<`  8`#,"P :` "P2 "?`"@  #* "@g #"?`" * " @W @"` "! O@ph"8??:P> OKH@p["H06H@pK"@02   @h @ø H `  @.h? "  h @â  HK@p0"Hpl`"!L "aHh0p`  'k` #3 "P"P 49  䀢 0" #`?"``@* "@@ِ #@"#, :# B?  !L !Ѐ bPBd@:bP` h ` ` @> `h?`"@hh* #@ `!` h`? "`h ,`:  h* #@|P`B :P@}dm` 쀢  !O"bP@O"@"# B!L !Ѐ ;d"P"P  䀢 "?`"@  #* "@1 #"?`" * " @! @^"d` @  "! O@o1"8??:Ph @KH@o%"H@ p"!Ll` "aH`@hX@Ɛ \@Ð T @ @1d* "P`"P }`  @ !H n*` iL@̒ ?d't@ t?xH@%ؒx?Z"!O"@Ȑt@H@ 0Lp"!Ll"aHT` @t  @q #4  d?"aX@f \@c 0.@c#`?`"!@֐ $``hd€ d "@վ "P`"P X  @I X@8 \@5 use of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d㾸  't` '` ? ?@T?@T@m!a耢 & @  @ " G@m#@- @`?" $!!؀  ?c t@ܘ  T@m!b   7 S!d ,#a 'T!aĶ@Y    " T@!؀# `$a"T@"!T"(T!ߐaĶ@0    " T@!؀T"0ǐ!!Ȁ  @S? "!d$!"T@w"8!`Tb(@& DTb  2!Ē @   "T@W"v!#\#`T"Hb@EĀ   @*`* @*ÖǕ*@  ( @ 4 , )$ b0@ސ T!Ē @ 2  "T@"4!"  ? !Ęh#\#`#d#hT#l"Hc pl@E< Pp ^l Zh V  @ * *` *Ö Ǖ* *b 6.&ĘȚ̄ІԞؠܢh#\#`#d#hT#l#p#t;x;;;;"Hc@pl@D "T@"!p  l h "T@"P!  @b˦ϗ*ۅ(ߕ*+ *  Ó*`ӡ, @+`@(+(@+ @ǐ (, @$ @6.&$Q$a@ m!!'@ג   "T@<![!#\T"Hc@Dv OO@ O@O@"T@#;!"`@ 4  "!  !!Ȁ G@k#`$!!` "@-" "  "  't'b@Д )#x 24 #`?" @  @’   $`G@kt#@` %#x#x ` ?c t@  `T@k]#!@   T@kR#!!؀ `?c t@   T@k@! 'd`@d `G@k3#p!@A  6#xT@k)##x ` ``  6!d /! ,      •x #\ . @#   T#В#` "!"T@M" A"    9  T# #\*   T##\#`#d #h #l#p #t #x #| # ## # # ##C #x? %#x'`&@ ` %#x    't`  t@ژ   G@j# !@ `?$  "cx acceptp "a耢 '' #`@@Ԡ  X@j]!`@ ?$`@`ـ $` 'А  @  6`G@jC#`@j㿘"P# "a`"P2 $a  ($a@ $a㿘@I ` "`㿘'Xb$@̐   H  "H#h H !ch"H"%&@""  @  .!. `! $ @1! a @- !" @'!a @#&!<a<"&!@a@!X"&!DaD#!X&!HaH4"&!LaL""4&!PaPc@#"&!TaTl#c@&!XaX!"l&!\a\!" @!`a`@.!p!#| @ȷ!qaq@ .!`!&!a"H"`#@Ȩ!a@.%!!X#@Ȟ%e.)@ @2଀ $ଟ 㿘@ !"?`" * " @F @ "`"#!\"ଐ"@ STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s aborthO"'D'H'L'@C ' '#@ Y"0K"p'!X  1!  "( 2 1!"TՒ T"( "Y@\"80 ڐ "  !"Y@O"pΐ ?"aĀγ Y"ybH @"Ѐ ; Ya@ Kb'DfL @y  0@!  `'SH  !  `$  ϐ @[  Y"$ Hb@L0@N " OD@˭b  #H On !OD@˞b  !#H #4^ !#4 2! 2 !KȐ" H &0#4 "@ #HA`?#4 2#! 2!KȐ"H "!/ #4 @ ' " ?"a@ 0J#4 "@ #H`?#4 )В  @a# R 2* + @ $  6Y@h"" ?"a@{* ( #H ߐ ݐ " ?"a@ resetxؐ @! # R 2*@ + @ $@  TZ  c@g?@A"a   runique: can't find unique file name. 㿘@` / ` 1,@@`O" O"(@D ` /,@+K@g"H; " [@ x03`@@ .