ELF 44 (444ddˑˑБPP>;>;Z^ ^ wQtde*APБLI `hIj` S``$](g(} ^ Z@ @c @'_@ nd _4\ e Ja(= f _f _]ou oo"4z 4t4_| ?vE x( x:O!j Jze E['drZ zJ,SGohCloyLsmgtU6tuL9Datd/lsEzBJAmirqxRoWJaPOj/Ktp-aRLAbu-ooaeIcA7r/b14nM1lL7h7jlFeKwph2e ;avk D$D$D$$MD$tuD$D$ ÉL$D$$D$L$L$D$ >ye ;aD$D$$D$t.tD$9D$D$D$$ r,D$$D$D$ D$ ux,닋D$D$D$H $ D$D$D$$k F,Í0$D$\ 0$D$\ )+ ; { k { k ; + K e ;av FD$ $D$D$e ;a,D$0L$4D$0L$4D$ L$$L$D$,D$ /11ɋT$D$4L$0T$\$ $T$D$=OD$ |L$9!P9)щ!ʃoL$ 0^ufalu Ql$d  d .D$T$1 3{|$({9t E9|\$$l$4$L$|$j D$ uD$L$ T$\$$l$뿋D$($d d ~1 YB9|,ËL$9w.P9w')щ!ʋl$ L‰,K K 2e ;av7D$L$ T$1C9}s,8ȕu\$D$YJ e ;a( $9|$|$$e k5 e D$$H e H e H e H, e H8 e HD e HP e H\ e Hh e Ht e e e e e $d (d  e  d $D$D$iD$$D$}D$L$ e  e  e  e  e  e  e  e  e  e 1ɩ!Ȉe D$s(ÈL$$D$D$  e T$!ʈe  e  e e (ÉD$ m$tD$ P1(Í= d ]b $|$D$,D$$xe (ye y e y,e y8e yDe yPe y\e yhe yte e e e we fe U0D̋D$L$D$ \$L$T$̹ЉD$T$e ;av.D$@$D$D$D$RD$ D$;e ;av2D$@D$D$@$D$D$ D$e ;avBD$$L$L$ D$L$ $D$D$RD$ D$e ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$(L$ D$T$e ;av.D$@$D$D$D$\QD$ D$e ;av* D$@D$D$@$D$D$ e ;av.D$@$D$D$D$PD$ D$+e ;av* D$@D$D$@$D$D$ e ;av;1L$#D$ @\$$L$L$D$ @|؉L$~e ;aD$$L$ 1B}oRl4t$9rp 69v))9w؃4Él$T$DL$(\$4$L$\$T$ JD$8L$(T$D\$l$맃4ÀH$@(~D$ l$<1 |$0 ΉL$0y9r'9v))9v N)9|먃4Éωt$\$|$,T$Dl$$<$l$\$T$ D$ T$D\$l$$t$|$,뗋@D$D$<$\$T$ 4É4Ã4ÍA$D$ 8 襬@e ;avJ D$T$9uD$$L$:D$D$ Í`p$D$&3 oe ;aL$I Y \$ d!I@^ 9JӃ<L$ur$8D$D$_D$ e xu9xL$fP e uHL$ HD$$Íx‰뽅tAtCB8$D$D$^D$ e P8uP뀍x设mɵ$fD$D$L$\$ Ӊ$L$D$#^e L$ uT$JT$zI1`p$D$M1 d$D$u6 H$D$&]6 f̃D$$D$D$D$D$D$ e ;aKD$HHt H( $D$D$Hv}HP HT$LuGP$L$D$HHAHP9u@ID$8$B@D$TD$UDÉL$ X$T$L$蝵D$HL$ L$PuD$8$?D$TD$UDeD$$G$@@ L$‹\$ۇÇ Օt@@ e [T$LP@,T$$-e D$@h4l$45e ZDt$Hp4BD@|$0\$,n En$^$F e h EF$D$8$fD$ D$LFD$$T$9 e ǀJZ ۇÇ݅ɇÇ!ۇÇ uUHDL$(e u,@DB4$ID$TD$(D$UDË|$,1˰|$41ʋD$) $D$É\$D$D$$T$끋|$01臰BH ωrxD$f_-e u@ F F$h 10~ D$$|$0D$H1l$E1l$4t$H#دljͯx‹D$L趯z,1謯D$<D$@ : L$Q\$kl$$D$D$HAHP9u@HHD$ Y$T$D$誯D$ L$+e ;av1D$$D$D$D$D$D$ D$D$ ؔe ;av)D$$D$D$D$RD$ D$萔e ;av8D$$D$D$D$ D$D$D$ D$D$$1e ;av9D$$D$D$D$D$D$ L$ D$ L$!Гe ;avD$tD$D$葓e ;avD$t@D$D$Pe ;avD$$?e ;aL$T$ыZt}-e uRC BT$Bt*$D$D$cD$ tD$D$Í{ 1ωZ1ߩ띋e uA넉1軩Y豩lD$e ;a 0Xe $D$D$D$ tԋ\e D$4$D$(D$,D$(D$,D$8 $T$D$hd $L$T$ D$(D$D$D$D$뵋T$x .T$x_B>f39T$xtl%y <9uNB L$D$(FD$Z$D$(ZD$R"WW볈\$D$$D$"jT$xY%yT$xR?.1`39T$xZ*tX? '9u6 Z\$0L$ iD$ $D$0D$5#DÉ\$,l$2D$$D$,D$! T$xh?T$xa>°`B9T$xtdmTA `<9uFB (D$XL$PD$P$D$XD$ kWWD$4_D$4Z$ :T$xWemTT$x^=JhJA&9uzT$xtLJc 39u/ QL$@D$@$D$e 0̉\$DD$D$D$h!wT$x끁JT$xz'`'9uT$xtL=J 39u/ L$8D$8$D$̈\$D$$D$ TT$xz=JЋT$xs\w29T$xtX\ 09u6J\$hL$$VD$h$D$$D$!1É\$H#D$H$D$T$xq\T$xj΀&9T$xu29u|tKqS `&9u.  L$<D$<$D$P_f\$UD$$D$,f\$"D$$D$T$x,T$x)0$D$_ J~e D$;A$$D$L$ $D$荮D$ D$ L$L$l $D$D$(D$ yHgT$ 9[9| l$l9)ȉ!ȃt l$ll$ltf.(D*L$)ډT$ !ڍLL$h $D$D$)@D$ ?HT$ 9| \$h9\$h,f).L$$|$x5vL$l$L$$$$L$$)ʉ!ʍ $$$$$D$xD$D$ D$ D$L$L$pD$t`p$D$pD$D$ L$ $D$  $⾽D$D$.\$ T$軁D$L$ $D$  D$($̻D$D$D$hD$ D$ D$wD$L$ $D$S  , $D$D$1l$ T$4D$L$$L$   D$H$̻D$D$D$lD$ D$ D$D$L$ $D$  ze D$;AD$HD$LD$P$$D$HD$D$D$ Q D$X$1踒L$H,e )с T$L$$T$L$L$ D$D$L$@T$\$D$TL$G|$x1Q$ $L$TL$T$\$ D$赑t$ |$x|$Xt$xۖL$XT$l\$hl$p$$$$L$G$DŽ$DŽ$DŽ$DŽ$$ËL$L)эQs$T$HDŽ$DŽ$DŽ$DŽ$Ƅ$xe ;avCD$ u D$(ËL$ $L$L$D$D$$D$ WD$D$(Vxe ;avIʺ$D$ED$L$ t D$L$Ëc c D$L$we ;avD$D$we ;av D$D$ we ;ae e L$T$Ћ\$sSSS 1i!iNjS1iiAʛ1S1iAʛ1i!BS 1i!Bi!⼃T$s111v-e 5e =e 볍SڍlL1i!i3Bi!i3Ei!i3i!ilj1iAʛ1 1i!B1ȉD$ ÉڍL1i!i3i!i뫋 1i!i떉, EݍT]1L 11i!iZD$$D$D$D$D$aD$ D$ `ue ;avHe L$L$3i!ilj1iAʛ1 1i!B1ȉD$ te ;av_D$H e T$ 3i!i3Hi!ilj1iAʛ1 1i!B1ȉD$ jte ;a D$$H(P$L$(Y \$,t D$0 Ë L$$D$$D$D$L$L$w$3D$ e u@L$(HL$$HL$H e uL$H x D$xD$(yD$$밍c $D$$D$$D$L$(L$D$ HL$,t D$0 É$D$D$L$L$w$2e L$u$D$*  M$D$  Re ;a@D$D $L$H?L$HL$D$@e T$ YD$RL$DT$H4k -E -+- --+- kt)Љ\$<,919t1t|$8<$T$D$蠤L$DT$H\$<|$8hs]Ѕ:95?D$8T$$$T$ e L$'D$8L$$D$8L$$\$D+L$4 $D$̋D$ @L$8T$D\$$ًT$8\$DՍT9D$ =4T$4 $D$D$8e D$ D$_$D$8e D$}D$ 5j$D$D$PD$ yD$0L$D $D$ʊD$ L$$\$Dl$8T$0#l$LL$P@11s$D$D$@D$ L$ttD$8L$$D$D-L$, $蚱D$L$8@ d Hd D$,$qD$|$8T$$:d Xd L$D|$8D$LD$P@ÉD$l$$$T$蕢D$L$DT$H\$$D$ =\$D$' k$D$! |$\$$l$t$(v($D$!D$$D$ĝ$D$D$$$D$$D$D$($D$D$n$D$. !Me ;aD$$D$ L$$T$T$D$T$$ZtmD$ $L!ˉ\$ )É\$D$)D$ L$ \$ˋl$$)Ӆw D$(L$,É$\$D$D$ L$ ։L$(D$D$,D$(D$,)Le ;a D$$H$P $L$1D$@T$$Z,r9\?u9l$ \$r$t$z HL$ىL$l$@\$ !݃ ! |$ ! j l$!݉j$D$BB8@fB8B@\$ Z \$( D$( D$( Ke ;a$D$(L$,сT$LL$ $kD$L$Q9A89<D$D$D$ P: D$D$(D$L$,L$ L$ $KID$L$(DD$$jD$L$Y9Y@A Y8CfY8q9wD$0L$4T$8$1f\$ t$ i$D$'D$ $D$/%)$D$ D$ $D$p $D$u $D$] T$ fD$  $D$D$ $D$%)$D$ YD$ $D$e+#$D$1  He ;aZPD$,e 'D$T e t5L$Xt&I $L$@e D$' D$ D$`Pù׋ e me QRhK)!˅ ؄eHCH3A,e9ǁe@\$Tl$X|uÇމL$0\$D$8D$T$<x cwUXtNP PBPǁejuHet@\$`PËH( $D$1@@@ T$T\$8k 9‰CD$TC D$TT$$L$D$1l$l$D$!Xe D$0ǀe ZuAetAe DБ^ ~L$T9D$89)ʉD$Le ;av# D$$D$D$D$D$ >e ;av/6D$ $D$$D$D$C~Z>e ;avБ^ $D$D$ >e ;a4D$8=D$8e I111ډ1ՉLA $TD$D$$D$(%̓t$$ މ!t$- _ DD$LL$$D$D$%D$D$,$D$ D$,L$XT$\YT$ YX \Wf.vWD$8*؍YY,@D$<4Å|D$<4 G<2e ;avXD$|$1T : L$L$ L$ L$$L$L$(L$L$L$L$ $:L$L$,;e ;a OD$ (L$$Q =L$ eZERT$7Zp,8 \$kl)I!K$@e D$D$L$AQ\$ ,ie-t$_ЃuUetED$td 9tBL$(@e 9uD$,É $D$ D$@e $D$ D$蛏D$̍pd $'D$몍td 9ulpd $ \ ,pd $D$ L$ T$td $D$(D$D$D$,ùC7Ƽ$D$ >$D$#} -$D$*e 1X$D$M &=e ;aD$T$ L J!ʋL$ыX9wQe hLK!9wT$(ÉT$\$ )É\$,$D$$D$gD$ L$AT$D$(8`e ;avyD$Prbe[1111J !J7u HAfHHAfH 8ke ;aO(L$,Q!Zl$0u0؍|Ee Qe BD$ $D$0H(IZL$,Q QIJir9Vije D$T$9t&1L$ $D$D$ D$D$ D$$ÉK5e ;avb $e@L$111ډ1Չ+AL$ 4e ;aT$$K1T$(e[1111>Z1A,[9ÄuވJuT$,ÉT$(L$D$ $D$e L$ T$u]D$(H u뻉T$ ($e L$uD$(HT$Q̋T$(zKxD$ K뮋\$({ J1ID$ $=T$D$\$ k(m!s@^ 91T$$3Pe ;aL$T$q\$k(֋m$NEЍ^  C0 ^  J91D$ L$ txS(*R€uY $l$QD$ L$ T$9t9\$[0I|ڍ e uD$$L$(tI1 $l$O륋K( $D$1D$딉`sXЍ^  CsG ^  J 9s Љ\$- &  H13e ;aD$$vlHmL$ Y [\$hl$l$(,$2֋D$L$$YʉٽM!l$ u0΋zJ t)j!7,7MsD$B 8uT$\$ k,s-L t D$P\$($L$ D$uD$L$T$롋D$ H,P.\$Ӎ @/T$Lt D$,É\$ k0l)Mt L$1Pe D$,É&e D$,Í$D$!q z/5e ;aD$$vH|L$ Y [\$hl$l$(,$2֋D$L$$YʉٽM!l$ u0J zt)j!7,7MsD$B 8uT$\$ k,s-L t D$P\$($L$ D$uD$L$T$롋D$ H,P.\$Ӎ @/T$LtD$,D$0É\$ k0l)Mt L$1Ke D$,D$0Ée D$,D$0Í$D$!蒽 -&e ;a D$({qL$$Y [\$hl$l$,,$2֋D$L$(YʉٽM!l$$u0J zt)j!7,7MsD$B 8uT$\$$k,s-L t L$D$P\$,$L$*D$uD$L$T$띋D$$H,P.\$Ӎ @/T$LtL$L$0D$4 É\$$k0l)Mt L$1DD$0D$4 ÉD$0D$4 +Be ;aLD$TxHSL$PY [\$@hl$l$X,$2֋D$D$L$TYYY \$Pnt$Pt$l$\$0\$Pl$D|$8L$$D$= $D$% `p$D$˱ '?e ;a(D$0LBHQL$,Y [\$ hl$l$4,$2֋D$L$0YYYʉٽM!Z\$,k0J sD$}Eh4)8؇ul$s,{-LL$41D$ PL$4 $t$D$uD$L$$T$0\$,l$둋L$,Q-|$e Q,Y.l$ݍY/t$$|2tC e u*(D$0IHH(É1<ϋI$Q€uD$<$DD$$l$뫋D$<$B1<YQ ZÀID$D$$]DL$,.k0l)Mt L$$1uID$L$D$,$T$L$P D$L$T$0(Í$D$e $D$M V$Qe ;aZT$tuË\$-e l$ kS rC&5e B Cm(mtGjjm<j5e ECj5e ECe@1111B,7e@111Ή19JM!ʼnk J !ŃC$C C(Bu $ÍB$D${^\$މ뢍{:{ :@S$YD$x e T$u ‹\$9 ($e L$uT$J\$KT$z9{9{D$ s9{ g9!e ;a}H|$L_ kL\$4ol$,u o(ً__'\$_,vt$<nt$i0j l$L]\$TY,\\$X({K mR$D$  ۑ /e ;aL$QZY\$ 9vx؋T$Eii9tr0q6Nr9u3e u6AQte uBAAÍz1,y1,ʼn؉<Ge ;aL$Q Z=vY-Y,=wY-Y,8Y$+v#q/Yq.Jw q/4q.8؇ޕ"R [ ҅1Ӆtz1uu1uI1u$ $D$D$D$8D$ D$Íޭ$D$ƣ $$D$讣 臑 r$D$(菣 h ='$D$$p ~л$D$X ⣻$D$@ `$D$( g$D$ $D$1 e ;av8D$$D$D$D$ D$OD$ L$tD$$1e ;avBD$$L$L$L$L$D$ L$I$ $D$D$ D$,7e ;av# D$$D$D$D$D$ e ;av=`A$D$D$ L$ $L$L$D$]D$ D$e ;avD$$fe ;av D$D$>e ;avD$tD$D$e ;avD$@D$e ;a1 D$HHu`@ BBs)l$9utL$I.ʍD(D$ ËL$Q0TtH1뷍e D$ ËL$Y [X\$\$$ӋD$L$YʉٽM!l$u0΋zJ tRt!77Jsrݍe D$ Í$D$!k te ;a@ D$HHuj@ GBs.l$9utL$I.ʍD(D$D$  ËL$Q0TtH1벍e D$D$ ËL$Y [X\$\$$ӋD$L$YʉٽM!l$u0΋zJ tRt!77Jsmݍe D$D$ Í$D$! e ;a4D$<H|L$8Y [X\$\$@$ӋD$D$L$<YYY T$8@t$ D$D$D$sX4u uډىԉލ\l$@9tl$<J.L$<QD0(QD$D4É؍\3tD$D$$1D$D$$||$L$,D$0]]Cu<@9tT$l$wD$1U0Е4T$l8l4Et8\5_ [Àe \<-e 1u`3G$L@L$$D$(D$D$L8AL8L<LL$\$sσƍL\$@T$DQMAM,$T$D$0D$D$ T$8l$<1뢉1\$$l$\$D$T$8\$l$<0D$8H( $茼e L$uD$ Ge ;aV8D$@-HL$$D$ !ĉ$J> !Z4Y?k !͉蕀 ! ! Ћ$r1^2 e ;avD$ $D$D$e ;a0 d T$$ t X 9,t H<uD$0D$4D$8 Ë e uD$0D$4D$8 ÉD$uu$D$_~D$$$D$+}6vD$H<ruѻ$D$~vD$H !݉T$0D$4l$8 )ڋh@9r,H> !p4H? !T110e@ƀB$D$>i d tRL$ QsdDtD$D$T$D$ D$D$D$D$ D$D$D$D$ T ̋D$L$ȋL$ʉl$9vOE)T$ L d t-sBt%ЁD$\$L$ T$$11ЉD$\$D$ D$ t$$AT e ;avq$D$4@T$()T$89vPD$8$T$,T$T$0T$L$ D$ D$L$T$ \$\$91D$lt$h\$D$r@ $L$d*l$`$9Z$1D$@$$L$x1ɉL$0$L$xKG$ !ыT$0 ʋ$A$D$@$T$0D$lL$d$|$@9r|- l$H|$0 |$0 !NjD$0 Ǎ, D$lL$d vۋl$HЕۉ؉1fՉȉѻ !K!11ۉͅ2Bl$H|$\$l$`9*$}h$9I)؉ˉ !ōE !$9BSB9v1ۃ9 ؈D$hL$D9@d L$l$‰l$L$l$$\$L$D$ D$ $L$$T$T$d\$$\$(l$l$X$4$$t$\$<\$^l$LD$()ŋ$L$<4$$L$d\$X$$?*> sHCs!F$ʉ $)ЉD$Ĭ9uۉ$\$L$D$ $9tB1밉$\$L$D$ D$L$\$T$$냉뇋$1111D$hL$D95ƉЉډ ‰ˉ$l$4$qGL$\D$pD$,D$p27D$\؉l$,$΋L$\$l$4t$8D$P t$,9D$P9tUt$8sE ! B$à l$,wT$49aƉŅtKL$8 ! ЋT$H4s$ ! ؍Z녍L$t$8s(\$\ ! ËD$H,M؉Ӌ$뼉ËD$HW($1x$}D$d$|ȋ|$0XsN)$\ȋ$110ȋ$1111BT$<$L$\$l$ D$$D$$D$$L$ wD$hL$D9ȋ$Ջ$S$uP$u+E3 !!¸! ЈEĬE ! ЈE$U3 !އӇ! ! EĬÉ؉1111o$D$!mT ,$bD$D$TL$$ ^ $D$f$$D$TD$nf_T^$D$-S A A te ;a@L$XT$\9|$1*ЋL$X1\$T)مHD$0D$IρɀLCr (rz(jLK(SD A΀D Aށr (r(D AH D A=r (r(D A(\$D D$D$D$d$D$DD$D$ MD$XL$L$TL$Dȉ$T$`)L$@ù1D$d$D$D$DD$D$ D$T$T9uC= = = = = = = = ? L$p[$D$+cD$$D$`Z$D$cD$T$D$`7][Η$D$+D$ ËD$H $L$L$^D$H $L$L$L y$D$L@ S$D$4@ =e ;a D$$@C ^  ^ CT$D$L$ d $T$fD$ ND$ L$1T$ tjJ JPd J t@T$$l$L$D$ T$D$D$( 1111D$( , * ̃($D$,D$D$D$ "D$D$D$L$tz t? t D$4(bH6$D$;PH$ƉL$ 0H$D$PH$L$ 닉D$$D$0$D$,D$D$$D$4(e ;a+D$%\$,Tt 9u[t9u1ȋe J$\$D$É$D$ D$L$\$뭉T$ D$$D$ D$D$L$T$ \$p$D$@D$L$\$S1.1Nϻ$D$< ڬe ;av@ D$T$%9r Éʉ $)ЉD$D$ỹD$$D$D$D$ $D$D$e ;av; D$$$D$(D$D$D$ 2D$D$ e ;avW D$$$D$(D$D$D$ "D$D$D$L$t D$, ÉD$, re ;a D$,$D$(D$D$$$L$(L$D$D$ 2D$D$D$L$ t(T$$9uu Í׽$D$0: " $D$: 轪He ;ae e $Mud t@=ud $D$8e D$mD$ ud ud ud ud `e uT1 -`e \B=}<)ʍ )˃ ^ rud H ud ud Hud ud HD$L$H $D$D$L$|e \l tunT$ TT$$Te u1T$(TT$,T T$Te e $MÉߋD$(qD$,fD$[ĉ‹D$ N$ $ e3$D$8 蟨e ;avae $Ke tAe t2e e ud D$ e $!MD$D$ 11e ;avPe tÍe $D$D$D$ t$@WD$P詧e ;aD11ɉL$,D$e $Jud ud uXe e u4ud e e $fD$D$xSD$L$,닍=ud 胾ʼnD$0e $KD$,L$T$0D$@$L$$L$:D$0L$,T$\$$‹l$@L$D$,&st$$\\$ tt$9L$LjD$,@LiWl E5e .