*&`  d,,@: ` 9,@ 0`@ ,:  02 L .  1,`,"ߨ 1 Lost control connection for abort.%cABOR x!# [@g8" " ?"a@Ic   @P#R  @~  "#Y@g("#[bH@a @C#ؒ  @U# R  2`* `*   $ V 2 * *@$ ~ 4 6Y@f"" ?"a@e V 2 *` :@` V @۔$ 4V  !Ā"(  ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegimno:pP:r:tvV--r requires numeric argumentRetrying... 㻀'D@f'H\\`HP\"##@ʐ X   "c(\ h"c( $3#%"c,#c "H"#!L&a$a@$`"b\"ad"@ p ")\@S`x 2\&a$aȒ`@J 2\&a$aȒ`@A 2\$``@9 \$a&a @f  8\@+` 2\ "a`\@j  "ahJ !\ "ah!!`  \!hJ 2\\@e $!`\@M!0  \@a8 \a@@ \@aH 2  P@T  "` "a XR@"b k`j\@ * d a"aL`5\^ T*` "!T"a P"ap㐐 `"G"D"#A" ?="aL:"  "!\ah@ȥ 2\!-"b "!&" "!!"# "! L    @a!$"@\ap@6ߐ   "cD "a"!@W\DP@7H!"#xH+  D"@  'H#c4"H"@+'D @O1 @^@P @"@3 lc@ِ DEH@  "!pDH &9@c@" "^@[ a,@ ^aH@ H 8?'''D1`@t"@ !"  "\"@H!@"@" D""@@"`?  ^a,@ ^aH@ @  t v v v v v v v v v v v v v v u v v v v v v v v v v v v v v v v t v v t v v u v u v v v u u, u8 up v u v u v u㿘@ "@W 㿘' "@ #b !# " !R @9 @˥#$#! & $b@9 @ ?$ $bO b  !# " $bR @9 @ˉ#$#$b"!< $ᐁftp> ^"(sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 "?`" * " @ {L dƀ`"^, "^@u"@ P`? "`@ʇ  P  & P` v Ps^@#bH P1"@r? "^@M"`B2 L "^@D"x9  "  ""^@6"+""c €bH# " L  " `?"``@* "@@  `!d@^ " Q!@"@""`1$@ P   @ n^a,@> ^aH@:  -    `"J@ KJJ@J`J2  "  " `2J@?㿘%"`ax""#!#`#$bH $bH@@ bH!$aJ@ `!$ 쀠 J@ `"#aJ@!__fd" J@ "` ?`쀠  J@ "" J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " `* ` #a!쀠    "!"! 㴐 %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 U?@)%"H`` `!`! @籒 3c1"* ` H L c@c"*   *@ @( 0!@Ȑ? `"a `"a8@z ?`"aX  @q? `usage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘 8`   b@:!@I macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8`@ ڐ#࢒   @  # !`#@ ?@a] `c@}a`@Ӑ  "` "! a @aQ @z! &/@A . \aZ  0T F@{ L'@ܒ :#a@֒ 4a@ . "@̒ a@$ a$L @ . #@ $@Ȕ L@ 0"'@   aD `a@, @  ! @ @  @D&@0@`؀ a@`   @_R   ?a@  ! @ Ԑ@ W @&0 @AR   ?a@  ! @ @ 9 @&0#H )@n  ") ")  '"a@ѐ `%*` * P *    ``@E   L   ",  ,@2  sP`  "@ P*` * ?`"-$*` P* @ * * `"%* @P *` #@ E*:  ,L? , `Ȁ Ȁ "a@X!P7!p@_`@7    @,   @_Ӑ 0a@_А  @ 0"a@0 "a@)! @_ 0a@_ ` @?㿘!  T @   ` `,3#`"`02.@ . @ `"`\.,`2.@t . @o  ` ` ` `,퀢`\.L`  !` !@‚` "    stringlist: %m㿘@ 2 cb@W & & @ P &cb@W 㿘  @2 *@#&  &cb@Wܐ  * "  & 㿘  `  @ .` @` @*@@ݐ㿘  : , @ 2  * Already connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘#b'H  'D"cc DcD@ HD  H"cc@?"a!!` #(#H !` H!h"dJ d`@/ W  S  !` Hd`ʐ @ !䀢 d"`P@ah +d`x $b@ ac ")d` "@ W%!X"d` @ O#8"Xd` @ G!(d ` #X"aP+#X *"H  @ #' ?$dz #!`!d%4@ђ  @˒  L? ."? ,"d`@4 2,!d`А"0@  #H  "b( "ac d%!X`@ ` d"`@ٔ$#H ""("!`d"0a@{ 2$"d@!($anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init0'L`'H  'HLΖ H?"a԰ H L - !p ' ! @ l !@ g@#  'H@U@Hu 2e!'H!@v~eH@Ξ! e!'L'H 2e!/'H@#  @U@HS 2 e"a@5 e"a@-P/ O@|@ ?.@O 2'H'HH eHr!в`L 2ee@"!'LeLc!`` `e@"!'eS"`e``eF" e@\" 25 !p \  #H  0'eb  @א"`= ""H@05? @ "b cPe"@ `@  sorry, arguments too long. (%s) 㿘"`@$ "f@!"f@ጒa ,@ $"@P@|X @` ?L@ ",@  "H@$ $"&@TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘!\ # !?"!`",  @$",# +` ""```"`` ""`0b, 2f@" f"@ܐJ? /  $d !f#@ ?@[ @ ?L /" /, fc( @֐;@D f#8@[j @1񀦠!?&!&!'㘀`$#HS`?`@f`#`@f#h > `@f`#p!@L d "0&`#H-`?fcx&!$@%b,@̘b, 2 f"f@# #&!!`",@{?$ ",@M $",@ 2.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘%Ȁ B#c 2? !g"c @)@ "P@z$ , `*  R  n"$  p ag" yg"g"$@%#(  g$c"c@@ @ch! %s: not foundh# ! Ȓ  ,@ڐ@, @ 2@Ȁ  @h@Z @U  @$@@MSIZE %s㿐#%c䀢 ???$h !x  "0@g $  @[ J   L@  2$??"$c 2 $!"@"0"@ $MDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H#'-c䀢 ?$h੐" a`1L"0"0   " L   2 hb@  2"h@*b  2 0, ,, #\#`"0hĖb@2Ȓ  ,@ ?'''Ę?x''''@?쀦`c  h"b@$"$c 2 $!"@"0"@] $䀦?"%ā㿐!"0?@/$"0`w @? "0 `?㿘# "a !L?2$a@N $a %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAh!!x @Ӯ`!x d"d# :p@ӡ !L +aЀ a15"P@ B `5- -@B2`* @ *`B2*@ *@a  d & d4 diȐ!@e ?․`@@Ē d@@ib!"@ii#\И!@H$@  4`  <    4  a"@ , @ː@Ȑb8J@!"@i` "#\ B#\@d d"@'" 'А"@''!p!p`d"d" ;!pxx  "x@ # '!x!x" `'" `'А"@@''"@` 腠DA?؅B.'@2 @_@\!"@i@ɺ.@Q@N!"@i@ɭ.@'@A@>!$@!i" <@ <@@ɒ%"P "P` "H  aЀa`(@@ !"@i@j^% a@@!"@i@ZN% @Fb "P!@A?ؒ. ЅąB'@ @ڐ@א!"@i@5.@̐@ɐ!"@i@(.@ꢐ@@!$@!i"ؒ <@ <@ꐐ@ %R @@[ `ia@& @ 0@ ?`" * " @@ @~%qd byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d !䀢  @ǒ !x!x" `'" `'А"@@''"P!"P 腠D@Γ?xxX B3? ?  @  k(k k"P" "P` "P  ki"k"P ̒x#\@`;``"`h B`;hk"Xk"`#p@V d V"P "PQ ` M xX EЀ`A "P@ D 4: 3В@ @ b !@?px. pąB'@.@閐@@ d$@!k"h <@t <@鄐@  "R @@K㿘  @ ,`@@4 `@* ?