(l$<5e hl$8lhq(e LL$$D$L$L$ L$e D$ L$0|e \l uDDD 111D$OӇ!|$<79|݉t$4|$X1< D$XD$tD$\D$|D$`D$4D$dD$DD$hD$LD$lD$X$0pú$ktPuBk(D$tD$T$$.AD$tD$LL$H\$DT$L$?D$u!D$DH T$LZ 9uyЋL$H\$D|D$L$w?D$tˋT$LP$#D$PD$T; D$PD$tD$TD$P$ApËD$Lp $>D$D$@L$L$8T$H$e>D$L$$=T$D$"T$@T$ T$8T$ZT$D$L$D$ 蕦D$$L$($L$/   $=D$D$8L$L$@T$H$=D$L$$=T$D$"T$@T$ T$8T$ZT$D$L$D$ D$(L$$ $D$/ $_=D$D$@L$L$8T$H$C=D$L$$=T$D$"T$@T$ T$8T$ZT$D$L$D$ D$$D$(D$,L$0$L$}. $<D$L$$UT$D$)L$ D$D$D$裤D$ L$ $D$. VR$D$A. V$D$4- h$D$- $<D$L$$oT$D$(L$ D$3JD$D$ D$ L$ $D$y- $D$+a- je ;aD$X t2 H HH u\$ É\$D$$覺\$X9r@HPuPP+PPL$ ÉL$X$L$ӋD$L$ʋHL$$@D$^`D$ L$AA@36$D$4>6o $D$B, Ke ;a4d f ^ ^ $L$hD$ X f ^$AgD$ L$ f f (#ld pd 薛Qe ;avrԪ$D$D$ L$ufofu Qft- $D$D$L$ tD$D$dD$re ;avV$D$uD$D$ $ $VL$WD$ $D$pf 蓚e ;a d $=e D$L$ }L$ e  $ ȉD$D$dD$ JhD$L$ ^ ^ f $D d $>D$ | D$D$$Íd $tD$$豙̃e $D$ D$e u'e te e e ;aPL$TAAA AAAAA A$A(A,f f -^ 9Çދ=^ 9Ç!9Ç f D$4 e -f l$0$щL$D$dD$ vfL$T$4ыT$ He L$0щ Le e }He Le f  Le He f 9هÇ9!9 ͕t He Le e * PYD$8 hX $bD$ L$T$TJ8B< $D$/cD$L$8^\ȍf.`f.WD$T@P 0d 4d 1,,Dž@ DžD DžH DžL C9|Љ${e PËD$T@@D$H f L$4f T$0d \$,-d l$(5Le t$$=He |$ p㉵9|B4d -0d 9slTZzR0te[9u1UËZht9u1CeCуÃÃà Ӌe ;a$e D$,P z$o'D$YD$(H8 $ UUD$t]D$,ǀT P D$ $D$D$oP(Je u D$ D$0$ËD$ $D$ދD$(@PWf.uU$ e )ȋL$e х…!Ӆ ڄuD$,ǀT SD$L$D$,H L $T$0VD$D$D$$D$D$VD$L$^ȋD$(@Pf.vD$0$D$0$D$0$D$0$Í$D$6 e ;a$2$ e )ȋL$e مÅÇ!ɇÇ ޖt D$($ÉL$D$e@@pX )ʋH t$L \ $)ŋD$t$TD$D$D$$D$D$TD$ Y e T$^f.D$($ˆe ;axWL$|f.0W f e D$DL$@ f f e He Le (Je e c4d t d xÍf $hD$D$0L$@)ˁl$l$4)‹T$DÁ Ç!ޅ ޖt 1҉L$8T$<xd $D$ pd )T$td ӅۇÇ݅ɇÇ!ۇÇ tWd 2T$$D$ $\$RD$D$pD$8$D$ $$$$$uDŽ$DŽ$@> $$$$$zu$@ƀ$$D$D$;(Je L $ǁe  ǁe / $$a茙$D$TL$L$X舿$ʚ;ቔ$$L$L$@ȉD$$-ܬd t$T)t$|Ԭd ދL$L$4جd d 5Ԭd )l$X͋L$|Չ-جd 5̬d =Ьd Pe $D$L$4iʚ;$ыT$@$щL$(L$հf $D$TD$L$XL$跰`f % `e  جd Ԭd H`f % `e L$$L$(HXe Ԭd \e جd Xe Љ\e d d $)ȋd \$xՉ㉔$D$0=e |$|e T$tT$p=e $׉|$`̬d $ Ĭd $)ʉ$㉔$D$\T$0׉$lj|$ld $$=d d e $ e $ e $ Ьd $ Ȭd $ d d $)׋D$x$$l$tt$|$$$|$p$$$$)$$؋$$\$`t$0Ջ$|$\ŋ$D$l d  d D$|\$T)É\$t=e |$xT$p$5d $D$,5d $5d $$$L$ >D$$D$,$D$TL$|)ȋD$X$ȋL$xT$tʋT$pȋ$$ы$L$=D$$^ hf ܝd d d t df @df d $`f @`f d $kd d $`V$=pXw|V$%pe Yhf $$1芉  d `e )ыd de $ډT$D$@BD$ ?L$T$T$ L$$ $D$D$D$ `f L$|T$ \$l$$@4$l$\$T$ wL$$T$$   $D$zL$| $D$ f $D$P$ $$L$6 П $D$ $,ȉ $L$T ס $D$  d L$<d $1 d d $$ Ȭd Ĭd $$ Ьd ̬d $$1ɋ\$<)Ս$ $D$D$l$ މt$D$L$T$$ $L$T$D$ `vD$$L$$u$$$D$D$hH1T$H\$P}^L$hut$Pml$H=T$8\$< $D$wT$8\$څt&Z-e u Bz1;tԋe u@}sH Шd 벍<1tݍ̨d $eÍ=Ȩd 1s\! J\e ;aeD$HƁe uAD$HQp` L$Pd tw $D$'D$$;Y8d $]D$D$ Hd $D$?D$L$ I9tD$@ƀÍLd $"މ $D$ 'I[e ;avXeH s" 9uÍ.Լ$D$  T|$D$ Ze ;a8 D$(HT$8)щL$T$4l$0DD$L$0 $L$4L$D$ D$ (T$l$D$L$D$(L$\$\$ Çޅ҇Ç!҇Ç t^l$0T$4,$T$D$ D$ (D$0L$T$(9sl\$$ Al$9E9sKD.A49}09s,L$$T$,)ډ!щL$<)؉D$@l$D R K D mYe ;a(D$<T$8!˅ ˄$D$D$D$ 4'D$L$…!ڄ-T$$ $D$D$ D$ &D$L$T$$JÃdÇ!݅ ݕu\$,$\$0\$\$4\$L$ D$T$D$L$T$ D$@L$DT$H(ËD$0D$,0D$@D$DD$4D$H(É$D$D$@BD$ ;&D$L$L$ D$D$,$D$0D$D$4D$D$D$L$ T$D$@T$DL$H( WJe ;atD$$HT$ 1;։ډt:S 9sv S։ډ܋S9s ؉ډÉ S؉T$ t$ e $踹D$D$@@@@ @L$$QP eR1111މT5PHL$HL$ L$ T$\$ ЉًPt@Zh9v6X[h 9uEZ9t9u T$ $N뻉T$ $뭃Í$D$! l$ͻ$D$3D$$Z$D$D$$D$D$@D$HL$L2H$D$D$$z$D$D$$D$v;$D$"  8¼$D$ Ule ;aD$HIP 9L$ T$\$ Љًt/tXt[R9s $D$K͉ $D$뿋XtƋPtPJ9uAB@@ e  e + e e e  e 붍I_$D$' Te ;avu D$T$t@YtEi 9s \$it u 9rԉ$L$D$D$ D$ Í$D$![ dSoe ;avRD$HT$ k9t+s 9sv[9sÉvC$\$Re ;aD$ $L$$L$T$(T$\$,\$ l$0l$cvD$D$L$ Q$T$$T$\$(\$l$,l$ t$0t$|D$D$D$L$ $L$$L$L$(L$L$,L$ L$0L$BD$D$D$4D$4Re ;avuD$PXi1AH1tNXtC(tEQtZ9uJË9u D$ h$D$[ dQoe ;avrD$HPi1tMHptFtCQtZ9uJË9u D$  $D$ Pre ;a| e [e Td Xd \d hd urq$L$1B9}$kD+k@Xd 9~߉-Xd oq$L$1B9}$kL+kH\d 9~߉-\d hd tm`d dd e 50d Td Xd \d `d dd 4d Íe $菉D$dd 뱋0d  Hd $$GD$`d e $LD$dd kTd )Ode ;a 0d 4d 9e $e uoe ~e1@ $d  d 9}>D$ QhtQiu҉L$ $D$uD$ 뷋L$Ee $_ 1@ dd 9}ߋ d $d 9s Qhu  L$ $D$HTL$PPT$\$\$hhD$ piD$ $D$#D$$Ǻ$D$D$$D$D$=$D$D$$D$8$D$ D$ $pI$D$ D$ $Mce $~$D$  D$L$D$$D$E$D$D$$D$ѻ$D$M$D$z L^e ;a@Td HXd \Ћ\d lЋ`d tЋdd DT$Hr9P9w99w9Zu_hd uPud DD$(H $聅D$L$(Q`e \$$D$D$DD$ bD$(u@Ãuhd uV$VJ9w999$d d )9D$$$ D$ukD$$H\P`…!ʄt @d (É$T$e YD$$FD$ L$e $L$D$Xt몍 d 1ɉ d 끉bˉЉYˉЉLe $D$,D$D$0D$t(9e $|;A $HitÉ$D$$$D$%le $9Jt] hd J(|$81 QDŽ$DŽ$DŽ$ B $L$8$$ $$D$D$T$ D$D$D$$L$D$ D$$覟$ $$T$D$$AiÍB( ^ L$$D$$ D$ $$F2$uMH~u7Í?$D$r }-$D$Z $$$HTL$4PPT$0\$\$,F$D$ a$$ݺ$D$<D$0$D$4D$x$D$D$,$D$7$D$ $$ $HTL$4PPT$0\$\$,F$D$ $$Fݺ$D$pD$0$D$4D$$D$FD$,$D$Rڼ$D$  $$A$HPL$0PTT$4\$\$,ON $D$$$zݺ$D$D$0$D$4D$$D$zD$,$D$FLz $D$ 8Ze ;a$D$($L$,L$D$1D$L$T$ \$,$ËL$(I $D$\$D$0D$ @؉D$\$ D$(X)Ӊ$T$L$L$0L$ D$\$ C4Ne ;a9\e e@@hL$`QYl$dց ߃rD$L,WD$XD$LD$TT$\$ t$8|$4 0d 4d 9L$Tȋ\$ l$dt$8|$4t He0d $D$mD$H 4d 9L$` $D$T$Xu D$d됋$uD$dT$XrD$8L$4T$`ZjÇޅۇÇ!Ç u\ÉD$L$\$l$e $lD$duD$`@@뿋D$`HT$)ыP $L$ʉT$\ȋD$dL$`T$T\$4l$8t$ |$|$TȋL$`׋T$TމӋT$Tt Re|$t$ l$\$d 5īd …Ç!֖&r 1҅{$L$AD$`HPÁÇ!҇Ç uL$dT$\$ l$t$L$T$e $okD$dL$T$\$`kt$)kCC|$ Ç݅!Ç ݕtwƠ\$XuD$`͋L$d׉yL$0T$,|$(t$$$uD$dL$0T$,\$Xt$$|$(묋D$0L$,n\$X딋D$`HT$)ыP $L$ʉT$/D$d11 + $,T$D$dL$`\$l$|$O~z T |$(1! $v,T$D$dL$`\$l$|$ $1.D$dL$`\$l$|$tD$<(WD$XD$H:L$$PPT$ X@\$h l$ 豻$D$ +D$ $D$$D$ D$ $D$I$D$ D$$$D$8$D$ D$$D$$D$ nD$(HQ  $ D$HQ  $D$@HP ÅɇÇ ݕuHHPÅɇÇ uÉL$T$e $ȫd ̫d d $d D$q&d $Ívg$D$( ]e ;ad $e td $衝D$Íd d tD$D$C D$D$D$D$$Jd D$ d $BD$ D$<Ge ;aD$D$D$D$ $ 9 I@"L$ D$D$D$ $ @e L$HD$D$D$ L$T$ T$ ~#l$99t,$\$T$D$  $l$t$|$ $u2 $Y|V9wR 9s;T$$É$\$@e D$NJD$ 믉Q@rr ks 7Ƽ$D$s |G̋d L$t@ tP 9sD$Pf@4@?f@6L$ P\$$ڋTPTT$) e e e e d P@ыd d d d d d d f $ \$D$&D$Hs$T$  $D$wD$L$ [L$ $D$TɃCs\ ^ JP@ I@!_ , ݈X>lSfh4L H?LSfH6EMDD$ if hw$D$qz ze ;a D$|$ 1 pD L$ L$$L$L$(L$L$,L$L$-L$L$L$L$ $L$tD$.tA=uD$@=D$D$0 ËA I D$ $bFe ;a D$$詌D$$L$L$L$ L$D$ D$tR@<@f@8@:@@@H H HP e P )ыe e e D$$D$D$$=e ;avsD$ T$ $ \$t$1T$z$9s#|$uՋ   Vqe ;a[D$ L$$A*\lmt։l$$l$D$H<HT$$9D$XLH9ww@D@HH \$ $L$T$D$ D$(T$$ ыXXe )Ћ e e e D$HD$,ËD$ P, $ID$L$$ \$K k@@H )Չh@8@@@<@D@H@L@T@X@=@@(@,SL$ Ep NlE  Ep lE  Ep p VT S=P=C<@<SDkHT$ l$ $D$fD$D$@<T$$+ P L$$9e L$QL )Ћe e e ALȋT$$$T$D$D$ $L$$L$D$u D$,ËD$ $L$$L$vD$MD$,Í*X$D$ u ꡼$D$t k$D$"t ` e ;av* D$$D$D$谐D$D$ e ;a,D$0$L$4 L$L$LD$L$ *D$$L$D$0P, $FD$D$(L$$@@H L$ H@8@@@<@D@H@L@T@X@=@@(@,HP L$L$0 $T$D$ D$0L$L$(Q0$D$(@<L$0PXӋTPT $D$fD$D$ D$D$8,Ëe D$ e L$|o$D$(#D$$D$/MJ$D$ D$ $D$D$$D$ τ|D$8,|e ;avUD$D$D$ D$D D$D$D$D$D$ D$ D$D$$e ;a D$@=L$ $D$ T$Z )ًXXe J ȋ e e e D$$T$fD$D$ D$D$$N%Pe ;aD$$H<}H8fL$ fP0\$ 9uPP)ыTPTL$(t# e P )ыe e e L$)t# e P ыe e e @<Ht$H $D$( D$,L$$ADT$0QH!„_ALA d H5 P<P Q QPQPLQLQ=X= ӈY=T$ h D$ X $D$*D$@<L$ P,h,+P,h,\,\,D$$P P -d ET j<jXXLZLXLX=j= ݈݇X=݋ h h T$M Z$T$3D$@<L$ P,h,+P,h,\,\,D$$Pr $D$茆ÄL $D$v D$T$|1L $D$iL$ 1ND$ $T$$JDBHE?H8f\$ H0L$T$ T$X \$ wXt$D$D$$$GZ$D$qD$ $D$=~8$D$ GD$ $D$O|$D$ D$$D$%|$D$~D$$D${fxv $D$#kl u$D$)Sl u$D$);l De ;a D$@HDT$)ʋHH\$ˋL$9T$ 9ӇÇ!9 HLP9 X ڋ-e \+uӇ!!9vb) )΁ vtAt$ e -e e -e PL$L$0-D$D$$ D$$ D$$ É11e ;a8D$L$ T$\$(l$$1|$ L$T$xD)xH99هÇ!9 uËHLP9t x e |kӇ!!9w \$(l$$뀉t$) )́ vu \$(l$$ZD$l$ e e e e PL<$L$+D$ L$4D$\$(l$$끉t$,D$,e ;aWLeD$HHBL$P $|D$dL$`T$\\$Xl$P11Ft$|<$\$T$L$ D$D$pD$L$<D$dL$`T$\\$Xl$P|$}r4$\$T$L$ D$D$D$DL$P $}D$H@ID$DL$ȋ e e D$@ e L$<)ȉD$8e \$4-e l$05e t$,=e |$(e D$$ e L$ q$D$^zD$T$D$x$D$ 5zD$0L$4 $T$4w$D$yD$(L$, $T$vݺ$D$yD$@T$$ ‰$\$v9$D$ yD$<T$ ‰$\$v{9$D$ YyD$@L$<)ȋD$$L$ ȋL$8 ȉ$T$HvǺ$D$ypLÉD$pp$D$xD$T$D$'w$D$xD$$D$uH$D$ xpR >e ;a?D$HT$9uB 9u3 J9uHJ@@ËPQދHȉL$HL$PT$ _o$D$-wD$$D$t%Ⱥ$D$wD$$cwȺ$D$wD$ $Aw;)$D$ kwD$$wȺ$D$IwD$$vp#o$D$d e ;avD$D$e ;aD$L$u-Pu&PuL$t BHÉAHL$ PT$m$D$!cvD$$voD$$voD$ $uoD$$uo n$D$c e ;aD$L$u/Pu(Pu!L$QPQt AHÉHL$ PT$l;$D$%quD$$%unD$$unD$ $unD$$tnmֻ$D$b e ;avKD$t@T$Q u tX XY @ËHJ^e ;aiD$ $D$6D$e QCIL$$/D$ L$+A D$ T$$Z\$ iTl$,$tD$XL$ T$ ؋t"k9u s8tg9r uk8s֋L$$fQD$$_veL$ZuHet@D$(ËD$$veL$ZuHet@D$(Í<$D$` we ;aMD$ $D$D$e QCIL$$蟺D$ L$+A D$QTT$$asD$XL$T$$؋tfk9uk8•u\$ D$$teL$ZuHet@D$ D$(ËD$$teL$ZuHet@D$(Íټ$D$ O_ Xe ;a($ e $Ir e $1D$D$$ $ e $sD$$@x e L$0H|$ L$4H e rL$8HL$ 7Ƽ$D$R Xe ;avDD$L$9u+T$\$1E9}49s<9tD$D$D$L> ue ;avK$e $meHe @R) He Le $e $ge ;av<$e $dLe t$e $fLe e ;aHe D$ ud oL$ $9D$T$R)DDADADA DDDDD$ HЅuTe ;a$e $cHe D$ ud tL$ ${D$L$QøR)D+D+CD+CD+C D+D+D+D+D$ @D$u$e $!e(3e D$;A^|$$1U$L$$L$D$ D$ NL$L$$e $bL$ $$D$T$$T$L$ D$ D$D$$ He L$ $)D$L$ ¸R)D @D D $ЉD $e $cDŽ$DŽ$DŽ$F $$$$$$$薽Ĵz; 裾~e ;avp $e $aHe D$L$ $'D$L$A¸R)D @D D T$ЉD $e $c te ;avyD$T$!م ˄tO1ɉD$L$$L$QD$uËD$$D$D$D$@D$D$ ?ՉЋL$pke ;a(e $D$L$…!څ ӄt D$$ËT$ 9Ël$9Ç!9 ޖu D$$eR1111މT5$D$D$L$ HD$L$T$ 9Ël$9!9 ClSe D$;Ahe $|$ 1a$QRht9$$D$ D$D$ D$ JD$D$ $e $^D$ $ $D$L$ L$D$ D$ D$D$$$sD$PP$$PD$H$ыP H$щH $e $_ĨÉ$$D$D$ D$D$ D$ nJD$7 蹺te ;a D$ T$!˅ ل11ɉD$L$ Pe $D$L$…!Ӆ ӄueR1111މT5$D$L$D$ 蜊D$L$!tD$$D$ D$D$$@D$D$ __ЋL$ 芹e ;a0L$@D$T$8u D$D$D0Ue|$ 1 PF L$ L$4L$T$L$D$ tP$D$Í辺$D$ce ;aC D$$f. Xf.Wf.f.u z f.D$D$D$D$D$+f.^f.vD$-11$,эZ0l$\)A*\Yȃ} QrdL$L$D$.fD$e+}D$-؉D$ QL$ )ʃ0T$)iɚ )ʍJ0L$L)ˍK0L$L$ $D$D$ vD$-f1@^f.sHYf.w1A^Ѓ|Xf.rH^ʉX$D$ Í8$D$ W $D$  2ae ;av] $D$0D$ $PD$$@l$D$`e ;a |$1xc$$)$D$D$ D$ x.D$HT$L$D$$$ $T$D$ D$ .D$0L$dsqD $‹$ Ç!Ç ՕYdw-A؉!D $T$T$&ĀÉV O x_e ;avi D$T$!م ˄u$D$ 1)ЉD$  $D$N1L$)ȸL$ȋT$^{e ;ap|$ 1#wL$xT$tcH ~;Ӄ-TdstT ƒÇ!ɇÇ ֖tHds?D xHds+D 0؉!D $T$T$p   ^!e ;avD$ $D$]e ;av[ D$$D$ D$(D$D$D$D$D$ D$D$D$L$L$T$$D$L$ N]e ;aD$D$ L$L$0$D$$D$ Ie ;a$D$D$ ~$D$dD$Ae 1@ ud e T uD$1 T$JD$9L$ud e T D$$,]D$D$D$ L$L$D$ T$ }1t $YD$L$  ȉ$T$we e e e e e e e he e $É$+D$D$ jD$ L$[1111x AH\e ;a,eD$d ' L$$ \WL$(L$( \W ,e k*"D$H $\7iRD$H $ND$@HD@H @e De Pkf!j$L$hd ld e D$ b $D$ ID$L$ $L$ZD$L$ $oD$ e ~Ne e  4d L$0d T$ 1$D$ x $蠜D$@L$T$ 9|؋ ͧ$D$ C\e ;aeH 9\pd $d d Ӄ99ڇÇ!9 LD$HxX| d d d d D$Hxiɕd5_V$L$ …u ǁ $D$H,t pQ e ud up ud $D$,pd $e uÍ$qe L$u D$ԋT$YY냋D$$L$D$ D$ ql$D$ Be ;a5(Je D$$<eHT$CD$ D$$D$D$D$ HIp $L$L$L$L$d $zD$u4D$ HJHuHet@Íd $zD$ud+믋D$$L$L$D$$$$D$ @e ;av`pd $e e 9~; ~2 xd A9~L$pd $&D$D$ Éމω@e ;avg pd $ e e 9~B ~9 D$ xd L$pd $D$@L$)D$ Éȉ?e ;a8eD$ pd $xD$L$18T$ \$@4$D$ PD$XD$L$9-4d 50d 9,qm49uC-td t5td 5xd N5xd tW54d =0d 9s:up4up54d =0d 9<pd $c: 3 $D$;  =>e ;a e $D$qy1$`D$@}1D$d d $D$3y螀$u$_腀$_ =[̃D$ H$wD$D$e ;aD$%T$9t 1t,ËD$XH$L$T$vD$ L$T$]$D$'D$$$D$ D$$D$$D$ D$$D$CD$$BJ$D$4< ֛$D$+oD$$#$D$ MD$$D$$D$ #D$$D$D$$$D$7 ;7e ;aD$Hw5 T$9u&D$H$L$T$uD$ D$ $D$![D$$D$'^$D$1D$$D$ $D$ :!̃a`\$ \$L$D‹D$@"\$l$wL$@^D$HuD$@@ipd $D$ L$T$шD$ tQQ Y0T$t/A0kt5CtKt$7D$ $L$P1S$D$ L$L$T$$d $iD$ueD$ uDD$HJHuHet@D$ D$(D$D$, ÍV$D$뤍d $biD$u%{{[d d $>v$ID$$)#<$D$%2 ;/̃ eL$u(PT$uD$ T$P\$)ځpHH D$$Z e ;a eH 9D$D$ $D$D$4,D$H d 9tbHIduFHu(9u ) ËAt$`D$@@tǁˋЋD$ d 3D$ d 덍ƻ$D$ -e ;av4e t e t $e , u-e ;a e@D$ d 9}P D$H,6pd $.D$ ud "9ue L$typd $|`pd $d  d d d bpd $hD$t ËD$$M Í $D$ge d uD$d LT$C=d }C)ω‰mCA $D$L˻$D$誻 s_pd $d  d d d apd $_D$$$D$6 ?+e ;a p0eHBe IIp@D$$L$,pd $d  e I d e D$4d 4d L$0d T$(\$,1E9}949tl$$D$eD$4L$T$(\$,l$md L$A tID$ $D$D$cD$ tʋD$$T$4 ыd Hd 묋d D$ pd $D$,$T$4Ћ4d D$ 0d L$(1B9ku싳uT$\$ C$l$D$3cD$ uD$L$(T$(Je u$D$ HAH$D$L$(T$|D$ $D$ $ŀ‹D$d 0d 4d 1B9}tpd $e uPd pd $eL$$ZuHet@0Í=d 1?$kd $D$D$D$ tԍd d =d D$4w?WS$D$̷ $D$贷 $D$"蜷 u+pe ;ae@@pD$ $D$D$ aD$ tUd D$$Ѝpd $Hd H d tpd $Íd $ރ&De ;a6eD$HBHIp d pd $d 1Ѕt`t+e u֍É=ÉD$L$I$L$ D$D$똋e A d pd $۹$D$ e L$ HdD$ $e $8e L$uvD$ e uXAL$QRp\$9t4QKQuQetAD$$XD$ L$뽍y<롋|$ <$ 7e L$u D$ \|$ W<JxdD$ B<=d .<D$$VD$$̃e te $JD$D$ e I e $D$$5D$ $6eL$HL$pH"^D$@h$D$D$d $D$I^ËLc Hc v%L$$D$1E$D+ e ;avme $D$5^D$v$D$1L$ LD$ HD$9r$D$D$$D$u"we ;a$$D$D$D$$o5D$D$ L$ VL$ L$  VAH HH@0‰B$B Be ;ae@D$Hh $D$D$d $D$B[D$HHPDT$ L$V$]D$ e A e L$$.3D$$D$L$ $D$  1D$ e $YD$D$u=L$u4D$t$A봍e $D$YZՍe $D$YD$ uWWD$eD$D$ ËWWD$à D$D$e $D$D$?Y e ;aD$$L$L$D$HtL$Ht De @e PDHHe t ItD$ `uu $Í e $0e tR$e L$ $e $e (e u e $%(e ,e $׍$D$* e ;a e D$D$D$nd D$D$$L$LD$D$ WD$D$WD$ e $nd $D$D$/ e $s Í e $D$$$ e $G Í=$D$ݬ e ;avH0e $D$D$}VD$ txW$D$~Ãe ;apd $id @d GRpd $L$ǀ$D$u܍ e $$e t"D$$e e $D$(e ,e ,e e $,e $ e $裾|e ;a? eHQpD$-ԾD$HǁHǁHAppd $D$H $ipd $豿D$H $*D$HǁHgAt$eLD$@@t Íik$D$= e$D$% λ$D$  e ;ave@ƀe ;apd $ɼD$D$ td L$ttd xd Jxd pd $TD$tfHtL$u#HtL$ Ht$ھËD$ $ jD$t}D$L$D$tV$D$ D$1ji$"pd $衽D$uÍd $D$>SD$}HwI$D$^ V$D$F $D$. m$D$ Je ;aiD$$hD$t d tD$$D$Ëe d $WQD$D$ d $AQD$D$pd $蓺d tAD$@d H d tpd $,Íd $ދD$ d uz d e J9t$gpd $ӻÍhd $QRD$L$ uD$뺍pd $蕻D$$D$Ípd $rD$$D$Í $D$D$PD$ u D$)d D$$ ыd H d t D$d $d $D$D$OD$ SD$$D$ËD$$裱D$D$$D$we ;avCd $D$D$OD$ t$D$cÃ&e ;a* eH9D$Ip$pJD$H $'D$HǁH $D$%u3D$HIt $MFD$@@t H1p@)$D$9aLD$$I$D$ 0$D$!ң e ;a eL$@9tYAtu:L$$2I=GD$Ht $Ht$! Í$D$2  [$D$ #Ne ;ae d @u`F$D$ pd $ԵD$ @d H d tpd $wÍd $0ƀd $D$MD$wp|$D$ e$D$ e ;a"eD$ L$ $D$D$ D$@\@`@epHL$L$ Qe Bhe YujXId 9uF (Je tH8tHlunD$$aËHtPp$L$sԉ$D$묍x‰o(뉍zhc(lL$ QRpZCZ<e ;a8 `eD$X1T$4\$l$\ڋ\$,l$09twd ud4d 0d l$49D$ $D$fD$ uL$,AL$,D$4D$8L$0uD$dD$h`ËD$X BT$Xe[11117-@d 5Dd =Hd D$1؉1D$,l$0\$4T$8T$\$$KD$XT$\$9}PL$$D$L$`D$u̍pd $"_$D$P pd $سD$Pe ^$貪D$Epd $DZB_$tP D$T pd $kD$T$W@D$T$XL$TL$Te tP 4d D$ 0d L$Lpd $4d D$T d UA$L$T9: $]pd $課D$XHT$1eD$XHƁ d $D$%H;g$uD$Xwe $FD$v܍hd $D$D$QHD$ L$ ȄtD$XHQp1 $zD$D$D$XV$0D$4$D$8D$D$@I4ËP9r뽋P9 Je ;av>(Je u(Ve@@p$bX̃eHBH8T$9D$ @\@`HIpL$$D$ @p@t (Je L$ (D$ L$tPY9tgD$ $T$ JpBtBI\V$HD$ H@8HIpQBQ@jÉ뭋D$ H(Je tQp\$9tvW$:D$ HIpQBQ$D$D$聸D$ @8HJHet@@jËpH닉R9y녍}4$D$ 蹂 }4$D$ 衂 $D$-艂 ̃(e d HIpt QHQpǁHAp d u D$,(D$D$D$D$ D$$ PV L$L$L$T$ D$$D$$D$tD$,(ÉD$A$D$D$+D$ u D$E8D$,(ËHǁ@@pD$,(̃eHQpR4HQpZ0J0HQpR9t (Je u@@pHAHÉD$D$D$ V L$D$ L$ $D$e ;a pd $ɓDA$D$u0pd ${D$t$k"D$ D$ Íd $ *D$uD$봍d $D$+d $"Me ;a~eD$L$ $D$D$eHQhJ1ɉJHAh1Ahpd $讒)@$D$ L$AXd ZXˉJX d d d Bd pd $D$ u7D$@uD$$D$ډ$ D$$D$뮍d ˉ d hd $a(D$id $D$)d $A@wbe ;avIe@@hD$HBH $DD$@.̃ V$e ;avR e@@hD$pHHQDIH$L$脷D$@I w̃V$?̃e qe@HH@D$L$e e ;aM$ɬD$L$}D$ ÉD$ $yD$D$ D$D$ @W L$ D$D$D$L$ $kD$pH@ nỸ e L$|$1 W L$L$(L$ L$,L$L$$L$L$L$L$ L$L$ $ e ;a4eL$8PCT$@Z`D$ \$HIpL$( $ D$HD$$ۭD$D$L$Q)‰T$D$@AD$$$D$D$L$AA@D$,VD$0D$0V@A ȉH$L$$Hʋ\$8+p 1Ph e ]X(L$HL$D $e L$T$L$8 L$ Y[ht-e $D$D$@i$D$D$cD$(99!ʄ\$KPST (Je $\$D$?;d $1#D$u4D$ HJHuHet@4Íd $"D$ue t뤋D$$ED$(\$^`d $D$D$#D$ ʃ\$l$(Ѓڃd $D$/#G"T$x($T$D$L$T$ D$4L$0$#$XӉ\$Y\$l$ $\$\$(\$\$,\$|$81$ $D$T$8T$D$ dD$dIuD$ 3 $D$D$D$L$T$ ddD$$L$ $l$89t$l$\$$1$$L$ $L$$$$QPYT$$$ e ub$$($覤|$D$0GD$4Ge u$$Ë$#$$D$$L$닉111a :Ee ;a D$$苦D$tD$H)с2HXL$PXe @@|$d $豆D$ d A d  Ie YXuuQXu0d QXe u d 랍=d ‰닄d QXe u d k=d ‰gU|$‰S뀍d $豇 8$\$D$@@$D$dr m8e ;aL$  d tqe YXuQd Bd Jd QXQXe u뚋|$‰K뉍=d ‰8뢋 d t+e YXud 냍=d ‰md $aD$u1|$d td $_D$d u߅t&e BXu_HtT$ÉT$D$ D$W D$ T$D$ $T$pB7Ke ;ad $虃D$ d A d Ie YXuuQXu0d QXe u d 럍=d ‰댄d QXe u d l=d ‰PV‰:{d $蕄̃0e $/D$t_eH`B`@`tm e ;ave ;ave ;avce ;avCe ;av#e $0;AP$0d \e e IB$`Y$X91|$01$dMAhBh<7@8,$D$ $d1B } u @Ӊ\$,l$09t,$L$T$Q$dL$,PhZ@`d $$`D$D$0D$L$ D$@He@IPË$T$=D$$H U$L$L UAL$0$dt4$@U$D$DU@D$4u‰$8U$<$<U@D$4^ $T9v1$0 U$4$4 UA?4\$0\$$L$D$$`L$ D$D$@D$D$ D$$@L$($dӺ@P1$du1D$0D$$T$\$$\L$$`L$ D$D$@D$D$ D$$<@D$($daQ9$T$D$t$`$X$dt u؋$`$X$XPU T U S % \e u ÍD$UD$D$UD$D$L$$L$@D$`d $D$D$D$D$ Fe ;avG D$$D$t'@ Hw D$ à ttD$ D$ Be ;a pe L$tD$ (Je eu$L$ d d ۇÇ݅҇Ç "L$$)ЉD$Pt$ D$L d L$Hȋ d L$Dd L$Pщ)l$$\$Ll$H\$Dˉd  d 5d 4d T$t91A9w0d -4d 9L$<tSk4uщ\$Tu'u#e-m{k4$L$TA4D$ L$J 7J w|$D$?^ J J J $D$^ e ;avBD$$?e@L$I4(Je u$e ;aBeHQp T$Z0u)ju YpӉQpK0@C0CÅۉ\$t Kx[|ȉ11ɉD$L$ RT$fv$D$:oD$$D$Fl $D$oD$$D$ D$Lmo9$D$ nD$$D$k]hf#>$D$b\ 1$D$J\ Se ;a$eHQpL$ \$T$j0l$9u]j49uVjuN (Je u-HAp@ǀB0BT$($ÉD$$T#D$T$뽋B4D$JL$ 'eF$D$ mD$ $Um Ⱥ$D$mD$$3mȺ$D$]mD$$D$ij($D$ 3mD$$l)$D$ mD$$l)$D$ lD$ $D$iffdG$D$kZ +$D$SZ \e ;av8pd $MmD$|d pd $oe ;a 0e e e e 1 d d )ыxd )ы-|d )5d )9ve $tl11 T$ BЉL$ d $d 9}]xD$ L$( $bD$tD$뻋D$($}D$%PuD$@댋D$농e $mD$P $D$,D$D$D$,@X d tvQX‰AXd d d @d $ td ttd xd Jxd tTQtAt$m0Í d ‰d 낃0e t A1:0Ã0Í0@$D$W I@$D$W e@ǀ1$D$%\W $D$6DW L$$e $0lD$(HTL$ @PD$`6l$D$SiD$$D$ D$g($D$ )iD$$$D$5fb`$D$V ~B \$$T$ l$t$G`Ql$D$hD$ $D$fZ$D$hD$$D$fF$D$ohD$$$D$f*ݺ$D$FhD$$D$fa`$D$U e ;aPpd $hd @d pd $ije x^ ^ 1-1D$$L$ D$ $11111T$@\$DL$4D$8l$( L$4t$0D$8l$(|$,T$@'v'\$D$e d pd $gd $RD$9d $D$pd $bi^ ^ Љ˃ D$ 9‹t$$9އÇ!9 חƃ d $L$\$mpd $gd $D$Ad d 1ɉL$@D$Dpd $hD$DL$@L$@D$Dc  hd $D$D$S $D$V$$D$D$U $D$UD$D$D$HD$T$D$ UD$8$D$@D$S(OMD$`@ d $d 9 QjxR|l$DT$HD$`thsx[|t$8\$@$ $muD$$$Qdrлc҃c-d t^C뒽me $iWpd $[WĬÍpd $FWĬËd $ |d $d T$xd $K($D$ CT$$D$LQZ$D$T$$D$PR$D$ SD$x$D$'R9$D$ S$$D$P5MK$- - @e ;av1td L$td td xd @xd e ;ad  e Ãt؍H9؋L$~|9~x~)ȉd u d d D$PXd I3L$ d HX d L$ $D$D$D$ HD$ɉD$ É넉؉oD$ - e ;ave D$$D$t5d L$A d d d $D$5 Ía$D$#[? de ;av>d uD$ÉD$ H d d $D$D$ e ;aD$ $D$D$L$ T$$eD$D$L$$D$D$ L$ $7D$L$9uD$9uD$ D$ 1YTe ;aD$(D$ L$$L$T$$T$R*D$ tϋD$D$D$  $D$L$ )r% $T$T$D$\$ SD$tÉ؁T$  $@D$ÃËD$$rZe $h;Ar|$1󫋔$($$))$1,t$,A9rT$$\$D$D$ D$$ T$ 1sXtsX9sirpd $OD$L$ T$AXd tDkXESXd  d d Dd pd $PƄ$,Íd d Ƅ$,' $D$; 輫ge ;aD$ tQ,\$ )Ӌl$i$t+1t*9~))ˍE9D$ D$   2$D$ & :!$D$  Y $D$  $D$ $D$ $D$ 譺$D$ 䭺$D$~ ୺$D$f ܭ$D$N ح$D$6 ԭ$D$ 10$D$  ze ;a@e e r$D$D$L$ D$0L$D$4L$ $L$ T$D$ ݞD$11ɋT$ T$ D$0L$\$4$T$-l$D$ 蛞D$|L$ 9P9D$)щL$!ыT$4щL$,-D$}3=D$H $D$ D$t7eHZuHet@ ËD$$0$D$Hu $%먍$&D$l$D$ ʀe ;avo D$L$ T$\$11E9}FX4߉Ƌ$z|$$X߉aD$`|$$NjD$tIL$tuEe uD$3EDDW$D$fD$ D$ $$$L$L$T$pT$ L$L$D$tǀHDe @DR,t8B-e uBB4ۍz1hz41^e 2ǀ$T$p$$11D$D1@T$pL$D$|$x9 B9L$L IΉ$TfuL$D봉L$H\$\S kÅ!م لL$HlTD$HT$\$9ud$l$Ll$DL$xZ,\$d5e u2B,$!D$H$$\$d|$xL$Dr,1"Nj,$LfEM(Z rj$j tl e u-s^ BB $$l$D2Kω蟇x 蕇$1臇耇D$H|$x벋5e uOC e u$Y,B 낋$,ω11(D$HYs1D$H|$x뢅tre uRF  e u$q(B $(ω軆1貆D$H^ 1蛆D$H|$x럄$Y(9e uA(A,Y(߉1Py,H{EM Z rj$j t[ e us^ BB 3Kωx $1Ӆ̅D$H|$x5e uRC e u$Y$B $$ωw1nD$Hs1WD$H|$x럅tre uRF  e u$q BR$ ω1D$H)^ 1D$H|$x럄$Y 9e uA A$Y ߉1薄y$莄L$Hu $$$111=GfD$4$l$l$T$ l$l$D$fD$xT$D$1 $1M1$L$L$D$pD$ L$L$D$x1ɋT$D$L$$$1tmD24FE9}r$$‰΋D$L$F  $D$ $$D$D$L$pL$ D$D$O`p$D$ 0 ) "               j$e ;av D$$D$D$ je ;av D$$D$D$r ije ;avD$ $D$D$v-je ;av$ D$$D$D$D$ ie ;avD$$ie ;avMD$ HP  ʄu$D$D$|D$ $T$ JB Lie ;av D$$D$D$ ie ;a0eHIh9D$4$D$$D$ L$4@@ @@@$øi)L$D$<!(e ‹5,e Ç!ׅ 11tMTe Çߋ-Pe Ç! ŕt ҇Ç!ŕ\sSt$T$L$` e ,l$$` e L$l$$ET$,$ D$ ` e TT$($D$D$4$D$D$$$L$4L$T$ T$\$8\$ D$,$fD$D$vD$ H$uD$4$D$AD$ H PÅ҇Ç!