`@A "  @? @I 6C`@,` "@  " `?"`@* ("@@ %`@C-`"   ?`"@ * "@ 逤Ħ`@ 㿐"# "aR `h@?   P"  P"`$a㿈'''' @+A 㿘@K/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.piddhclient-pbinding to user-specified port %d-d-u-1specified_interfaceInsufficient memory to %s %srecord interfacedhcpcudpNBIPREINITalias_㿘@s m  @n b! * m@@` 2m`@@@u\! ** m4"@F2`D@@v` m + 9"c@@l`耢 m0"#@@@c` 2@ , &"cDJ -m@ ``@DŐ ` 2  mm@!@E̒a0  `@f@ @O  +  $$ L"#" `m! *" 2 "mm!H@laP 2  D4"" ,! ,4#H@#l#H ,X?"  *X * 2  +##$@Ȑ @% +@5@   maX @  @ @4 #c m L 2m @ a` P mah@ Ȑ@  2#c` @  "  P "`@& 2 P d -@+"a  Usage: dhclient [-1] [-c] [-p ] [interface]㿘n@E: ȁ㿘@# 㿘 P@  02  ""`@ 0 P@o@ P@ ", Pc@  ,#l P" 0 P@ "4 P@X"`8㿘 P@@ P@ ", Pc@  P "` ,#l P" 0 P@ @"4ARPCHECKcheck_㿘n"p@ s X@  P  ! ` ,nbX@ ڐnbh@ $@ C $@@ے@@ 値` P`"  P "`0@a܀ ! P ," cl  P""` P c@   " P   @ @ "  P@"`0 c@.  P "` ,#l P" 0 P& @# 4 P@@ s",@DHCPACK in wrong transaction.DHCPACK in wrong state.DHCPACK from %spacket_to_lease failed.㿀 ( P, o@Dؐ P0j    o@Dʐ p0\!o   @ې@5@D@ 2Po@D 0Gt"`#(@WP @5!P`"`P  "@5P`"`2  : "P  "@5P` "` 2`@ : @:@" P ,cl @ "P`@ "P` @ @" REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.㿀 P`8`"`, P@ ` P   2oo ""o"o" ,@  P o  ob@  Po b@  P mah@ @  P " P@ Pp`" P"  P@\  P!o` "@@4 P ,@`l" @Cǐ P @"`@ Q㿘 P@@ P`@"`, Pa䀤 2 a @  P"  c@  ,#l Pb" 0 P  "4 P@"`  BOOTREPLY from %s rejected.h * (`P",f@   @Ȧ @@4k   @@4yp@C`!X0@DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.` oq0Qr0Np  b8p"bHp bX"'Ē`@Ê  2 (#p  b`@Q@4   "@G@4@B0  (`P",f@  @3Ȧ @-@3 2!pBOOTREPLY%s in wrong transaction.%s from %s%s isn't satisfactory.%s already seen.ARPSEND㿀!܀  (p"8q (P` q`, @q 8!q   X@@3@BP&  & 4 * @ w 2&P    2  `@  gq 2 @ 2!o@Bg 0e 2P 0 $ 0Pq 8` $ ,@nbh@ I@ hPb@?  0@  @±  P $P" P   ,#l4 $P` 2"`@ 2@"@ ,#l$@ &@`nΐ0q h@B0  @B60 bp@s X@Ւdhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d Invalid lease option - ignoring offerdhcpoffer: no memory for filename.Bogus server name %s㿘@t(4 q@A#{  @(4 , 4@ "@`  8W$ 8 @@@ 4"*@ @  L, & ` @ߔ !Ԁ "! 2!J , "!@1 A & $r.  @@Œ`, $* @@  $ 2! $r@AK 00 "! "J l @  & (r  q@A1#0q#@A,@  @`l (* DHCPNAK in wrong transaction.DHCPNAK in wrong state.DHCPNAK from %sDHCPNAK with no active lease. 