݅ u $0ËD$)‰$D$L$D$表D$ ΋D$($D$7D$,$k yT$4$L$\$ yT$4$\$ CC D$HPÅɇÇ uPH$L$H$ e umL$H(E e uPE L$\$$؉ʋH(t4Y$h$9v*Y 9tY9uuL$$%ljL$$빃Ézw븍x(D$jw눉lj[wW׉ŋD$ Iwω1>w7wω0$D$D _e ;acL$ yQ\$$*׉ j9t9s ރىD$T$ZjÅÇ ݕ11r,i\$ l$t$D$ D$L$ \$ l$rt/tz t$v$9s $T$뾉 $T$밉j t‹j(M 9 e utE e u3B(BBB B$T$(\$,|$0ÍJ(ω1uz1uz1uz |u빍M ω1hu| e u EfMω1;uO-e u A91u' e (7J$N$ e B(F( e B F t e p( e BFt e u|p(N,tS e B0urxU()rXP׉Ɖr*S(qP ׉qD$V(׉qD$|$Q qx(‰qxqЋ|$jDλ$D$ Ye ;aD$H P(Xi q}׋e TM(e AH(p te F(e Xte C(e ury(tJW 9ue uO à pW9e uOփ~pʋT$ e uJ뵍z]p멍Q(׉ʼnKpxS(6pXP׉Ɖp*V( pQox(‰oz oЉU(׉oD$8$D$ X&e ;av& D$$D$蕒D$HD$ We ;a D$$HL$ $D$$HT$()ʅ$ e eJD$L$(H$@@ (e ,e !˅ ˄11ҋ\$$k5e EL$T$-e ɇÇޅ T$ucCD$$fD$D$D$uD$$ ËD$HT$)ыP $L$ʉT$D${ăm딍}m^-e uC L{ m?i $T$D$@@ ljmD$$ U$e ;aD$ $yD$D$L$ QT$$^D$L$9D$ HL$ $D$ H L$ e uz@ @$D$$ĐD$$8D$ $D$D$t*HL$e u @΍x1l뾃Íx 1plzhlyTe ;aD$ $YD$D$ L$ QT$$>D$L$ 9ED$ HL$ $D$ HL$$D$L$9D$$AD$襏D$ H T$1iˉi$9uQ-e umSL$tGD$$e uD$@$D$ËL$y1-kڋe uX몍xk랍{ʼnk놋-e uP tx ʼnjaD$$=ËD$$-Ã0S[e ;aD$ u *$D$$D$ $D$+$D$ $D$lƻ$D$q zRUe ;avuD$ $L$ D$>R̃ D$$D$D$D$D$ e ;a4D$8HQI@L$,}V$D$D$,$D$nD$8HQI4L$1d$D$D$$D$w"}D$8HQID$8HQI(L$$$D${D$$$D$GMD$8HQI,L$ ]$D$/D$ $D$D$8HQI0L$i!$D$D$$D$ZD$8HQILL$$D$D$$D$ciD$8HQITL$($D$KD$($D$D$8HQIPL$0}$D$D$0$D$uD$8HQIL$07$D$D$0$D$}(D$8@H@D$09$D$dD$0$D$064Me ;a D$$HQ0T$iEILL$T$T$,$L$D$ tOD$T$D$$PZJ0 L$ LWL$L$@H LWHL ËD$$AMLe ;aHeD$@D$DL$PL$@\$T\$Dl$L`D$0uud ALm`3d \$Xsjtt$D~vL=|$8=V|$<|$<=V9ut$@vt1L$,$D$D$@@D$D$0HǁHQlT$XӉQl e SL$LAI `3d TT$,DD$4MD$4$D$,D$TD$0HT$DZ\$@ixl$(I|L$$RLT$[\$ *$D$tD$$D$@$D$JD$($D$$D$$D$ D$ $D$,D$0H T$X9T$X8Sy$L$xt*e @e d d )+ e 9|$ckH$D$T?$l$@KLl뱈L$D$X$D$DHHL@0 $D$D$D$XD$ e D$0HIhT$X9tu9e tD$@$L$ $4щ $ D$%tT$X뫋D$0HIh $D$0@@hD$ $D$D$tT$Xa-+$D$$D$0H4T$X+T$X"^$D$D$L$D$OL$LAD$0\$XHËD$L$ D$@D$L$D$HÃHD$@@D$@@ D$DH@LD$@$l$\$HË\$X.`3d  $D$@D$L$XL$D$ u D$0l$LHÍK@KLS0D$ $T$D$D$XD$ /jHFGe ;avPW$EGe ;avF̃D$ D$D$# e 1@A @`3d tuމD$$*D$L$`e  $D$uKD$ `e tu!t`3d 덉$MD$ `e $YD$ `e ЋD$ e `̥T$ HW\$l$E-HW$l$D$`3d à e e ̃D$ Hw#A `e $wD$t]D$ As] @`3d @u7e tu u D$D$e uD$D$  e ;aD$ A @`3d u D$ D$ ud $L$L$&ud $D$ЧD$ e $D$D$~D$ tD$ $־D$ `e $A~`̥D$HWD$D$HWL$ $D$=ÃC̃ 1L$AAs3D$ e $X}D$t׋D$$D$謼 e ;aD$ D$D$D$L$ u:$D$ D$D$ee@L$ D$ T$ @Bt؉D$D$D$$T$ T$D$jeB.e ;av,$ oD$t$ ]B̃P|$8ZD$T$D$XD$L$\L$S D$ ]e L$,|$1mZL$,QZ,l$T39l$9o@9dD$8D$<D$@AP+T$@AT$8D$8ePR,ZT$\$PR,RT$ PR,R T$$PR,R@T$(PR,\$8PR,l$@݉jPR,pZ@@,X A@,T$TP@D$QR,$SD$,H.tnL$T $L$XL$L$\L$D$ D$,$SD$t5e@@,L$T$PL$ HL$$H L$(H@PËD$T$D$,D$DD$HD$L$D$DD$fD$HD$DL$9$R${D$T$ePR,ZT$\$PR,RT$ PR,R T$$PR,R@T$(PR,\$DPR,l$L݉jPR,pZ@@,X L$,A@,T$TP@YT$L9<]$+R$D$T$1C971D$0D$4D$XD$0D$\D$4L$TuH@L$fPÉ $D$0D$PÃPe ;a% eD$$D$D$u:urHfQ(GD$߃u8t&t螼D$AQ$轻؃ u؋u(rHft{豼t誼D$tӃtڍ@ `3d TDT$D$p$D$D$ D$ L$ $D$ $$D$= D$D$J$D$bD$$D$.4$D$ D$D$J$D$D$$D$z$D$ $D$*g p<̃D$ $D$ Ass e $D$wD$ $^.c)c$cD$ $D$ D$ $d^bbb$ ]蠷 e ;aD$A1ɉL$$D$$L$L$菴e tgD$u D$@uND$$]$W]`̥D$ HWD$D$HWL$ $D$%Ãe u롍 `e $tL$D$C:̃$Qe ;a ud @$D$e L$ ud @$D$Ցe L$uY ud @$D$諑e L$u ud $LVD$M Í=ud PQ׍=ud AQ랍=ud 2Qb 9e ;ave&$D$D$ $D$t$D$)va׼$D$  9e ;ave$D$ D$ $D$,#$D$*#($D$9 8e ;ave&$D$D$ $D$$D$vaDm$D$  8̃$D$ $D$t ËD$ $D$D$D$Al `e $qD$D$L$I`3d T$e $2qD$uxD$u D$(ÅuL$uu)D$$D$`D$$D$(É$D$D$D$ D$D$$D$ k[D$(e yD$L$ QumT$ u[et[tkht t(u D$(É$T$L$D$$D$ ZD$(D$(ËT$tT$D$(D$(̃ D$DD$$D$ ̃ $D$D$D$ ̃ $^ D$D$诮 ̃D$ D$D$PTs2\$ ,H ʼn,$\$D$F e ;av D5e ;a eD$D$ D$D$$L$ L$J[D$D$HQ0et5SR,jQ0i4SR,RQ8SR,R Qe ;aD$ T$$9u[D$(\$,9u0D$$L$T$D$L$T$ T$0L$4D$8Íp$D$m p$D$S +We ;asՍ,(뾉L$\$(D$t$,$D$}D$L$T$4\$(t$,빋d  B<e u! d $T$e D$r90T$$B$>D$D$ d $hD$s< d $D$$D$Fd $ $\$n0Ζ L$ B D$蜴D$$D$cD$ $Ǽ蒶#d$D$藪 p 1d$D$x  $D$` 9de ;a[LD$XL$PT$X\$$l$Tut$8|$P|$4D$09ljD$<1D$ D$<D$L$HT$\\$$l$Pt$,|$4L$T$ l$Ht$|$\Etvs e 9L$9s5L$4t$09,$ЉT$L$$ȉD$SD$ bD$0L$T$l$Tt$8|$4\$tQ\$$RD$L$Q!шL$T$ ЉD$,\$P,l$Ht$|$\6l$$딋L$뎋\$ \$ \$$\$ 9s ]뉃LÉT$e@ƀ<$D$`D$lID$ D$(L$L$D7$D$豺D$D$D$(D$蝺$D$臺D$H$;$D$eD$$D$1ܳ7$D$ e ;a4D$8H PY T$ L$L$<Q T$$D$D$L$T$ \$T$$\$(L$,D$0D$$BD$, D$@4ËD$8@ $D$,D$D$$D$蜙 E$D$脙 \$D$L$X*l$Prt$L|$||$H|$x|$D$|$@z |$$D$X Ѐ$D$@ Ie ;aB,0e $91atZ+s8fu\$l$$\$-D$@ d $D$e D$!D$ `d T$$l$@}!D$ `d T$${0e $pd $蒦1GL$D$ $L$(- d $L$L$ e L$8!D$T$(L$ u@}s*D$ d T$( ܍d $,~ ~ e ;arTD$XH >T$PX\$L*9u1L$l$$p+pt$z z 1w|$9C߅VDT$L9[{\$@|$D\$@e=O?99$t$D$ D$ L$L$8T$\$l$t$T|$PD$01D$,D$0׋HL$9~*\$$l$<9t,$D$L$#D$L$$9vP҉L$\D$`H9sCD$P@L$\D$`H1T$LD$\D$`Hw v v $D$  e ;av;D$$D$ D$D$D$ D$L$D$0L$4e ;av;D$$D$ D$D$D$ WD$L$D$8L$<Ne ;av;D$$D$ D$D$D$ D$L$D$@L$De ;av;D$$D$ D$D$D$ D$L$D$HL$Le ;aD$$D$(D$L$tptPL$t- (L$$D$D$(D$T$D$ $T$É$D$D$,L$  _ ȉD$$D$(D$$D$(=e ;avdD$tLL$ %|E ˉʼnD$$L$(l$,\$0T$4É $D$L$l$ \$T$ʋL$ t 5e ;a|$ tL$( `1wD$ T$(\$(9~@D$L$T$l$$9t$l$\$FD$D$,D$D$0D$D$4É뼉 $T$D$L$ 랋L$(Pe ;a$L$,T$011C9}7,}h\$ $T$D$l$L$,T$0\$‹|$( 1_D$( D$ L$\$l$,11 GL$9}FL5}F9r_|$,$T$t$dL$ t$D$ T$0\$l$,|$ȉD$4\$8L$<$É$L$ D$\$T$0k$q r Fe ;acHD$(11:D$4L$P\$($D$D$T$ ND$4@L$T$ щL$ T$T9|D$L$AD$D$D$0L$L$@T$T$,\$\$Dl$ l$$t$T|$PD$81D$41D$D$8f)!؉$)T$l$|$ 跴D$4@L$T$ыT$T\$Pl$ t$D|$,l$$t$T|$PD$4L$D$0L$@L$49}1HD$TL$\T$X1C}$,[t9u49uDD$dHË\$L-l$Pu}m9k L$,D$())ʼnۇ!\$L։ŋD$,9D$,$t$L$D$,D$ L$(L$RD$L$ T$\$$t{\$,l$X9sD$\t[e I111ډ1։L$(3R,\$T\LD$(D$dHËe \$`D$@L$4T$0D$L$L$PL$D$D$DL$ L$ 5= .= '= Pe ;aXL$\e eAD$0$D$TD$D$D$T$PЋD$\$cD$\L$ \$DȉًT$\Zz8/ut$@)Ɖt$(U T$<ʅÇ!΅ l$HML$8U҇Çޅ!҇Ç Ζ'Ke t7T$\rjmEjr9L$$-e LDJ \$$9ZFGL$GD$P_\$0o l$Tw$t$$dD$%BJ $\$L$D$ L$D$ T$\|$H뎉ω1]‰T$\T$4L$@)ȋl$8l$T$ $D$Dt$<D$dD$T$8ӉD$8t$@t$|$HGD$4DL$8T$@ыL$<ȉG D$\H PX$T$L$D$ L$T$\|$HL$(Å҇Ç!݅ tPD$\@ $fD$D$jL$\ $BaD$\@ $D$ L$L$DT$\>4e ۇÇ݋50e Ç! ޖuL$(T$,ȋ\$\C C D$DЉCCD$LC$bD$L$D$(D$D$,D$gKy3p$HD$G : 9 9 )e ;a0e  4e !un1D$ d $_D$@@}rWl$D$ 1#L$ d  $aD$HD$ @}rD$D$<8 58 ^9e ;a11B@}f d lt܋lDtЉ$Et#hp y 9ËQ9!9 ӄt $ d 떉t3AQ 4e 9ڇÇ݋50e 9Ç!9 ޖt D$É0e 4e H t@ @D$D$7 Ce ;a%L$ T$9\$D$h p4$K $\$΋L$il 9l$,l$ ]9Ëu 9Ç!9 u=9s{e l$tu \$ \{D$ ߉ËD$a9s7T$<9te uHD$$D$$5 5 5 5 e ;a8L$HT$@9t\$<D$4h,$p t$}L$l$@4$ΉыT$@q9RL$0t$lum l$i9$l$,\S [\$(9\$9ڇÇ!9 L$(\$,L$l$0uL$@9t$T$$\$ \$D$L83 2 2 2 2 2 2 e ;avVD$ $L$ D$辶e ;avD$ $L$ D$~e ;av_FD$D$L$L$$T$ $ he )ȋL$le \$ \$\$\$ \$\$$D$(щL$,e ;apJe u D$ ËhJe u )Je tߍ Je $XpJe u Je $vZD$ Ë hJe u  )Je tэ pJe D$1ɉ pJe Je $3ZD$D$ 2=e ;avoD$ ( ǀ( tPL$ Je $XD$hJe u hJe lJe  Je $YËlJe ރ蚴ue ;a(B$L$T$(Je tn\$0~e-ph9uCL$$$D$L$T$ D$,D$\$D$4D$D$8D$D$D$$$R(|u $;(ҳ=e ;aIL$ T$,l$\y*$D$aA :- 3- \e ;aeL$ IhL$9ui1~H~QPIT!фtHL$,9tJe $T$$T$D$L$ D$D$4D$8É $D$0D$D$$D$T$(T$ T$,T$"@D$L$dD$0@$D$$D$L$(L$L$,L$ @?D$L$2- 7e ;avteHBHAptPL$ T$( D$ÉL$e $RD$D$ D$e D$襯pe ;avSD$t7eHZuHet@Íe $-T6e ;a $Je de IIh9D$(L$$t" hJe hJe lJe dJe ʋ dJe T$T$1ɉ B D$ $ D$HPX L$T$ƄAH AH $L$(L$L$D$$D$D$D$D$D$u D$D$, Í Je $R$@e D$D$t=' lJe  Je $PD$f) $D$n= wBe ;aD$H T$ \$݃ˀ AÇ݅҇Ç!҇Ç t rs AH ( ( լ`e ;a$D$0^L$, $D$D$5D$ D$L$( $T$,T$\$0\$l$4l$ D$@D$D$($fOD$($L$,L$T$0T$\$4\$ \$\$D$D$(HAH$L$0L$D$L$HT$(ZX\$0X hEl$,1|F9}|rkD$ \L $D$D$($pPD$ @D$8$ÉD$D$($QPD$D$8$ÉD$8$D$8$ ' ( .Ye ;aD$L$ʁDL$ \$ FT$9}:|9sC9tl$t'h9uh 9upw1‹@D$D$a& Z' 胪^e ;av. D$$D$D$D$D$ +e ;a D$T$T$u_$@e D$D$tML$AQs&\$ӉYDD$ ËHсwJ% $D$R9 2 $D$:9 Ce ;avOD$D$D$ D$D$$D$D$D$D$ D$Cʨe ;av^D$D$e@H|@xD$L$$D$D$D$D$ D$Ke ;aeHBHL$ApApD$T$ Qp$D$D$D$ D$5D$L$ApeZuHet@聧ËL$ $L$L$L$ L$D$ D$9zte D$;Ae $Ht%~P8tt $Fe ;avh D$HL$$D$$L D$L$T$R tr%HȉD$T$ ÉL$D$  Aa|e ;aD$H t|Hw<w"tt D$Ã(D$Ã,D$Àu$D$Ã0D$Àwu4D$Ã$D$Àt u0D$Ã$D$D$`Ne ;avw D$H tE$D$L$QJ| 9sB.uB9w-)щ!ЉD$\$ D$D$   _me ;a D$${D$ugD$Ht8u@ $C D$L$L$D$ D$D$ Ë@ $ D$L$D$L$ ËD$D$$*D$$ D$L$D$L$ _0e ;av0d $^e ;av0d $^e ;at,D$4L$0^ t!Zd9rjh9s 9L$8,ÉL$;`$8d D$D$4D$ND$ L$L$D$$3D$y$D$D$4$D$Ǻ$D$D$$D$$D$^ D$(HdL$ PhT$#$D$D$ $D$Z$D$dD$$D$06D$(yD$$D$8,D$8,ÍR$D$. \$ l$ey$D$D$4$D$Z$D$D$ $D$q$D$D$$D$X^I$D$! \le ;av# D$$D$D$7D$D$ [e ;a(D$0L$,^ Zd9rZh9stST$$L$  $D$JD$ u!D$$HdT$0@h9v\$4(ÉD$4(ÉL$`$8d D$D$0D$3JD$ D$D$$D$D$0$D$Ǻ$D$D$$D$$D$^ D$ HdL$PhT$#$D$pD$$D$<$D$FD$$D$D$ yD$4(1OD$4(ÉL$D$Y$D$D$0$D$Z$D$D$$D$vq$D$D$$D$LR$D$! $D$. X(e ;av# D$$D$D$D$D$ Xe ;a(D$, ^ Qd9rQh9stjL$$AlQp~O\$01EL$$9}:Mtmk$$ `& $T$D$ HL$,D$h1D$Pf땋D$dN\$Hl$8vfL$\gfD$L$l$L$\$ T$0#D$L$T$d e ud ŋD$L=d fĄÁĄC lNe D$;A $$$$$$\$$l$D$ $$$$$$T$$\$!D$ $$9 PӃi8•g \$T$$D$D$DL$$$$D$L$D9tƄ$ĨË$$L$D$ tՋ$$D$D$\$ $D$L$\!  D$H $H"$Z"f9H Z f9h 4ńEɅ  r M4քۅv j $L$$$\$$D$H1D$8D$HDD$8@L$$$\$$$$$$D$8$T$89}= D9 L$$|$D$ uƄ$ĨH `4P"@ ҅u 9j ^ )!Í$Y 4˄i"I  9T$ D$`)͉l$ۇއۇ!΍ 3L$P1/t$,^t$ $L$T$Pl$`щl$$9}@~49s\$,D$4$|$D$ uƄ$ĨƄ$Ĩû$ $$$tƄ$ĨÀ$H $pD$D$DL$$$Z $KD$L$D9tƄ$ĨË$$L$]D$ tՋ$H($Z(9L$D1l$4]l$D$$9h$p(9'tz$R(9$$\$4t$dDD$4$!D$$L$4$ʋ\$ʉ\$T$D$D$|$ $$@ $I L$$$D$LD$ $ĨË$@ $I L$$$D$D$ $ĨÀuƄ$ĨÀb$H($Z(97H $D$D$DL$$$Z $D$L$D9tƄ$ĨË$$L$ĂD$ tՋ$H(L$D$1l$0]l$D$$9h(p$9,[z(R$9sT$tl$@\$0t$p$D$$L$L$e ;a\ L$$T$(ӉQk111@݉[,f9sTt$ 44u#t l$ Ƌl\)iiu tq뢉l$ 뚕e yY i4i8NAA A4A8\$D$l$11҉T$1҉T$1Bl$\$\$l$J֋lmiuu\$뼃u$e u il$\$렉ÉsTu/e ui l$\$t|$CTD$ދl$\$Rou l$?ou+e ui4l$\$ljSoue ui8l$\$|$SD$ދQQ T$Y8\$ki,kuۇ݉ۇ!,39Q$y(5e ߍ\uMi ډQQ-e !ӍuAA0 ÍyR$q R$|$랋jsY$A(5e ׃l+uZQ 9)ʼniډQe !uAFyR9$q R$|$둋e u A4b1QT\$= É|$1Q1Q1Q1QЋ|$ ܶ ն ζ Ƕ  9e ;aD$H8T$YfuY ir<9tYuD$ ËhEssL$D$MD$H\$9tD$L$T$뫉$L$1wD$ uD$L$T$눋D$@%D$ D$ Ĵ 8e D$;A$xD$@D$DD$H ] \$@L$D$\$H\$\$<i05-c ؋c ~pl$,1^D$<ʋ$|$tU|$Lt$tUL$Xދ$k [$ȉ1\$m,9s A9|ĜÉt$8L$( l$]щ\$hʋHL$4H,)9L$4 ˃l$X9t t롉\$$D$$|$0D ރs)WD ЍD$ $D$D$; 4 ]he ;avtW$D$e ;avD$u]4e ;av BJ $D$D$ e ;aBD$ JL$$$D$螴D$$D$j^$D$tD$ $D$@F$D$ iTe ;aB JL$ RT$@HD$j$D$D$$D$谲Н$D$躳D$ $D$膲($D$ 萳D$$D$\$D$fQ!$D$  te ;av $R e ;aBH8L$T$ @D$;R$D$赲D$$D$聱j$D$苲D$ $D$W $D$aD$$D$-"$D$7"B$D$ ̟ Ee ;aBJL$ Z \$RT$(l$@D$=$D$跱D$$D$胰D$ $D$jժD$$D$Qj$D$[D$$D$' $D$1D$$D$"$D$䡻$D$蜞 e ;aBJL$PT$X8\$(l$ @D$ $D$臰D$$D$S辩D$$D$:襩D$$D$!j$D$+D$ $D$ $D$D$$D$ͮ"$D$ׯ§䡻$D$l e ;avuBD$J L$ RT$q$L$tF(Je t;D$u )4D$L$ QX9t$D$moT oe ;av,B@@p$Zp$D$o e ;av*BD$ J $D$L$T$ J e ;av0BJ ZjR$D$L$\$ l$ Y e ;av+BD$ $D$L$T$ J e ;aBD$$膮D$HvIH$?e IL$PPH$D$L$ $舱D$ D$ǀ] Xe ;av5BJZ jrRT$ l$t$ $D$\$m e ;av5BJZ jrRT$ l$t$ $D$\$ e ;a\*$UD$蜉<^ ^ D$T$ 1@A<@`3d €t9PTl$tHӇ!|-e tl$-e uul$r$D$D$D$2.$\$D$ud $D$D$b|$,1{!D$$D$(fD$4 ud L$,L$L$0fD$L ud L$DL$L$HL$$L$L$, $D$L$ uGD$v6PT\$,H!#\$D$vyA@`3d €t \$-e t/PTsCl$tH Ɖt-e ut뤍`3d 뜐\艃 肃  y r k Oe ;avq0BJ Zj rzRvNl$,T$4$D$D$L$ \$|$D$D$ D$$nD$(L$,0ς hse ;av4BJP\$9t@9t9uD$!D$D$e ;a BH R\$$t t D$< ×tutftڋp<D$T$L$\$>$D$,L$(T$9t D$< É $D$CD$ tD$H4tT$t\$$ Y9uL$8T$\$TPD$< D$< P I e ;ae vu耄 e $D$cD$8e f$DVD$荸D$e @f$@VD$kD$e <($L$he le yP4/ze z̐D$\$ $\$ ̋$\$D$x\$|d $h]] ]e4$ X3$ u-$D$D$=$$$ ƃt=GenuuineIuntelue e ω e tnd t"v \$,$йd pAA )eǃ#ld =#ted  d BoD$x$D$|D$ixŹhjXX -d^ ̃\$ S e #CS CC [̋|$e$X \$X@$[39ufP?X̋|$e X;C,t^9tX;ChuY@ b `@$e Z4܉?e XCh`@É?縠xe [39u s,9u |${L$Ke s $F v$D$FV(+EX<̺f ̋L$we  wf @wf wf wg wh wh w0i wi  wPj @wj wk w0l wl wpm wn wn  wPo @wo wp w0q wq wpr ws ws  wPt @wt ̃$|$t$L$ ie ;av?Yu<$D$T$l$ t$̫̋̋|$\$1=e zf @GG G0G@GPG`GpsDfGÉÉDÉGDDDGDDGG G0DDDDGG G0G@GPG`GpDDDDDDDDÉ7̋|$t$\$ =e u @9v(=e u tÉ{9v))NLLfNfOËËLLËNTlOTlooLLooNoTo\OT\ooNoV o^0odoloto|OW _0dlt|k̸\$̸̀\$̀̋D$̸̀\$L$T$ ̀=vD$̸\$̀=vD$̸\$L$T$ ̀=vD$̸\$L$T$ ̀=vD$̃D$ @B$D$$̸̀̀D$̃ ̀ËL$̀ ̃ ̀ËL$%̀ ̸h\$L$T$ ̸̀\$L$T$ ̀D$̉e p$$;FhubYu;D$t%H$L$BD$L$ D$L$RJ K멍|$9;u#e ;av.Yu+D$ tH$L$AI 빍|$ 9;u͉#e ;avJD$$L$L$D$ PD$ L$ $D$D$PD$ D$oe ;av[D$D$L$ $D$ /D$ u 1D$ËD$$D$D$D$D$ e ;avpD$$L$L$D$@/OD$ L$Q@$D$D$L$QH$D$D$L$P $D$D$D$Yte ;av~D$D$L$ $D$@D$ tRD$@@L$I@f.u6z4AHHHf.u zAPHPf.!L$111fe ;avJD$$L$L$D$MD$ L$ $D$D$MD$ D$Oe ;avND$T$9u7JX8t 1D$ÃD$B$D$D$ 1e ;avBD$$L$L$D$L$ $D$D$ MD$ D$we ;avSD$$L$L$D$u 1D$ËD$ $D$ D$D$ D$ e ;av<1L$"D$ \$؉$L$L$D$ @=|׉L$e ;avP1L$ A=}2D$ T$$\$؉D$D$uD$D$9e ;avBD$$L$L$'D$L$ $D$D$hKD$ D$e ;avW D$T$9u@JXf9u/HZ8t 1D$ ÃD$B$v D$11be ;aD$$L$L$D$JD$ L$$D$1D$L$$D$D$oJD$ L$$D$D$LMJD$ L$ $D$D$L$( $D$D$ JD$ D$e ;aD$D$L$ $D$;D$ D$L$f.88tR1҄tH  f.u{ 1D$Á(L$($D$ D$ 1΍T$$D$LlT$ D$L$1z1sD$L$1d;e ;av>Yu;D$t%H$L$+:D$L$ D$L$A ۿ멍|$9;u#e ;av.Yu+D$ tH$L$9A {빍|$ 9;u͉#e ;avJD$$L$L$D$ GD$ L$ $D$D$ GD$ D$e ;avbD$D$L$ $D$ D$ t6D$H T$Z 9u JX9@R9!ȈD$11we ;avBD$$L$L$D$FD$ L$ $D$D$D$e ;avHD$T$9u1H@ZR9t 1D$É$D$\$D$ 1豽e ;av+D$$D$D$D$ ED$ D$^e ;av,D$D$D$$D$ D$ D$ e ;avJD$$L$L$D$ OED$ L$ $D$D$0ED$ D$蟼e ;avUD$D$L$ $D$ _D$ t)D$H T$Z 9uJ@9D$11$e ;av+D$$D$D$D$oDD$ D$޻e ;av$ D$D$D$$D$D$ 蕻e ;avBD$$L$L$WD$L$ $D$D$ CD$ D$7e ;aviD$HT$Z*09t11Ʉu 1D$ÃD$B$D$ D$ ׉,$t$\$L$ D$T$谺{e ;avBD$$L$L$gD$L$ $D$D$BD$ D$Ge ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$L$ D$T$Թe ;av;1L$#D$ @\$$L$)L$D$ @|؉L$~e ;aD$$L$ 1B}oRl4t$D$ uD$ D$ ye ;av81L$ D$ T$‰$L$L$D$ @|ۉL$e ;avkD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$ND$ uD$ D$ .ye ;av81L$ D$ T$‰$L$L$D$ @|ۉL$Ѳe ;avkD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$^D$ uD$ D$ >ye ;av;1L$#D$ @\$$L$L$D$ @A|؉L$ޱe ;aD$L$1BA}dR,49ttD$ Ëlt|\9t؉T$,$\$t$W\$ D$L$T$D$ 3^e ;av81L$ D$ T$‰$L$L$D$ @|ۉL$Ѱe ;avkD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$^D$ uD$ D$ >ye ;av81L$ D$ T$‰$L$L$D$ @ |ۉL$e ;avkD$L$1\$S\$l$؉ };Ѝ,ыum{9uT$$l$|$nD$ uD$ D$ Nye ;av+D$$D$D$D$7D$ D$e ;av&D$T$9uJ@8D$ 1賮e ;avJD$$L$L$D$6D$ L$ $D$D$6D$ D$Oe ;avTD$D$L$ $D$D$ t(D$H@ T$ZR 99!ȈD$1խe ;aD$$L$L$D$d6D$ L$Qh$D$D$)5D$ L$$D$D$5D$ L$$D$D$5D$ L$ $D$D$5D$ D$0e ;aD$D$L$ $D$dD$ 1ur1u=1u 1D$ËD$D$D$$D$|D$ ˋD$L$L$$D$MD$ 떋D$L$L$$D$D$ ^D$HhL$L$Qh$D$)D$ ,e ;avJD$$L$L$D$ 4D$ L$ $D$D$4D$ D$oe ;avUD$D$L$ $D$ /D$ t)D$H T$Z 9uJ@9D$11e ;av+D$$D$D$D$=?3D$ D$讪e ;av,D$D$D$$D$=oD$ D$]e ;aD$ f.v D$D$ D$D$$T$f.wf.u{D$$f.uzWf.u1z/f.u)z'$D$t T$$D$$f.v D$$T$$|'e ;aL$f.v D$D$ D$D$$T$f.wf.u{D$$f.uzWf.u1z/f.u)z' $D$t L$$T$$f.v L$$T$$蜨'e ;a`$D$(f.u{ D$0$ f.w f. (f. f. f.v f.Wf.v` Yh\,*xY\$YD$D$D$D$0$f.v YhX,1 XL$0$WD$0$D$D$ D$D$0$WD$0$e ;aD$L$ \Y%Y-XY% XY-XY%@XY\Y%،\^\\\$D$(D$MD$ D$,8#e ;avPD$$KD$L$Wf.u{ 1D$$$qD$ɥe D$;AW$f.u$f.uUf.u9f.f.f.f.Sf. f.%f$$;D$L$Wf.u$f.%pf.f.u%hf.-\XL$$l$$D$$YD$$D$L$L$$$$D$D$,D$D$L$ $/oD$L$ $L$,T$1 ÉɇÇ݅Ç  w8Ńt"YYhf.vXJ돉W$f.v2 ^ $D$JD$ $ĜW$f.ʉf.u\$DD$DL$H  ʉ$艄$$ f.$f.8u$ĜD$tD$xD$t$Ĝ$Ĝ$Ĝ$M  $D$t$$ĜW$Ĝ $D$t|D$TD$XD$TD$LD$LL$P$D$,uw 4~w 8؇ޕtD$D$D$  e ;aE,D$4$L$0I+1-I $D$@T$D$ D$t%D$D$D$D$8D$@,ËD$0$D$4D$D$D$ D$uWD$8D$@,WD$8D$@,É $D$`T$D$ sD$t%D$D$ D$D$8D$@,ËD$0$D$4D$D$D$ D$u\ $D$<T$D$ D$t%D$$D$(D$$D$8D$@,ËD$0$D$4D$D$D$ D$uNuB $D$D$D$ nD$D$8D$@,ÀintWD$8D$@,蠍e ;alD$fǀ(L$T$ +11CD$9<.u"u $D$ÍoЕ wm0u u$O$돋  }* ߈(ߋ E W0tƀ)l$9@,ek9t+9}n40r]9wV1C9}.<0r9w'}ۍ4tw$9t D$D$D$Ö-u qeD$ÕE(뫋 $9D$À-uƀ(1D$      te ;aL$T$+s1ۈ\$1111l$1l$ 1l$1l$1핈D$1 @t$ \$D$9.uHut$ |$‹D$ D$ D$D$$D$(D$D$,D$D$-D$.ÍkЕ 0uu\$K\$t$ _T$}Yø L$ ȕȋL$ JT$Bl$GL$T$D$L$T$ʼn؉0Ç\$ ݉ËL$D$ \$9ȋ\$R,eh9Z+t+$94091@9}.<0r9w'}ۍ4tw+9uMD$\$ ۇÇ t-L$)ʉ\$ D$$T$(D$D$,D$D$-D$.1ՋD$ D$ D$D$$D$(D$D$,D$D$-D$.ËD$ D$ D$D$$D$(D$D$,D$D$-D$.Ö-u D$ D$ D$D$$D$(D$D$,D$D$-D$.ÕE]9ȉ2D$ D$ D$D$$D$(D$D$,D$D$-D$.À-u11wD$ D$$D$(D$,D$-D$.     e ;aIPD$T $61 T$$ډT$Q.D$L$D$T$~?L$,c -(c 9|뻋T뵉T$$T$.L$D$)D$TL$$}%ڋ,c -(c 9|uTu5rэQ\$XkE9k)K !M9K !SJ11L$D$;|$L D$H!Ɖt$DD$!Ɖt$ AD$@ |$D$L$ D$ZD$(L$0D$4ËD$$D$ D$D$D$L$D$(D$0L$4tle ;aTD$XH P$L$AD$XHT$ T$\$\$ hI,$ыD$L$L$|$$5 lL$XQ L$,T$0L$ L$l$l$!T$!ځ }sI0݈0ݍnƋl$vƀ)볉 $ǀ É] V O H qZ\e ;avPD$L$T$\$1E9}*9} s*4+9s"<*8؇ߖtD$D$D$ Ye ;ac c T$$9{Rl$ \ P\$TDD$ T$,$t$D$ D$T$JT$\$ 4*M|$$1 Mω֋T$|d +Љ !¸̉Ѝ)׍V }0D뢅tƃ)땉Љv8̉<)~ } sP0L˅tƃ)뾋 Љ = | ǃ  $$ËT$+ $    8XCe ;aD$ t:L$!4L$$D$D$HD$ ܉$L$|!L$$D$D$HD$ |܉$ىL$WYe ;aD$}ËL$ 9}= s[5uMh9uC)t $D$Å~ T„uډ $D$)15 VZe ;av/D$ }ËL$ 9}  $Ve ;av]D$|ML$ 9}?HH|= s19sB@ 1ǁ $@$ Ve ;aL$$111<ЗFՉډÉ9}F 9}<Ɖؿ lj rƸ F|,zډÉ9|} \$l$ Ë 9}4 5u;z9u/)tȅ~D u15D$D$  Te ;a]@D$DX҇Ç݅ۇÇ!PZ?l$HuF9T$<)ދX\$88NL$4ىL$0l$8 ҉T$,!׋T$0 ! T$4 ! T$8\$,!ډPT$|$(O !É\$ !Ńًt$8 ! t$8 ! G؍HL$0ىL$,\$, !ڋ\$0 !݃ ! ՋD$8T$4 ЄD$ t$T$(JىL$8 t$4! t$0! 9à |$,Ѿ!|$9Ç!ޖ t$FD$\$ t$l$$|$HG)Ƌ|$  !{|$<93\11t$ D$1D$ѿT$,!׉|$L$8D$4!ŋD$0! ՋT$T$ !!|$8T$)ӋT$\} D$`DW}|$) yۇ߃$5 ^ <79‹w9Ç!9 S+T$@5 ^ 4΋>v\$@\$HSÇ݅҇Ç!D$WlL$$ _ T ltD$t$l$ T$$D$$~@T$HZ*ۇÇޅÇ!J1Ƀ !؋\$\kr9)++]@D$$ٽ !t$@y !|$ )lj|$e D$;A$X҇Ç݅ۇÇ!$[҇ÇރÇ!Ç 1 Ç݁!Ç ŕp _Ç݅Ç!Ç * =\$H$-^ D$lۇ݉Ή !‹$Qى$$!Ƌ$ ! ! ߋ$xP\$H$TP$$Pډ$$@$JL$| t$x!ىL$t t$p! |$l! ؉D$h!$)ʼnl$P|$L$t!L$|T$ht$x! ڋ$)Ë$ЋT$h11ۉ\$<\$810 C,jl$hl$Pt$xT$v\$D9_`Ƅ$ļÉB D$(l$$$$T$l!֋T$P T$ʉًt$,L$tD$p!! ދD$T Ɖt$D$0D$ D$4D$T$l$L$QD$ t;$H II|P9 0tAH Ƅ$ļƄ$ļÉً\$||$x1L$dL$TL$4&T$h1۽11ʼnމىӉ1O$A A@ AƄ$ļ  0$hD$ ʴ ô 輶 赴 讴 0$`D$t 8(e ;a D$$HT$ !ى !t$ ! ӋT$9ڇÇ!D$9Ç!9ڇÇ GL$,|$( ϋL$(99!9 фL$(ȉD$|$ |$9؇Ç9Ç!9 Ɩ)ʋD$L$, 99!9 tbD$H IP JP I|P9sc9t}#HvF1@ HAHD$0 ËP9sBD$0 D$0 ߲ ز Ѳ 0$xD$ 0$pD$} 6e D$;A $Z*Çޅۉ!w ZW $ыߋ^9Ç9É! ^9 n q 8؇ݖ $D$3$.^99!ӄqV$9_V \$38N$1>N$Qkˉ‰苌$ۇÇ݅҇Ç!҇Ç tP\$4D$H$T$D$ D$ D$ T$4)ƒ0D$\$Hy~ Pڋ$1.E$$9}*t(<(= 3K$|9r# S Ss C ~S+p9 T(0t܅uCA CƄ$ËFÅÇ!ݕ{AV9dY)$)Љʉ !*h鋴$ !։!ۇ݉鋄$ ! Ƌ$p$ZX$Kj9s;$)鉌$ !lj;y !Ջ$ۇ߉$ !! k$PS$$L$D$$T$ T$lXX$$i$iHى$qx$ى$$$$ 퉬$!苜$ ۉ$! ƒ ! ׉$!$)l$d$$)͉l$t$m$)L$8$!ډ$! Ӌ$)$ډ$$$)Ӌ$׉$$R$)Ӊ$$11ɉL$D7‰ EZ$$ΉT$D$ω\$DۇÇ9!ۇÇ t$l$X$$$$$1D$`$D$\$9T$`B$$؋$l$X$$T$`$T$`9)Սu5 ^ luml$@D$\1$j\$`9t$<Ƌt$\)Ɖt$\ȋ$!$|$dt$p0$l$\틔$!ՉT$\⋜$! ꋬ$$ꋬ$9Ë|$t9Ç!9 ޖ\$`C$^ \$lD$X؉F$@ F4$D$pD$T$D$8D$ $D$|$l$ȋ$T$<⋬$!T$T$@!ꋌ$담$! Ӊ勄$! ݉l$ D$$D$(D$,$É$$j t$lj$m Bl$t$$$D$h$L$P1ɉL$T$$g$T$t$$苔$l$t$$T$|T$d\$h$$L$T$$$ l$d剔$D$dŋD$P t$h4$4w$|$T<z$$狔$!Ջ$! $! $o 9D$P$͋$!։$T$d)T$|T$tT$x$r0;$s Fs ⋌$鋜$달$!ꋬ$! ڋ$! t$d$)ދ$Ӌ$t$P֋l$t$t$x9ӇÇ݋t$|9ƇÇ!9ӇÇ $$D$Pt$8括$,$l$|l$\$D$ $l$PT$$T$$T$ȋ$⋜$!ډT$ꋌ$㋴$!$! Ӊ\$ l$$ T$(T$,$1ȉÃÇ!݃ l1 D$L؉$Ç=!Ç ߗ! D$LۇÇ߁Ç!ۇÇ  vjD$L$-^ \$lۇ݉Ή !‹$Q$ډ$$ !à !ljȉ鋔$! Ӌ$XP$l$LTPƋ$މ0ŋD$LÉЉ1҉T$L$$$$$ы$$$@ @J HƄ$裥 蜥 蕧 莥 臥 耥 y r )e ;a D$4T$,9\$8 ً\$09ˇÇ!9 D$L$ |$@l$,LILD$\$0؋L$|$ l$8|$T$D$D$T$, Ӊ\$T$Ӊ$|$0|$D$ЋD$Nj$9l$9!9 ÄtD$x@ h9[D$,‹|$<$؋D$\$0ËD$D$$D$89ˇÇ9!9 ʄL$9‹\$9Ç!9 Օt D$< ËT$$)l$(99!9 ȄuԋD$H uHv1 0u@ @D$< D$< D$< ` Y 'e ;a,D$$L$pىL$l\$XT$l ҉T$h!Ћ$! ǃ ! L$tк !J!ډT$Pߋ\$TT$x!Ӊ\$DL$lL$p!‰l$h! ӋT$|Ճڃ\$dыT$X!Ӊ\$H\$P9D$TL$xL$d  $4\$`$89w_$09$l$\$L$D$|C$$PD$`$TD$\$X,ÉD$@$3$$0D$T$l$ \$t$l$D$@$$4\$`UD$>t X 8 KD$DT$HN$Db -^ $ D$DT$HL$P$1t;$H;f)GE׍Q1L$`$0$$4D$$8D$$HD$ D$>D$ |$$?D$`D$(\$,ZD$8L$4T$0$P$T$X,Ë$0$$4D$$8D$L$ \$D$>D$l$|$D$PD$t$ D$,L$(T$$$P$T$X,ÉL$`$*:$$DŽ$DŽ$DŽ$DŽ$DŽ$Ƅ$$L$H$t$P)މ$\$>$$4$$t$T$D$ L$`$Dl$D$ |$H3Guuы|$H ׉egu͉1DŽ$DŽ$DŽ$Ƅ$$$l$T$L$PL$ \$>\$t$ D$(L$T$\$$l$ t$4D$?|$0t$,$$$$$$$D$?$$1`8$$DŽ$ DŽ$ $$$D$$L$$L$ D$tx$DGwDEu($ J~ˋl$D$ |$H1Gu $ ֋$H̀etfu$ +$$1뭀gtЋ$0$$4D$$8D$$HD$ $DD$D$>D$D$DD$D$HD$D$PD$$ D$ {D$(L$$T$,$P$T$X,Ë$0,$$4l$$8l$$Hl$ \$\$>\$D$T$L$t$ D$$L$,T$($P$T$X,Ë$0$$4\$$8\$\$>\$ D$T$L$t$`D$ L$$T$($P$T$X,ËD$D T$H ʉS@u2$<$$$ ^ 0 0$D$ ?e $;A|$@1T$@$$\$$l$访$$)݉l$\$@$$l1(5$$G5ED$@$BD$$L$@$l14L$@$lDŽ$p DŽ$t $`$x$d$|$ɋ$$$D$$D$D$ $D$ |$$l 9T$($D$,D$4L$0T$8$$$ĄÀGu*u"\$ ףkd)Ή~7l$0T$D{\l2A|$WD;k J Arjk5\TATVȋT$($=ʚ;Ç݅҇Ç!