㿀 ( P, r@AP"h01    r@AB"0#!r  "@S@2"@A P r@A"0@Pt"@#(@̒P "`No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ldsend_discover/send_packet: %m㿈 P' ,0lb"@  @0 6 b 1   P`8 " P "`8 P 8 2 P`" Pr#@@9  P"@ "8 Pr`8`@@# Ps 8`@4@ 2 P + P4 b  "4@“ P2 `4@ϓ, $`4 P"f`4@$ P@ P2 f@4  `4@ṡ<  $`44 2 Pb "4 P"@l40@ "@  "44 P P2 D 2`D# ,cX`'!s @ǐ P`4`@@+  + P#$'<#\@"% 6 Ps@? 8 Psl`X 4@No DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAIL㿀 Ps@@?ؐ#X P` 2Z P`s , P' ,l I!s #p@@0ѐ@? Psc ,@Z Pob@ P mah@@ 2% P Pl   " Ps@#`@?"@  Pp` @ 0s"@?#Đ@@ 8 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 P ,#D s@ "`  P"@?O#t @` P mah@9@X P "` Pf" @ ,lnaؐ @@EXPIREDHCPREQUEST on %s to %s port %dsend_request/send_packet: %mx P! ,#l0"@2b $  P "`t#(@Ӓ0: 2 P8 2 P ,s`@@ 2 P P`," 8 P !#l @tb@  Pob@ʐ P mah@@ P "`X04 b  "4@ P2 `4@, $`4 P"f`4@$ P@ P2 f@4  `4@< $`4 P`   ,#l@ `4 "  "`4 P  ,#l @$?' , P #H 7//   4 2D2D'!t"@ @>_쀢? * P'"<#\ @!  P'<#\ @ K耢 6 ,t@># , Pt#lc(4@DHCPDECLINE on %s to %s port %dsend_decline/send_packet: %m㿈# ,cX`'!u "@`@> + P#$'<#\@  u@=ؐ"DHCPRELEASE on %s to %s port %dsend_release/send_packet: %m㿈# ,cX`'!u #@z`@= + P#$'<#\@ڒ u@=#??c  /  @ $@ P %@ < Ԑ$@ $@  " @ ?" @  " @ "  P($@ & $(& `@ "  P& @ " @ " @ "  P` @͐% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2" P(, ? @#@?, "@, @"  P&, @" @" @" ښ` P`<   @*g  P"e Pe!+4 !,"e P *`< P *`= P *`> P@I* ? P "@ P2 D P2 F P" H P" L P" P P" T P @` X?c  /  $@E P %@@ <? Ԑ$@ $@  " @ ?" @  " @ "  P($@ & $(& @ "  P& @ " @ " @ "  P  2 Pa ؐ$@ $!`4@  "`@  " @ " @ "  P ``2"%` @% Ȑ$@ `$@ `"``@ "`@ " @ "    @ 2" P(, ? @#@?, "@, @"  P&, @" @" @" ښ` P`<   @)  P"e Pe!+ !,"e P *`< P *`= P *`> P* ? P`,"`@ P2 D P2 F P`? 8"`H`H`@` P P " L P" P P" T P @ X0 / $@y P %@t < Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf-耢  $ f-'f- "  P&- "  "  "  P`<   @)  P"e Pe!+4 P!,"e P * < P *= P *> P* ? P,"@ P2 D P2 F P" H P" L P" P P" T P @  XH / $@ P %@ < Ԑ$ '  "  ?"   "  `4" a$'!@  # @   "` "` "` P@(`< P"e Pe!+4 P!,"e P* < P *`= P *`> P@* ? P`"@ P2 D P2 F P`@ H P " L P" P P" T P @ X㿘 $ " (@* (  @$,  4  8@   , @wcan't create /var/db/dhclient.leases: %m㿘% * "@W#x@bx $x@:" +# ` +`P " @z `P`"@@o@`2`P +#``P " @^ `P`"@@S@`2`P@ lease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } p`0 ' *∀ 2x#x@bx $x@:&"x@Œc`02  "yx@μcy∔ @η`!y`  @@+@Ω`(y@΢`8`$ y−`P@Κ`(`,y−`h@Β ,`4 !, `8 ∖ @( y`x@{,@_`! * y`l #\#`"@c#d@K` y `l #\#`"@P#d@8`y`l  #\#`"@=#dy"@9a@"script_set_env: no memory for variablescript_set_env: no memory for variable assignment%s=%s㿘@%D   cD@ cDcDJ =cD  D, @DH `2"H@ $Dy@9A#D" @Đ@@C #cD, "@y@9-#cD@@@z`@ 㿘#cD   cD@FcD"  cDscript_init: no memory for environment initializationinterfacemediumreason㿘 d"#H@!! $#Dz@8!#D "z"i z"cz" _%sip_address%snetwork_number%sbroadcast_address%sfilename%sserver_nameno space to %s %sprepend optionappend option%s%s%sexpiry%d@z$@ @A@*< 8P(@@4<' @- @(#@@)B耢 5z$@Z @@) 2$( @ @А#@@)xЀ zؒ$@5 @@)ʐ(  z$@#($  z$@$   P& V4N, "  P P  &0N&`I@  !, zz#@89c( P @ P8&@@@,  !, zz#@8c8 P8@ P&@@@{  4 8 ,!@@zH$@ @& 5`zP$@z$`@ Can't fork script: %mscript_go: exec: %mgot wrong pid㿈  % P&b  `X" @@?Ғ /  '@@t' {@7e#  #D@?{@7[#?@,쀢?{@7P#쐎   "?> ?option %s name is larger than static buffer.㿘@ !|@7.  @ "1J@ - @ # _#* J@  -1#. Can't fork daemon: %m㿘 +# @(XL  "L@@"c |@6!0@ @@Can't create %s: %mCan't fdopen %s: %m%ld 㿘!# &@! x|# @7 "H0@\bx 2!||# @7"`0 @P"x@b@JInvalid IP address in option: %sBogus name option: %sunknown dhcp option value 0x%x㿘 4.`  8  @% `} ,.` @L 2 | #@ 2 |#0@6 0  |#H@6#@                                           J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @R "N /sbin/dhclient-scriptrCan't open %s: %mno memory for client state.no memory for client config.㿐3c@5 %@2X!"0 @"@ " <$@" !,$@" x$@"! """$~$@ !p" $@$@$@ $@@ + $@  + $@  + $@  + $@  + $@  + $@  + c$@  , @@ ~$m$m@a ~c@4!@p? @X@> +# .  P 2&@졐& $ P~@4! P @(&  P& 2`2 P%@쌐0  %~@4y! %`X0@ P"& 2 P % P`?Corrupt lease file - possible data loss!㿐!@C##~@/a @? !@Ȓ @4 X@hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.㿐@>`I*`  @20@.  * "@@$  *  ~"@ x *  s"@ m *  h"b @ 0``@,`0Z @4Òa@0R!!@  "K&! @\!@0@b b  bbbb @E0+@5b && `@4!0@G0@ 0@ 0@0@4{!P@Ȑ@! ;@4q!h@  $ ` x p 0 < H  D expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal data㿐@͐~   @> .