҇Ç t]D$H\$4$T$D$ʚ;D$ D$ʚ;T$H)‹D$D$(\$4D t$HӃdrm> ףkd)ȍNT$HK-\T5AL$WT St}6Arhk5\|Akl$4l$WD+ =BCVA0T+HADV-$A$)ȃAD$@Yۉ!ٍL W$9wv$9\$<$$L$l$$$D$@$D$<$DŽ$DŽ$ĠÉl$<$ 3 $$L$T$\$ D$:\$t$D$@$$l$<>A$A؉!D WD$T$T$ D$L$DŽ$DŽ$DŽ$$$ĠÉwɋD$4UkT, l$ l$$\$8wt$,D$LAD$4D$Lu$L$WDt$$~L$ !ۇ߉Ή$ ! Љ$\$8|$$$t$,$l$4l$$9Ç9ڇÇ!9ڇÇ t*!ƃ$|$4o43AAn$^T$4Z-DACl$WD*ɉ!i1|5^ ,>\$8A|$WT=\$8$‰$9Ç9!9ڇÇ ϗt\$t$4$T$l$\$ D$$ዔ$)‹D$$s{l$4u=Af_$sSNAsAT$WD$$$y y x x x ~x wx px ix bx [x Tx Mx Fx 0$D$  Ue ;a$D$, @L$ 3 $D$D$ L$T$$L$T$D$(D$ D$,D$D$0D$D$1D$D$2D$D$L$T$ $D$L$T$ D$L$L$4D$8$1e ;avz $D$D$D$$D$ D$(D$D$)D$D$*D$|D$L$T$$D$L$T$ D$L$D$,L$0 je ;al$D$\$HD$HT$Pi}i vi oi hi ai Zi Si Li Ei >i 7i `e ;av7D$$D$D$fD$"D$ D$ L$D$ L$$e ;avW$D$($D$,D$D$0D$D$4D$ D$8D$fD$"D$D$L$T$ D$e ;av,D$D$D$$D$ D$ D$e ;avBD$$L$L$D$/]D$ L$ $D$D$D$e ;avHD$T$9u1H@ZR9t 1D$É$D$\$1D$ 1!e ;av81L$ D$ T$$L$L$D$ @ |ۉL$e ;av/D$L$1B } .u{D$ D$ je ;av81L$ D$ T$‰$L$LL$D$ @|ۉL$e ;av0D$L$1B} f.u{D$ D$ e ;av;1L$#D$ @\$$L$L$D$ @=|؉L$^e ;aD$L$1B=}dR,49ttD$ Ëlt|\9t؉T$,$\$t$\$ D$L$T$D$ ^e ;av:1L$"D$ \$؉$L$L$D$ @W|ىL$Oe ;avpD$L$ 1$SW}M$lt < 9Ç9 ݕu\l 9u\ T 8tD$D$te ;av:1L$"D$ \$؉$L$L$D$ @|ىL$_e ;avpD$L$ 1$S}M$lt < 9Ç9 ݕu\l 9u\ T 8tD$D$te ;aviD$H $D$HL$ $wwD$T$T$XI$ыD$ $D$D$wD$@I$у@{e ;av'D$H $ZD$$+ze ;av'D$H $D$$xe ;av\D$9uÉT$$D$D$D$D$ u׋D$9t͍0$D$X =e ;ave ;ave ;a8D$<HL$ $D$L$@x9A D$T$@T$ \$D\$$-,$L$L$ L$D$ L$tGt%$hD$L$T$ L$HD$LT$P8D$HD$LD$P8T$tD$<$D$$AD$L$@x9HL$T$@T$0\$D\$4-,$D$D$0D$GD$ L$t'D$L$T$<$OL$D$T$tՋD$@D$(D$DD$,D$$D$xD$D$|D$D$D$,L$ L$T$T$\$l$D$L$,T$"11$D$xD$L$|L$ID$L$T$\$ $$$h1Ee ;aJD$$ID$ ud 9 '$AD$L$e T$ PD$D$D$L$ $D$`D$ uWD$$D$ ud 9ttHD$$L$(D$,D$-D$$D$(D$,D$-ËD$D$$D$ D$(D$,D$-Íx‹D$ ЋT$ GHD$$L$(D$,D$-D$$D$(D$,D$-Ke ;ar8D$<HL$ $RD$L$@x9;A D$T$@T$ \$D\$$-,$L$L$ L$XD$ L$tu8É$T$tD$<$ D$$D$L$@x9HL$T$@T$0\$D\$4-,$D$D$0D$ǐD$ L$L$D$tD$<$L$D$RT$t݋D$@D$(D$DD$,D$D$L$\$9sD$ É $D$D$ Ue ;a0D$8 e $e D$$WD$0hO $L$4Q9<D$($C#D$D$ w $D$虃D$ L$D$,L$$D$L$4 $D$4$D$ D$zD$(L$$9L$,ȉD$870Ëd Z-d 5d 90Zd |e u L;‰+ e$l$T$t$ \$LD$L$T$d e ud ʉŋD$(L$4낍=d !؉D$860Ð60M+ F+ oe ;a, d L$d T$(1^L$T$(o9/TDTT$$ e TDT$ L Tu?D D e u D||$ 1Љdt$l$\$ $L$D$\$ l$t$|$됉|$$1D$he uNG@9}\<d -d 9\5e u$DD$|$11f뫉߉1Uэ$mD$d d e u d ,Í=d S) |e ;avW$ODe ;av$Ye ;av> D$H $D$D$| ËD$ $D$B軬e ;a D$H $D$D$}:uOr$D$! D$L$ T$z $D$D$L$ T$ D$LsL$PT$TL$PD$LT$T11L$PT$T݉ËD$L\$0l$,t$D~D$L$T$ T$H$׋D$L$L$ T$T$4qD$0\$,t-d 9tD$X\$\L$`T$d8ÉD$(\$$ $T$d D$D$ tD$(\$$11뷋D$(L$ T$4\$$륋\$T9D$L$! Ät, 3 $D$D$pD$ L$T$"ոθǸ놋IT$DT$T$HT$$ыD$L$T$\$ \$XT$\L$`D$d8ËAL$)e ;aD$L$ $ZR1F9}"<9} 9r D$LЉNjD$LD$8L$TT$0$k,? $$D$D$ D$L$ t1%92 $DŽ$Ƅ$Ĉ%}$H$L$$xD$D$ D$D$D$谊D$L$$$l d l}$HL H, H8 H  HG H; HH($DH%HHL$\PLT$@1l$H]$L$\T$@9\$H$D$/D$D$ D$D$D$蠉D$$$t$$L$`$D$D$`D$D$ $D$D$D$ ڋ$H L$0Q$9b$L$Tl$81F9 <|9}t$49uBT$0|$$?T$D$ cD$$uM$7D$0D$D$D$ 0t$4D$0L$TP$$l$8a$1!t$4Vt$8|$T$$9 T$44tz9u;t$$7D$D$ 蘇D$$t$Ct$$?T$D$ aD$$W$$T$D$D$ "&l$4$l$D$D$ D$4h$$|H*H@ uz$D$l$$D$h$$D$d$ D$lD$D$hD$D$dD$ \D$$$ $D$D$D$ !D$$t $$;HL$$6D$TD$ ׅD$$t $$$$6D$D$"TD$ 腅D$$t $0$$T$D$?\$T$D$ 7D$$t $$7D$DD$D$D$ D$0P$\$D(L$$D$D$ D$D$D$D$$$t $T$@D$D$D$ D$L$(9u $$D$D$D$ ΄D$$Q T$$%D$D$ D$t$L$p$ D$pD$D$D$ ȃD$$$u $$`Q YL$Xh8thDiAD$$D$D$ BD$$t $D$XD$$D$D$ D$$u $'$$T$\$D$ 辂D$$t $iL$X5-1L$t$=D$tD$D$D$ ^D$$$u $r$L$$6D$D$ D$$$H(^ D$|f^ D$x$D$|D$D$xD$D$ D$@D$D$D$$$$u $$)$HL$,t_L$,$HL$$6D$T$L$ D$$$u $$$D$D$D$ iD$D$,$iHL$$9D$D$ 蒀D$$u $$1$BD$D$D$ GD$$u $$$$D$$D$D$ D$$t $D$<$$D$$$D$D$ D$L$$$uCu'D$D$ L$T$$8D$89xL$uD$0D$4D$8%D$<,D$@$Í 3 $HL$L$D$ L$T$\$,9~PD$ L$T$l$(9t$l$\$^D$ D$0D$D$4D$D$8D$<D$@$É +?e ;avbD$ $D$$D$D$L$ T$\$uv,D$(D$,D$0D$(T$,\$0~ >e ;av D$@L$L$ D$D$i>e ;av1L$A L$L$ D$iщL$>e ;av3L$ʚ;IȉD$iʚ;ډʉT$ =e ;avFL$ʚ;IʼnȾD$iʚ;iˉ\$ c=e ;avC$D$ D$D$$D$D$(D$ D$D$L$D$,L$0=e ;avK $D$$D$D$(D$D$,D$ D$0D$D$CD$L$D$4L$8 D$f@ HfHHHHH D$D$ D$D$/e ;aD$ fVffuf 2$hD$ HL$PXډ1 \\B}rS D$$L$(D$,D$0D$$D$(%D$,\D$0Í }$D$L$ QuA@1Bl}\u'D$$L$T$D$ '6D$L$|$O e u$0 D$$|$(D$,D$0Ef ftfȳ$D$L$ QfQPQfPQ P Q P 1 \ \ B}r L$$D$(D$,D$0Í۱$D$L$ fQfPQPIH  L$$D$(D$,D$0Í$AD$ HL$PXډPQ1 \\B}r" D$$L$(D$,D$0Ѩ ʨ é 輨 赨 , e D$;A |$(1 ED$p$ $L$(L$T$T$ L$ T$\$L$$D$($D$L$T$ \$u.l$$$$$$$ĠÉD$ $T$$D$$$/D$ $T$$1뚉$DŽ$DŽ$$$Ġ+e D$;A>|$,1CD$p$ $L$,L$T$T$$T$ L$T$\$D$pL$(D$,$BD$L$T$ \$u.l$($$$$$ĤÉD$$$T$ $D$($.D$$$T$ $1뚉$DŽ$DŽ$$$ĤÍ0$(D$ C*e D$;A|$1iBD$p$ $L$L$T$T$ L$ T$t+DŽ$DŽ$$$ĈÍD$$D$L$T$ \$$$$$Ĉc).e ;avCD$ $D$$D$D$(D$D$,D$ D$ /D$L$L$0D$4(e D$;A`$1;A|$(AL$($DŽ$pDŽ$DŽ$$~$$$D$$~9$$$$$DŽ$$$$D$$D$BD$ L$T$$$t$(fu<11$$$$$$$ļÉD$$\$ l$D$($L$T$ t$|$D$$\$ l$뒉$DŽ$DŽ$DŽ$DŽ$$$ļË$$D$D$-D$ L$T$u+tD$$DŽ$$L$(mDŽ$DŽ$DŽ$DŽ$DŽ$$$ļq&|e ;aDL$dF11ɉL$|$(1>T$(L$L$,D$ D$$L$P~ D$LD$ L$$D$D$\~T$XT$8D$D$ L$T$T$DL$HD$L$!8e ;aD$ $D$$D$D$(D$D$,D$ AD$L$T$t6 % $D$衻D$ L$D$0D$4L$8D$<ÉT$0L$4D$8D$<l We ;a0D$8D$,D$D$ u11ɉL$e ;a(D$4~tL$0T$@T$$$ T$,T$L$D$ D$d IuJ$D$L$$ѺT$D$D$ L$D$L$L$$D$(ÉT$$L$(ne ;av3D$u D$Ãu unVe ;avD$ u D$Ãne ;ave ;avxD$ | } d IuJ$DD$L$$T$D$L$ D$D$L$D$$L$(ÉT$$L$(ale ;avCD$ $D$$D$D$(D$D$,D$ gD$L$T$T$0L$4D$8e ;avCD$ $D$$D$D$(D$D$,D$  D$L$T$T$0L$4D$8e ;avKD$@L$ $ЋD$L$ t L$$D$(ËD$$D$L$ L$$D$(.e ;avKD$@L$ $ЋD$L$ t L$$D$(ËD$$D$L$ L$$D$(e D$;A|$1&D$p$ $L$L$T$T$.L$ T$t+DŽ$DŽ$$$ĈÍD$$KD$L$T$ \$$$$$Ĉ .e ;av[$D$ D$D$($D$,D$D$0D$D$ D$ D$D$D$L$T$ T$4L$8D$<$^ e D$;A|$01%D$(p$ $$L$$L$$L$ $L$L$0L$T$(T$L$T$ \$$u^D$0fu.11퉌$$$$$ĠÉL$,D$0$l$D$T$ \$L$,밉$DŽ$DŽ$$$Ġ- e ;av{$D$<@L$@ $ЋD$L$ T$\$t L$DD$H$ËD$($D$,D$D$0D$D$4D$ D$8D$T$\$7D$L$ D$DL$H$ ie ;avCD$ $D$$D$D$(D$D$,D$ D$_D$L$L$0D$4& e ;avK D$0D$D$$$D$(D$D$,D$D$D$ D$D$L$L$4D$8 e ;avCD$,D$ D$ $D$$D$D$(D$D$D$L$D$0L$4V e ;avCD$ $D$$D$D$(D$D$,D$ D$/D$L$L$0D$4 e ;avCD$ $D$$D$D$(D$D$,D$ D$D$L$L$0D$4 e ;avCD$ $D$$D$D$(D$D$,D$ D$oD$L$L$0D$46 e ;avkD$ u  e u4$D$ D$D$$D$D$L$T$ T$(L$,D$0D$(%D$,xD$0ye ;avCD$ $D$$D$D$(D$D$,D$ "D$L$T$T$0D$4L$8Fe ;a(D$0$D$4D$D$ L$T$D$T$ L$$$2D$,D$D$$D$D$8D$ &D$taw6uc c D$u c c D$PL$TT$X8Í%$L$L$T$ D$(Ѓ u c c 뽃uȋ c c 몋L$,T$0D$PT$TL$X8e ;a!u c c D$XL$\T$`<Í%$L$ƞT$ L$D$(Ѓ u c c 뽃uȋ c c 몋L$,T$0렍-He 6D$XT$\L$`u c c D$4L$8T$<$Í%$L$RT$ L$D$Ѓ u c c 뽃uȋ c c 11뤍 He V#e ;a4D$u c c D$HL$LT$P4Í%$L$VT$ L$D$(Ѓ u c c 뽃uȋ c c 11'e ;a(D$,$D$0D$ӽD$L$ T$L$T$$D$ $ D$ D$D$D$ oD$taw6uc c D$4L$8(Í % $D$fD$L$ ؃ uc c Ńűc c 벋D$L$$먉L$4T$8(+e ;a$D$ D$D$D$ D$taw6uc c D$$L$(Í % $D$蚖D$L$ ؃ uc c Ńűc c 11oJe ;a $)D$$D$D$D$ D$L$tmD$w>u c c D$(L$,T$0 Í%$L$ΕL$T$ D$Ѓ u c c 뽃uȋ c c 11:e ;a$D$ D$D$D$ D$taw6uc c D$$L$(Í % $D$ D$L$ ؃ uc c Ńűc c 11Je ;a$^D$ D$D$$D$D$ SD$taw6uc c D$(L$,Í % $D$JD$L$ ؃ uc c Ńűc c 11Je ;a4D$<$D$@D$ùD$L$T$ D$,T$(L$0$*D$8D$D$0D$D$DD$ D$HD$D$LD$D$D$$taw6uc c D$PL$T4Í % $D$>D$L$ ؃ uc c Ńűc c 벋D$(L$,먉T$PD$T4e ;a $7D$$D$D$(D$D$,D$ sD$L$tmD$w>u c c D$0L$4T$8 Í%$L$^T$ L$D$Ѓ u c c 뽃uȋ c c 11/:e ;a$D$ D$D$$D$D$ D$taw6uc c D$(L$,Í % $D$蚑D$L$ ؃ uc c Ńűc c 11oJe ;a$vD$ D$D$D$ D$taw6uc c D$$L$(Í % $D$ڐD$L$ ؃ uc c Ńűc c 11Je ;a$D$0L$,L$ $T$(T$L$D$ D$L$tmD$w>u c c D$8T$u c c D$8T$u c c D$8T$u c c D$4L$8T$<$Í%$L$6T$ L$D$Ѓ u c c 뽃uȋ c c 112e ;a$[D$ D$D$$D$D$ D$taw6uc c D$(L$,Í % $D$zD$L$ ؃ uc c Ńűc c 11OJe ;a D$$D$$*D$D$D$D$ { D$taw6uc c D$(L$, Í % $D$貇D$L$ ؃ uc c Ńűc c 11Be ;a D$$D$$KD$D$D$(D$D$ D$taw6uc c D$,L$0 Í % $D$D$L$ ؃ uc c Ńűc c 11Be ;a$D$ D$D$$D$D$(D$ C D$taw6uc c D$,L$0Í % $D$:D$L$ ؃ uc c Ńűc c 11Je ;a D$(D$$D$$D$D$D$D$ { D$taw6uc c D$,L$0 Í % $D$rD$L$ ؃ uc c Ńűc c 11GBe ;a$D$ D$D$$D$D$(D$ D$taw6uc c D$,L$0Í % $D$躄D$L$ ؃ uc c Ńűc c 11Je ;av3$D$D$D$ g D$D$6e ;av3$D$D$D$  D$D$e ;a,D$0$D$4D$蓩D$L$ T$L$T$$D$ D$8D$($D$ D$D$(D$D$ 'D$taw6uc c D$u c c D$LT$PL$T0Í%$L$L$ T$D$(Ѓ u c c 뽃uȋc c 11뤍 He > e ;a0D$<L$8L$,$T$4T$L$D$ D$DD$D$HD$D$D$L$$tmD$(w>u c c D$LT$PL$T0Í%$L$L$ T$D$(Ѓ u c c 뽃uȋc c 11뤍 He > e ;a0D$u c c D$DL$HT$L0Í%$L$T$ L$D$(Ѓ u c c 뽃uȋ c c 11e ;a4D$u c c D$PT$TL$X4Í%$L$&L$ T$D$(Ѓ u c c 뽃uȋc c 11e ;a,D$0$D$4D$裤D$L$ T$L$T$$D$ D$8D$($D$ D$D$(D$D$ 7D$taw6uc c D$u c c D$HT$LL$P,Í%$L$6}L$ T$D$(Ѓ u c c 뽃uȋc c 11"e ;a e v u a e 9]FD$ $T$d d e u= d Le $u c e  Í=c =d FA+D$\$L$ T$̀=vD$D$؉D$]ÉD$T$D$GD$\$L$ T$t$|$l$̀=vD$ D$$؉D$(ÉD$ T$$D$(̋D$\$L$ T$̀=vD$D$؉D$ÉD$T$D$̋D$\$L$ T$t$|$l$̀=vD$ D$$؉D$(ÉD$ T$$D$(̋D$\$L$ T$̀D$T$f\$L$̀=vD$ ؉D$$ÉD$ D$$øf\$L$̀=vD$ ؉D$$ÉD$ D$$\$L$ T$t$|$̀=vD$D$؉D$.D$ e ;av7 Yu4D$t$BD$L$L$D$ i` b밍|$9;uĉ#e ;av0Yu-D$ t$D$D$` 뷍|$ 9;uˉ#e ;av0Yu-D$ t$rD$D$_ 뷍|$ 9;uˉ#e ;av+D$$D$D$D$eD$ D$Ne ;avID$$L$L$D$D$ tD$@L$I8D$1e ;av'Yu$D$t$^ |$9;uԉ#e ;av7 Yu4D$t$bD$L$L$D$ 9^ 2밍|$9;uĉ#e ;avJD$$L$L$D$odD$ L$ $D$D$$PdD$ D$e ;avAD$T$f9t 1D$ÃD$B$D$$dD$ Xe ;avBD$$L$L$D$L$ $D$D$ncD$ D$e ;aviD$H\$+s9t11Ʉu 1D$ÍK $D$D$nD$ ׉,$T$t$L$ D$\$p{e ;av0Yu-D$ t$¤D$D$ \ 뷍|$ 9;uˉ#e ;av0Yu-D$ t$蒤D$D$[ 뷍|$ 9;uˉ#e ;av/Yu,D$ t$肤D$D$a[ Z븍|$ 9;ủ#e ;av0Yu-D$ t$D$D$[ 뷍|$ 9;uˉ#e ;av/Yu,D$ t$D$D$Z 븍|$ 9;ủ#e ;av0Yu-D$ t$rD$D$@Z 9뷍|$ 9;uˉ#e ;av/Yu,D$ t$蒣D$D$Y 븍|$ 9;ủ#e ;av0Yu-D$ t$D$D$Y y뷍|$ 9;uˉ#e ;av/Yu,D$ t$D$D$!Y 븍|$ 9;ủ#e ;avD$D$_e ;avD$D$oe ;av:1L$ D$ T$‰$L$\L$D$ @=|ىL$Oe ;avnD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$D$ uD$ D$ ve ;av81L$ D$ T$‰$L$lL$D$ @ |ۉL$ae ;avkD$L$1\$S\$l$؉ };Ѝ,ыum{9uT$$l$|$D$ uD$ D$ ye ;av81L$ D$ T$‰$L$|L$D$ @|ۉL$qe ;avkD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$D$ uD$ D$ ye ;avd d $D$L$t9u%ID$L$ D$D$ É$T$'D$h Ue ;av1 f$L$u Ë@T$T$T$T$ $e ;av1 $L$u Ë@T$T$T$T$ $e ;av1 $L$u Ë@T$T$T$T$ $he ;af D$ L$$1B9 A T$,40-1Z9|7: 92 4-070utf00ut0Z 9-Z9|+ 9 ,-070ul0Z9|' 9 ,-07:u lf00tkZ9U 9M ,f-0l7 D$(T$,D$0)ى!؉D$4T$8Å D$(T$,D$0)ى!؉D$4T$8Å D$(T$,D$0)ى!؉D$4T$8Å 9 \$,$D$D$ bD$ uD$ L$$T$D$j L$ L$(D$,D$0D$$T$)Љ!D$4\$8Å: D$(T$,D$0)ى!؉D$4T$8Ã.Z9r l0C9}L <8؇ݗt9~9+ <З 59uC!) ݅9D$(T$,l$0)!D$4T$8ý 뻕9i0Z9j9 l16 9 ϕ)ى!ˍ g ^ D$(T$,\$0L$4t$8Ã21Z9|Pj9 l5u9 9D$(T$,D$0 )ى!؉D$4T$8ÅD$(T$,D$0B)щ!ЉD$4\$8ÍZ9|L9x,2006u1^D$(T$,D$0)ى!؉D$4T$8Å&D$(T$,D$0B)щ!ЉD$4\$8Ã3u2D$(T$,D$0 B)щ!ЉD$4\$8ÅD$(T$,D$0 B)щ!ЉD$4\$8ÃM5JJZ99,fJalnj9|394Januutfaru tytK)ى!ˍ tßw 7D$(T$,D$0L$4t$8ÅD$(T$,D$0)!D$4T$8É렃MZ929\$,fMotnr9|+9z<Mondu|fay)ى!ٍt] wQfMSu LTt D$(T$,D$0L$)Ήۇ!ȉD$4T$8ÅD$(T$,D$0\$4|$8ÅD$(T$,D$0)!D$4T$8ÉS]D$(T$,D$0B)щ!ЉD$4\$8ÃZPu_Z9j9lM9D$(T$,D$0)ى!؉D$4T$8ÃZZ9|794Z070utf00ut0Z 9-Z9|+9y,Z070ul0Z9|'A99,Z07:u lf00tkZ9 9,fZ0l7D$(T$,D$0)ى!؉D$4T$8ÅD$(T$,D$0)ى!؉D$4T$8ÅD$(T$,D$0)ى!؉D$4T$8Åi9a\$,$ D$D$ TD$ uD$ L$$T$D$L$ L$(D$,D$0D$$T$)Љ!D$4\$8ÅD$(T$,D$0)ى!؉D$4T$8Ã_Z9xj98t2]r9|n9 t$)t$ۇ!|$u@402006u5D$(l$,D$0T$)щ!ЉD$4\$8Å9D$(T$,D$0)ى!؉D$4T$8ÃpZ9j9lm9D$(T$,D$0)ى!؉D$4T$8ÉD$(L$,D$0D$4D$8)C "B B B C C B B B B B B B B B B B B B B B B B B B zA sB lA eB ^B WB PB IB BB ;A 4B -B &B B B A A B @ A A A A A A A A A @ ze ;aviD$L$T$ \$1E9}$$$! ! ! y! r! k! d! ]! V! O! xe $`;A $$H$H P$$1\$D$T$ L$\$D$`$$H\$$l$ l$$$4$51t$D$T$ L$t$D$ $$HP\$$l$ l$(t$t4$51t$D$T$ L$t$D$躩$$H@T$$\$ \$0l$T,$-1l$D$D$ L$l$D$hD$L$ L$,$5ڿ$$L$$$$$L$($$$L$0$ $D$,$$$D$D$D$ VD$L$$($, ËH P\$4$1\$D$T$ L$\$D$q$$H @$T$ \$L$D$$VD$D$ \$ T$.D$ L$$($, 謡7e ;aD$) d d D$\$\$D$L$T$ ËL$Ѐ wȃ[\$ t%d d D$L$D$\$T$ ҉T$HȉD$T$D$D$ YЀ wҍۍST$ȉD$T$D$D$ 衠e ;av.D$L$Iȉх~ tD$ L$Ke ;aD$L$T$\$ ى* tMt)08؇ݖuKI뽋d d D$$L$(T$,\$0ÉL$D$~ ( uE$\$D$D$L$ L$ T$$T$T$D$\$ l$ T$Bd d D$$L$(\$,T$0ÉD$$L$(D$,D$0e ;a`|$t1g|$8^L$d $L$hL$L$lL$L$pL$ c L$ c L$ t$|$8L$,L$4T$0|$Lt$8|$tt$LֻL$4$$`]He ;a`|$x1觶|$8螶L$d $L$hL$L$lL$L$pL$ L$tL$L$St$|$8DL$,L$4T$0|$Lt$8+|$xt$LL$4$$`襝Pe $;A+$1$$$$111ɈL$61҈T$7$1ۉ\$D$1ۉ$l$h1t$t1$1t$l1t$P1$1$$$$$L$$D$@D$DD$x$$D$8D$hD$5c ϋL$DL$@$L$xt$ht$8t$tt$<$$t$\l}Wd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$N:tWd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$N^ۇ$읺$$$$4 $D$D$$L$ 1҅1k<k<؋$+ub$t$\ˋ$$4L$DL$@$L$x$D$8L$tL$<$$$$-u땋 d 덉T$|$$D$N\$L$ $T$|A$$D$T$L$ $ }Wd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$N]=읺=읺$=읺$؉!\ }Wd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$-N:tWd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$N:uN^~$ۇ $߉달$}Wd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$N^~$ۇUu}Wd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$N^ۇ$=읺t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$ O9}Wd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$L$p4$l$L$!D$ L$T$\$l$pt$T92)ۇ!$։$ˋL$DL$@$L$x$T$hT$8T$tT$<$$D$l$$}Qt$\$L$DL$@$L$x$L$hL$8L$tL$<$$$.uN0r9w1ك }Y9}|10r9v߉4$l$A$D$ D$ L$T$\$$t$T9)ۇ!$։$ˋL$DL$@$L$x$T$hT$8T$tT$<$$D$l$$,;c |c xc $L$D$t$ l$D$\$ |$l$@$t$\L$DL$@D$x$L$hL$8L$tL$<$$$$`c \c Xc $L$D$t$ l$kD$\$ |$l$@$t$\L$DL$@D$x$L$hL$8L$tL$<$$$$x8t $pc lc hc $L$D$t$ l$\$ |$l$$$t$\L$DL$@$L$x$D$hD$8D$tD$<$$$Pc Lc Hc $L$D$t$ l$&\$ |$l$$$t$\L$DL$@$L$x$D$hD$8D$tD$<$$$14$l$D$KD$ L$T$\$h v^5$׋T$DT$@D$xT$hT$8T$tT$<$$$$݉ˋ$l$\$렁  }^d $t$\$L$DL$@$L$x$D$hD$8D$tD$<$$$Ѐ w4$D$D$Txۇ$,L$\$ $t$\ljL$@$D$x$D$hD$8D$tD$<$$$p$ E$L$ D$OD$ L$T$\$}l5$׉$T$DT$@$T$xT$hT$8T$tT$<$$$$݉ˋ$l$\$뒉Q}Wd t$\$L$DL$@$L$x$L$hL$8L$tL$<$$$4$D$D$T$ЋT$\$ E|Ult$\ωʼnT$@$D$x$D$hD$8D$tD$<$$$$멁 4$l$D$D$ L$T$\$rl5$׋T$DT$@$T$xT$hT$8T$tT$<$$$$$݉ˋ$l$\$뒁lE4$l$D$D$ L$T$\$D$D$0 Í0$ D$9 \Me ;av\(D$, 9u3H.|$yD$0$D$D$ D$t($L$'D$4 [e ;av% D$$D$D$wD$D$ [e ;aD$ $D$$D$3D$ D$L$L$$ED$L$H L$H e uP XH H e u"L$(H$D$H $觔D$D$,Íx$D$(}rӍxXirZ+e ;avA D$ 9u$D$D$9n É$L$'D$ xZe ;avcD$ $D$$D$D$D$ D$L$T$tD$(L$,T$0ÉD$(D$,D$0Ye ;avCD$ $D$$D$D$(D$D$,D$ gID$L$T$D$0L$4T$8Ye ;av D$$O] fYe ;a; D$4T$$$D$D$L$ 8D$L$D$(L$,T$0)ȋT$0)ʉ!ыl$(͉ډD$(L$,T$0\$$$D$L$T$ dHD$L$T$~ D$,9vuJ$e|$G e u&pD$8|$< Í&oD$8T$< D$8D$< ÉD$8L$< 1 Xe ;ar D$(T$$!م ˄$D$ND$D$L$$ $T$(T$BD$D$L$ L$~$Te |$D$L$O L$OL$$OL$(O e uJ XO O e uG$|$G$蘐D$D$, ÍO$pnՍOωÍXXn؉륋D$Inh$|$G#e u   nt$|$* sVne ;avD$ $1Ve ;aD$ PL$  ыT$щ $֋t$Ã!˃ لu8ǀ׉x h ?@HыP HL$ʉP ËL$?$ щ XËT$6Ue ;a3D$L$ T$ !ыl$ ȉ É؁À׃ t ʼn Ձ€ŀ׃ $9Ç9!9Ç t D$09!ŕt?$%?91ҋT$$|$(럋t$\$ZD$L$T$(\$$9ЇÇ9!9 L$0Se ;aD$ L$T$4!Ћl$0L$z ȉD$ ljǀ׋L$׃ l$T$ T$ D$l$ ʼnŀ׋T$׃ 99Ç!9 ŕt D$DÅD$ Ɖ ˁÀ׃ \$t^\$ l$  މƀÀ׃ 99!ʄt%??9c1\t$8|$VD$ L$L$@D$D8Í d DHD$@L$D8z Oe ;a8L$<|$$1gL$$ $D$D$L$D$L$ T$ D$,L$0T$($L$D$<D$ 9D$L$L$ D$D$4$L$(L$D$ D$D$(L$, $L$0L$D$<D$ AD$L$…!Ӆ ӄT$(Z =D3m)D$,\$(L$0$L$D$<D$ yD$L$L$ D$D$4$L$(L$D$ MD$D$(L$, $L$0L$D$<D$ D$L$…!Ӆ ӄtET$(Z swD3h|gT$4$\$D$ L$ D$D$L$'*L$'ɋD$(L$'ɋD$( ؉菽 舼 聽 z s l e ^ W @{e ;a(11ɋT$0\$\$$D$8$D$e ;avD$D$ D$D$=e ;a0D$4$L$8L$D$ʚ;D$  D$D$L$L$T$4$T$8T$D$ʚ;D$ /D$D$$L$L$ T$$T$T$ D$D$(D$ $D$$D$D$ @^L$(XL$<0=e ;a0D$4$L$8L$D$XGD$ # D$D$$L$L$ T$4$T$8T$D$XGD$ ? D$D$L$L$T$ $T$$T$D$D$(D$$D$D$D$ P^L$(XL$<0<e ;a0D$4$L$8L$D$0D$ F3 D$D$$L$L$ T$4$T$8T$D$0D$ FO D$D$L$L$T$ $T$$T$+D$D$(D$$D$D$ D$ X^L$(XL$<0 ;e ;avrD$(T$$!م ˄tD$D$,D$ D$0ËL$ $\$ \$T$D$ l D$L$)D$L$,L$ L$0:re ;a D$,T$0!م لL$$ $\$(\$D$T$ D$L$T$$Ël$(Ç!ޅ 1)É1)ǸȉD$|$09Çދl$,9!9 ƖuS)щ)D$(ӋT$99!9 ؄t L$4T$8 D$4D$8 щL$4D$(L$ȉD$8 ÉL$ɋ|$09Çދl$,9!9 ƖuO)ŋl$()ًL$99!9 Ȅt T$4|$8 D$4D$8 )ډT$4D$(L$ȉD$8 ËD$$D$4D$(D$8 8e ;a(0|$P1PL$H $T$LT$D$ʚ;D$ L$L$$T$T$ \$4\$,l$H,$t$Lt$D$ʚ;D$ L$,?L$ʚ;vD$ T$$6eċ\$4 L$8 \$4L$8L$4 $D$T$D$8L$4D$EL$T$tD  ‰Ё€׉T$ ׃ L$D$%?D$D$D$|$t$IP,ke ;a|$1D c d 9un1L$T$tF  ʉс€׉T$ ׃ \$L$?L$D$D$|$t$IÉ+Se ;a|$$1CL$ td 9uq1L$ T$tF  щʁ׉L$€׃ \$L$ ?L$ D$D$|$$t$ KHÉ덍0$(D$} *1e ;avD$tD$Ëc *e ;a(D$0L$,t`  ȁ׃ nD$<$L$T$O"D$L$T$ T$@D$DL$H(ËL$4T$8)_e ;avWD$L$t9  ȁ׃ nL$T$ËL$ T$r)e ;aL$T$tj ډ ʉс€׃ йʚ;?؉=D$iʚ;ځ=T$ËL$ l$Ӊ(Te ;aD|$0t$HED$@[ c 9@fD$"L$HL$,T$L   щʁ€׃ L$$l$($D$ x5tEL$(HPHPL$$ ʈP ݈݇X݉ ʈPXL$,ʁ?H X H P L$"fH PD$\D$`D$dD$hD$lDËl$TT$Pt$HDD$)k<9uz=}b$|$G*e u2DžD$\D$`D$dpD$h|$lDÍDž(>Ƀt=$g|$G5e u2D$\D$`D$dpD$h|$lDÍ=ɋc #&^e ;aDL$PRT$LYZj j  Z  j Z Z Z ݋\$Tkۇt*t$@qt*\* \* T* ڃL$H\$Tl$@t\ ދe }ω1Q=L$HQYi k+` Be ;a.dD$hL$l Љ ȉ׃ Ç!ͅ ?1)څ}˃ʚ;L$0T$4\$D$X$Çދ|$|ʚ;!Ç ޖ<$l$D$ʚ;D$ D$L$!D$Xʚ;ËD$09Ç!9 \$4؉9ӇÇ9Ç!9 tT$|$T$ssu|`$L$T$D$$D$ D$L$L$(D$,$L$D$D$$D$ lD$L$L$(D$,| { Pe D$;ADŽ$DŽ$DŽ$Ƅ$$$$$$$Ƅ$$$$ DŽ$DŽ$DŽ$Ƅ$11Ƀ] TZifO $$$ DŽ$DŽ$DŽ$Ƅ$11Ƀ  t2t 3 |$l11 T$lA}ZD$T$$ D$L$tL$Trg d d DŽ$$$ËD$x$$$9 DŽ$DŽ$DŽ$Ƅ$111DŽ$DŽ$DŽ$Ƅ$$$$Ƅ$D$x$$$9 DŽ$DŽ$DŽ$Ƅ$11ɋT$|R⋜$$$9e DŽ$DŽ$DŽ$Ƅ$111DŽ$DŽ$DŽ$Ƅ$$$$Ƅ$$$$$9 DŽ$DŽ$DŽ$Ƅ$111D$($t$t$$$9 DŽ$DŽ$DŽ$Ƅ$D$p$$$9DŽ$DŽ$DŽ$Ƅ$11ɉD$D$t$l$$$9DŽ$DŽ$DŽ$Ƅ$11$D$@$T$\\$X$D$|D$ 3 $D$D$D$$L$L$ T$ $1l$LED$$L$ ډ9\$L$$]D$L$\L$LT$ 9} $D $$$DŽ$DŽ$DŽ$Ƅ$11Ƅ$11`D $$$DŽ$DŽ$DŽ$Ƅ$11Ƅ$11twt$X9}l|L$hL$\)!$ $)Ɖt$\$D$L$ T$h$De <u _Sd d DŽ$$$J$~$x$ۇ$$d d DŽ$$$]|$C sۇ41{ۇ<9{ۇ<9{{ۇ 49L$+AD$D$ $D$ $D$IID$D$ $D$$D$ @D$(D$@L$$$$?|$D$@Ge uK$DŽ$DŽ$DŽ$p$$VkĸË$s밋17$堻D$D$$D$ $D$D$$L$L$H$u|$D$HGe uK$DŽ$DŽ$DŽ$p$$jĸË$밋$$+$kۇ $T5x$Z $ +?$ iĸn_ g_ `_ Y_ R_ K_ D_ =_ 6_ /_ (_ !_ _ _ _ 5e ;a$D$4H)ȉ!D$0,tzdau LftatH$\$D$(D$D$,D$ D$ L$T$\$l$l$8\$T$(tD$4둅t$Y- 9tyuD$4i- D$<$L$@L$\$l$ T$D$L$T$t댉L$PD$TD$X8Å$ﻻD$D$D$Yu;D$t%@ $D$;D$ L$L$D$2W +멍|$9;u#e ;avNYuKD$t5H$L$D$ D$D$$D$ KD$L$L$(D$,V 뙍|$9;u#e ;av:Yu7D$t!@ $D${D$D$FV ?뭍|$9;u#e ;av>Yu;D$t%H$L$D$ L$L$D$U 멍|$9;u#e ;avNYuKD$t5H$L$D$ D$D$$D$ kD$L$L$(D$,bU [뙍|$9;u#e ;avBD$$L$L$D$L$ $D$D$x[D$ D$e ;aveD$H\$k39t-1Ʉt#KP9uK @ 8D$11$t$L$xL$ D$\$de ;av+D$$D$D$D$ ZD$ D$e ;av,D$D$D$$D$ D$ D$e ;av7 Yu4D$t$D$L$L$D$ yS r밍|$9;uĉ#e ;av D$$L$L$'D$L$Q$D$D$L$Q$D$D$L$Q$D$D$L$ $D$D$D$ ee ;a=D$H\$k391ɄH Pks 91ɄHPks9tt1ɄtjHSkp9t;1Ʉt1H$S$[ @ 9t 1D$É$D$T$D$ 1݉,$t$T$ L$ D$\$1뤉,$T$t$ L$ D$\$l1e,$T$t$ L$ D$\$)1"4$T$l$ L$ D$\$he ;av^DYu[|$T1t$Ht:D$LD$D$PD$腖t$|$0f|$Tt$0YDP 뉍|$H9;u#e ;avfHYuc|$\1$t$LtBD$PD$D$TD$D$XD$t$ |$4|$\t$4HZP S끍|$L9;u#e ;av?,Yut$$t(0D$L$T$D$(L$,T$0 oN h릍|$$9;u#e ;avA Yu>t$$t(0D$L$T$D$(L$,T$0 M 릍|$$9;u#e ;av1Yu.t$t萁D$D$ M 붍|$9;uʉ#e ;av?,Yut$$t(萕D$L$T$L$(D$,T$0 A 릍|$$9;u#e ;av7 Yu4D$t$"pD$L$L$D$ A 蒿밍|$9;uĉ#e ;av>Yu;D$t%H$L$蛽D$L$ D$L$2A +멍|$9;u#e ;av81L$ D$ T$‰$L$L$D$ @ |ۉL$e ;avkD$L$1\$S\$l$؉ };Ѝ,ыum{9uT$$l$|$ND$ uD$ D$ .ye ;av:1L$"D$ \$؉$L$L$D$ @|ىL$Ͻe ;aD$ L$$1S,l$t| , 9t0ult 9ul T 8ЕtD$(É\$T$D$$l$t$(l$ D$ L$$T$\$D$(;e ;av;1L$#D$ @\$$L$YL$D$ @|؉L$螼e ;aD$ L$1$S}d$Rl4|9Ç9 Օu1T l8•uT l 8•uT \ 8tD$D$Ye ;av81L$ D$ T$‰$L$L$D$ @|ۉL$葻e ;avkD$L$1\$S\$l$؉};Ѝ,ыum;[9uT$<$l$\$D$ uD$ D$ ye ;avu3D$D$ ƺe ;avD$裺e ;avD$胺e ;aL$T$\$ l$щډiq9l$\$w4$L$ OL$9,$9!9 ˄uRT$L$)L$L$IT$JHJ)\$-e  uf8Zu?L$9w7)͉oT$)ʉWe !ʋL$ u;6 de ;aD$$D$L$u<ƒu/T$$L$ D$D$tD$ D$ Í0$D$lC 赸`e ;a:(D$,$)D$L$ʃÃÇ݃\$ T$$T$,$L$ %D$GD$tD$$L$ 4D$L$D$ T$,Z$ND$L$D$ © ڄu3D$L$D$ T$,Z $MD$L$D$ uD$0(D$0(Í0$D$B [e ;aD$ $D$L$ƒuAD$T$ $D$ L$D$tD$%D$$Í0$D$iA 貶]e ;ao4D$< D$8H1T$,t$(|$$L$0\$l$ D$8$D$L$T$,Ã\$tb уÇ݃T$8$L$ D$D$tD$uD$0$KqD$@4Ël$t$ |$(LJÇߋt$$·Ç!t*D$@4ËD$8H 1۽10$D$? 