@ @ʖ ) @`:@`: 'a@}@d  !x@}0 !!8!X@3 @ expected option name.%s: expected option name.%s: too many options.expecting semicolon.㿐 @A !!? &"耤  !,  @ 2 !.@ ! @  ,"ۤ ; 0#@3h# 0#8@3d@ expecting interface name (in quotes).expecting left brace.unterminated interface declaration.?#T@!! H@I P 2&@z P& 2 L@ L ?$ L "c@ʒ { ? p@3@e0@3 0#T@ޒ? } Pf?@Insufficient memory to record interface %s㿘 +#  @p 2   +#  @d 2 @ `  !@1ْ  `@s @;  +c$"cno memory for state on %s 㿘@ΐ& & P"@1  P @T& no memory for config for %s 㿘!@鴐"0 P"f P& 2 P#(@1  P"0& @4 P&@<no memory for lease. unterminated lease declaration.㿐@ {@2k p@0@(4 2 @1l# @(4 0 * .`@$ 0'@$?a }@u@ `2`PP0^ ` ` PT"   P `  2 @   2`  P"` (``P $`P/"  P& ,#l 6  @ޒ    P@1#0  P " P@"`  P"expecting lease declaration.㿐@ }>`:@*`# `0 ;&`0@ l!@1 H@ 0+&`@ /0$`,@{ 0(@D%&`(@@!&`$@~&`@z&` @v&`@’`40@1"H@ڐ@ 3 ;@1#8@А $  t                         4                     D T d        expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.pԐ@ w   !!? @0 ;"F @B @H@ː  2@/ @@ x .' +@ K@ H !!?2  ,@0! ;" @ڐ #@. 2  !0#8'  @.Ԥ  Ԁ@2!Hؒ!`@0k0@稐* : `2#*` $@"W@ !@Ԕ  $Ԑ;@ @y؀ ؒܠ $@;{@ ؒ!" @0&!Ȁ ;" @p Ԕ @  @ !Ԕ @ є @ !Ԕ @ٖ  @  !!? @/! ;"p @1l @a @b  /@b @b /@/"ۀ ; L@@/"00"`L@` @`AK?@ WL@`A ," ;@/!h0 @/!0a!@/@ @樐 *`@ "` * @  2 @."X * @ @1 * &@hThtExpecting media options.no memory for string list entry.㿐@   2 @/ @k0- ,# ;@ !2@@$  @. @` $@$&@@ ߠ ;@.#8@>expecting IP address.no memory for reject list!x@ @.֐"@#0@  2@-א"( @~ b,@ &@ $@ j , ;@.#8@㿐 @  } {`@ P0 ; ` ` @ >0@ :?ޠsemicolon expected.㿐@ + ; @.y#Ɛ filename must be a stringno memory for string %s.㿐@ ! @.Z# @@k  @-X @)Ő  expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.㿐  @ ǒ !!? ! @.  ZD @@  2@-  @ܐ@ې@芐 @ Ò .@  ."̤@ 2@,!?`,`@m@@$@狐@@@? .,2`㿘 &@` . @ @ expecting a network hardware typehardware address too longexpecting semicolon.㿐@ E!!$0  .@ .@@-"ِ0('  : @t   ( `@丐@-u# ` `.`@%@䬐@  ;@-d#0Expecting numeric lease time㿐@!@-M H0 @% can't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.㿐   "@; & @:   @,  @,!^ !@@ N`}`{"@@,֐ `;"m  i @x@uӀa a `@,!  S ` @``: @@=@  @+!@@~@}  )@Ȓ & @㣑:  @+!```: "@&@U`&`:`