0$D$? qe ;aT8D$@ D$<H1t$ T$0|$$\$,L$4l$(D$<$CD$L$T$0ÃÃ!ʃŃt$,Ç݋|$( ͕D$t L$ )ʋL$$ȉT$L$< $T$ D$?D$aD$uD$%D$D8ËD$4$J؋D$<H 110$ȹD$X> 衳e ;av`D$ $D$u2D$ @&td d D$L$Ëd d D$D$e ;avN D$$D$t D$$ D$L$L$D$ D$D$ 諲e ;ave D$$D$D$u2D$@&td d D$L$ Ëd d D$D$ $e ;av1 D$$D$D$u ËD$$ رe ;ave D$$D$D$u2D$@&td d D$L$ Ëd d D$D$ Te ;av1 D$$D$D$u ËD$$ e ;ae $DSD$D$ @$ D$L$tLu&%$L$KD$ L$L$$D$(ÉD$L$$:D$$ L$븋L$D$$D$(IDe ;av'D$uÉ $5 D$e ;avD$uÉ$̯e ;aD$te$D$D$ D$u11ɉD$ L$$Ãu%D$td d ؋d d ʃu"c c D$ D$$ÉD$ Hl$D$EQD$ $D$OJI0$йD$9 ɮe ;av4D$$D$rD$D$D$L$ L$ D$$ue ;av4D$$D$wD$D$~D$L$ L$ D$$%e ;aD$uJ$m|$G!e upD$ |$$Í5$D$D$ D$u11ɉL$ D$$Ãu+D$td d ‰ȉҋd d u c c 뱉D$ Fl$D$iOD$ $D$MHD$L$ L$ D$$Ee ;av8$D$($|$t$,uD$D$ L$L$@D$D$e ;av8$D$($|$t$,D$rD$ L$L$@D$D$葫e ;av8$D$($|$t$,D$w*D$ L$L$@D$D$1e ;a @D$`D$dt$HJxD$D$L$L$ $L$ȋT$\$ څ҇Ç݅!҇Ç ! lL$(|$,t$HL$0T$,( ډ ʉс€׃ !ф?11ɉD$$L$(T$D$UD$L$D$DD$$ 0SL$G)ucD$D@ud d L$`D$d0@É$D$$D$D$(D$D$\D$ D$`D$d0@Ð0@ÉL$`D$d0@ËL$(21L$4l$8Ӊe ;aD$ D$$D$$+D$L$u]D$D$$ 0SL$!(u1D$@$D$D$覮D$L$ D$ L$$/Ð/ÉL$ D$$/;Fe ;aD$$D$(D$$kD$L$ueD$D$$ 0SL$a'u9D$@$D$D$D$ D$D$L$ L$$D$(.Ð.ÉL$$D$(.s>e ;aD$$D$(D$$D$L$ueD$D$$ 0SL$&u9D$@$D$D$D$ D$螼D$ L$D$$L$(.Ð.ÉL$$D$(-裦>e ;aD$D$ D$$D$L$uUD$D$$ 0SL$%u)D$@$辯D$L$D$L$ X-ÐN-ÉL$D$ <-Ne ;avD$umD$=fileu`D$@&L$ t4H $D$D$ L$t T$B L$$D$(@ D$$D$(ËD$:ee ;avbD$H $c D$H $ ыD$D$L$L$ T$B$:D$ D$D$D$ 跤e ;aD$$D$u2D$@&td d L$D$ Ëd d D$H $?D$$#D$L$T$Z t L$D$ ÉD$L$ B$a9D$L$ =e ;aD$ D$$D$$D$L$u]D$D$$ 0SL$#u1D$@$D$D$薌D$L$ D$ L$$*Ð*ÉL$ D$$*+Fe ;aD$D$ D$$[D$L$usD$D$$ 0SL$Q"uGD$H $D$D$@$D$LD$L$ D$L$ )Ð)ÉL$D$ )U0e ;a D$4D$8D$<D$$$sD$L$D$$D$$ 4SL$u!{D$,MD$$H&L$HL$ $D$L$ D$$H$L$,@~@L$,D$$L$,P$T$(T$L$\$0\$ D$L$T$J 9uz uoL$l$$utZE&D$ $)D$ L$z1҅utT$4L$8D$<-( Ë\$$[%tދd d Љ‰뾉뺉붉Ӊʉ밋L$,D$4D$8L$<' D$4D$8D$<' Ð' D$4D$8L$<' 9e ;a0D$4${D$L$D$4H$L$<@~@P$T$8T$L$L$@L$ L$DL$L$HL$۷D$L$L$$T$ T$,t1D$(L$4 $qD$(u6L$$tT$,D$LL$PT$T0ËT$4R%t d d ֋L$$̋L$D$8H&L$HL$0 $D$L$ D$8H $L$OD$L$/D$,t:D$ L$$D$4L$8D$<D$@D$DD$H0Í;$.1D$D$( td L$D$ $ WL$D$ D$$7D$D$ 趏D$TD$D$(D$ L$$L$$%$D$D$ D$L$ D$4D$8T$'„tڋȐd 9t1̉$L$̐d D$tD$ 11…뭍 X?e ;avoD$$D$D$7D$ L$t!Q 9uu D$Ëd 9t1 $D$d D$ƢD$ Xue ;aD$$D$D$D$L$ tvP 9ue u D$ÅtIP9u>„tڋd 9t1̉$L$d D$D$ 11…뭍 DW?e ;avXt$D$D$L$L$H `r $D$ `L$ TUL$ D$D$ Ve ;av D$ $D$byVe ;av%D$ $ʄD$D$4Ve ;avVa$D$Ve ;avg$D$($L$,L$ׂD$($D$,D$D$0D$D$4D$ D$8D$D$؍Ot>밍e>뇉$L$d T$}qD$ td Đd $L$D$$L$d T$@qD$ t |$D$XD$L$D$(D$, ÉT$(L$, ËАd Ԑd e7&2e ;atD$8D$<D$@D$D|$L$ECL$LT$P0 ى ʉс€׃ ʚ;?؉=D$($iʚ;Ӂ=\$0\$D$ʚ;D$ L$L$ T$($T$0T$D$ʚ;D$ L$T$Å҇Ç!݅ ͕Oʚ;L$ L$8T$<|$`$0BL$dT$` ډ щʁ€׃ ʚ;?؉=D$$$iʚ;ځ=T$,T$D$ʚ;D$ L$L$T$$$T$,T$D$ʚ;D$ L$T$Å҇Ç!݅ ͕"ʚ;D$D$@T$DD$x$L$|L$T$8T$D$ D$D$L$D$HL$4 $[|$Ge u| L$|O e uML$xOL$4O e uD$HGp $$tÍOω‹D$H:ҍOω‹D$xn:뤍_:|DŽ$DŽ$tËD$L$hl$lL$ l$XT$T"Ve ;a D$$11҅v $蓕D$L$FD$L$d 9d 9L$D$ $|$Ge ut &L$$ A(I,O e uCGL$O e uD$Gp D$(|$, ÍOω‹D$9؍O8밍&8뇉$L$d T$kD$ td Đd $L$D$$L$d T$kD$ t |$D$XD$L$D$(D$, ÉT$(L$, ËАd Ԑd e 2e ;avZ D$$tA11҅t T$|$Ge uv cغL$ O e uGL$OL$O e uD$Gp D$$|$(ÍOω‹D$m)؍Oω‹D$W)몍cغH)녋GD$L$:D$$D$(D$$D$(e ;av<̺$D$D$L$ u D$L$e ;a1 D$$$L$(L$T$,T$\$0\$ D$L$D$L$s$|$Ge  L$(O e uuL$$OL$0O e uGL$,OL$O e uD$GP D$4|$8 ÍOω‹D$'؍Oω‹D$,'몍Oω‹D$$t'yb'QD$4D$8 e ;a1 D$$$L$(L$T$,T$\$0\$ D$L$D$L$s$-|$Ge  L$(O e uuL$$OL$0O e uGL$,OL$O e uD$GP D$4|$8 ÍOω‹D$@&؍Oω‹D$,*&몍Oω‹D$$&y&QD$4D$8 de D$;Ad $D$D$L$T$ \$ T$d\$86$D$脮D$L$ ~ /gD$D$DL$L$$T$ T$x$\$T-c $T$uD$D$Du/11ɋT$T$T$$$$$ĄÍ@]$"|$Ge u@ eL$DO e uD$xG  눍O ω‹D$xq$eb$뻍 d $RR(d $ ,d L$P d $mUD$P$D$ D$L$T$ \$e 9Nыl$8949؋t$d$\$֍Oω‹D$$(뤍|D$0D$4 K D~ =~ fe ;a`D$d$L$hL$CD$ L$uD$lD$p`ÉD$XL$4 $D$OD$uϋD$d$L$hL$D$L$ T$\$ p 9uwt D$lL$p`ÉT$@D$$L$\BJ$L$D$tD$lD$p`ËD$@H@t@ 9utʋD$$L$\덉Ѻ낋C $D$\$9 @$D$.ID$ L$ Аd e Ԑd i$D$HD$ L$ d e d ɻ$D$HD$L$ Ȑd e h ̐d ɻ$D$HD$L$ d e  d ɻ$D$NHD$L$ d e  Đd d d ؐd e ܐd t$D$GD$L$ d e T d D$ $T$\$d e  d d e d De $D$D$ e L$  ud ^ $)D$D$ ^e L$ uY ud ^ $)D$D$ *e L$ u |ud e Í=|ud =ud 랍=ud {X=d k=d ‰W=d C=ܐd 3X=Đd ! =d =̐d =d D=Ԑd S^e ;avYD$$L$L$yD$L$Q($D$#D$L$0 $D$D$akD$ D$e ;aD$$L$L$yD$thD$H,T$Z,j(p(9t11Ʉu 1D$Ã0D$B0$D$H D$ ׉,$t$\$1 L$ D$T$벋D$T$1Le ;av0Yu-D$ t$D$D$c 뷍|$ 9;uˉ#e ;av0Yu-D$ t$D$D$`c Y뷍|$ 9;uˉ#e ;av/Yu,D$ t$D$D$c 븍|$ 9;ủ#e ;av7 Yu4D$t$D$L$L$D$ b 밍|$9;uĉ#e ;avh D$$L$L$G!D$L$Q$D$0!D$L$Q$D$!D$L$ $D$#D$D$ |e ;aD$H\$k391ɄH Pk s9tt1ɄtjHPks9t;1Ʉt1KSX@9t 1D$É$L$\$ *D$ 1݉4$T$l$BL$ D$\$1뤉4$T$l$L$ D$\$l1e4$T$l$L$ D$\$)e ;avQ D$$L$L$D$L$Q$D$D$L$ $D$9"D$D$ he ;aD$H\$k39tt1ɄtjH Pk s9t;1Ʉt1KSX@9t 1D$É$L$\$(D$ 1݉4$T$l$L$ D$\$1뤉4$T$l$L$ D$\$l1e ;av: D$$L$L$WD$L$ $D$!D$D$ ?e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$'D$ 1݉4$T$l$L$ D$\$qe ;avBD$$L$L$gD$L$ $D$D$dD$ D$Ge ;aviD$HT$Z*09t11Ʉu 1D$ÃD$B$D$D$ ׉,$t$\$L$ D$T${e ;avBD$$L$L$D$cD$ L$ $D$XD$D$We ;avVD$T$9u?JX9u1HZ R@ 9t 1D$É$L$\$D$ 11e ;avD$D$? e ;avD$D$O#e ;av> D$=Ѓ D$ Ë @c $D$D$D$ +e ;av\D$=w _ D$É$c c c L$T$D$ D$D$e ;avL1L$ AL$9}-D$ L$$T$T$-D$tD$$D$$=e ;avH D$=w _ `D$ Ë c $D$cD$D$ e ;avH D$=w _ D$ Ë c $D$D$D$ ae ;ava D$=w4 Hw D$ à tD$ =t=t c $D$jD$D$ e ;a6L$rT$ \$1@9}W ,@4jf9r<|jf9wLjfu D$)f1ffD$D$D$f=vT$ 1t$9}r)<)9skt$4Zf9w $\Zf9vf9rl)|$뱋 $LJfu D$)ft1ffD$kT dR ]T VR e ;a L$hT$\$1@9}N,@49r5|9wLu D$ )1D$ D$ ËT$\$19}t)<)9smt$<$4||$|49w9v9s $뻍l)L$뱋L$u D$ )t1D$ $S Q S Q 8e ;aD$HX~o,[ljt$9~=H P@~9} D$ É $D$T$t$ WD$D$ É$\$L$ft$ D$D$ Ët$Xe ;aD$PXh9r94Rtq|$9;9wzDm)!ȉ$)T$t$f|$ 7D$D$ ËH P@~9} D$ É $D$T$|$ ZD$D$ Ë|$P {O e ;avK D$=w _ ` D$ Ë Ыc $D$D$D$ .e ;aD$ L$(T$$\$,1L$(l$,ƋD$ 9)\$D$094$|$,,|$L$9l$ 9~9}$똋 $D\$닋D$ \$~)ʃ  D$4D$8ÍD$4D$8ÉT$4D$8D$4D$8M e ;avAD$ $D$$D$c c c L$D$ T$D$D$(e ;av; D$HwD$ $D$_D$D$ Ne ;av; D$Hw D$ $D$D$D$ e ;av; D$HwD$ $D$D$D$ e ;a D$== c c T$1 |$͉9}1)<)99}L)lj9} sc  9t0$D$L$9tD$ É $$D$D$ ÍDD$ Í _ AD$ ÉD$ ZK SK |e ;aN,e v,uN e  $D$$D$YD$ D$( c L$$ $D$!\$D$ |$e /ND$$c D$$  $T$(T$&\$D$ W|$e MD$$c D$$  $T$(T$(\$D$  |$e {MD$$c D$$  $T$(T$*\$D$ |$e !MD$$c D$$  $T$(T$,\$D$ s|$e LD$$ةc D$$  $T$(T$&\$D$ '|$e mLD$$c D$$  $T$(T$>\$D$ |$e LD$$c D$$  $T$(T$@\$D$ |$e KD$$c D$$  $T$(T$B\$D$ C|$e _KD$$ c D$$  $T$(T$D\$D$ |$e KD$$c D$$  $T$(T$F\$D$ |$e JD$$c D$$  $T$(T$'\$D$ _|$e QJD$$8c D$$  $T$(T$L\$D$ |$e ID$$@D$$c D$$  $T$ T$\$D$ |$e ?D$$c D$$  $T$ T$ߺ\$D$ K|$e ?D$$c D$$  $T$ T$\$D$ |$e 0?D$$c D$$  $T$ T$+\$D$ |$e >D$$Ĩc D$$  $T$ T$\$D$ g|$e |>D$$Ȩc D$$  $T$ T$5\$D$ |$e ">D$$̨c D$$  $T$ T$)ߺ\$D$ |$e =D$$Шc D$$  $T$ T$%\$D$ |$e n=D$$بc D$$  $T$ T$\$D$ 7|$e =D$$ܨc D$$  $T$ T$ ʺ\$D$ |$e <D$$c D$$  $T$ T$7ߺ\$D$ |$e `<D$$c D$$  $T$ T$\$D$ S|$e <D$$c D$$  $T$ T$I\$D$ |$e ;D$$c D$$  $T$ T$\$D$ |$e R;D$$c D$$  $T$ T$#ʺ\$D$ o|$e :D$$c D$$  $T$ T$\$D$ #|$e :D$$c D$$  $T$ T$5ʺ\$D$ |$e D:D$$c D$$  $T$ T$d\$D$ |$e 9D$$ c D$$  $T$ T$\$D$ ?|$e 9D$$c D$$  $T$ T$Mʺ\$D$ |$e 69D$$c D$$  $T$ T$Yʺ\$D$ |$e 8D$$ c D$$  $T$ T$v\$D$ [|$e 8D$$$c D$$  $T$ T$ߺ\$D$ |$e (8D$$(c D$$  $T$ T$\$D$ |$e 7D$$4c D$$  $T$ T$ߺ\$D$ w|$e t7D$$8c D$$  $T$ T$\$D$ +|$e 7D$$Dc D$$  $T$ T$v\$D$ |$e 6D$$Hc D$$  $T$ T$8ջ\$D$ |$e f6D$$Lc D$$  $T$ T$\$D$ G|$e  6D$$Pc D$$  $T$ T$\$D$ |$e 5D$$Xc D$$  $T$ T$\$D$ |$e X5D$$\c D$$  $T$ T$l\$D$ c|$e 4D$$`c D$$  $T$ T$˺\$D$ |$e 4D$$dc D$$  $T$ T$\$D$ |$e J4D$$hc D$$  $T$ T$4\$D$ |$e 3D$$lc D$$  $T$ T$\$D$ 3|$e 3D$$pc D$$  $T$ T$\$D$ |$e <3D$$tc D$$  $T$ T$\$D$ |$e 2D$$xc D$$  $T$ T$ ˺\$D$ O|$e 2D$$|c D$$  $T$ T$\$D$ |$e .2D$$c D$$  $T$ T$˺\$D$ |$e 1D$$c D$$  $T$ T$˺\$D$ k|$e z1D$$c D$$  $T$ T$\$D$ |$e  1D$$c D$$  $T$ T$ \$D$ |$e 0D$$c D$$  $T$ T$\$D$ |$e l0D$$c D$$  $T$ T$F\$D$ ;|$e 0D$$c D$$  $T$ T$\$D$ |$e /D$$c D$$  $T$ T$.\$D$ |$e ^/D$$c D$$  $T$ T$m˺\$D$ W|$e /D$$c D$$  $T$ T$\$D$  |$e .D$$c D$$  $T$ T$6\$D$ |$e P.D$$ĩc D$$  $T$ T$>\$D$ s|$e -D$$ȩc D$$  $T$ T$\$D$ '|$e -D$$̩c D$$  $T$ T$\$D$ |$e B-D$$Щc D$$  $T$ T$y˺\$D$ |$e ,D$$ԩc D$$  $T$ T$N \$D$ C|$e ,D$$ܩc D$$  $T$ T$뢺\$D$ |$e 4,D$$c D$$  $T$ T$\$D$ |$e +D$$c D$$  $T$ T$˺\$D$ _|$e +D$$c D$$  $T$ T$Ź\$D$ |$e &+D$$c D$$  $T$ T$^\$D$ |$e *D$$c D$$  $T$ T$f\$D$ {|$e r*D$$c D$$  $T$ T$T\$D$ /|$e *D$$c D$$  $T$ T$˺\$D$ |$e )D$$c D$$  $T$ T$˺\$D$ |$e d)D$$ c D$$  $T$ T$\$D$ K|$e  )D$$$c D$$  $T$ T$r \$D$ |$e (D$$(c D$$  $T$ T$|\$D$ 賿|$e V(D$$,c D$$  $T$ T$>\$D$ g|$e 'D$$0c D$$  $T$ T$\$D$ |$e 'D$$4c D$$  $T$ T$CN\$D$ Ͼ|$e H'D$$@c D$$  $T$ T$<\$D$ 胾|$e &D$$Dc D$$  $T$ T$PN\$D$ 7|$e &D$$Hc D$$  $T$ T$ \$D$ |$e :&D$$Lc D$$  $T$ T$ֻ\$D$ 蟽|$e %D$$Pc D$$  $T$ T$p\$D$ S|$e %D$$Xc D$$  $T$ T$x\$D$ |$e ,%D$$\c D$$  $T$ T$ \$D$ 軼|$e $D$$`c D$$  $T$ T$\$D$ o|$e x$D$$dc D$$  $T$ T$\$D$ #|$e $D$$hc D$$  $T$ T$\$D$ ׻|$e #D$$pc D$$  $T$ T$ \$D$ 苻|$e j#D$$xc D$$  $T$ T$,\$D$ ?|$e #D$$|c D$$  $T$ T$\$D$ |$e "D$$c D$$  $T$ T$ \$D$ 觺|$e \"D$$c D$$  $T$ T$\$D$ [|$e "D$$c D$$  $T$ T$\$D$ |$e !D$$c D$$  $T$ T$\$D$ ù|$e N!D$$c D$$  $T$ T$N\$D$ w|$e  D$$c D$$  $T$ T$\$D$ +|$e  D$$c D$$  $T$ T$ \$D$ ߸|$e @ D$$c D$$  $T$ T$\$D$ 蓸|$e D$$c D$$  $T$ T$,\$D$ G|$e D$$c D$$  $T$ T$\$D$ |$e 2D$$c D$$  $T$ T$\$D$ 请|$e D$$c D$$  $T$ T$\$D$ c|$e ~D$$c D$$  $T$ T$$\$D$ |$e $D$$Īc D$$  $T$ T$\$D$ ˶|$e D$$c D$$  $T$ T$=\$D$ |$e pD$$c D$$  $T$ T$ \$D$ 3|$e D$$c D$$  $T$ T$,\$D$ |$e D$$c D$$  $T$ T$\$D$ 蛵|$e bD$$c D$$  $T$ T$\$D$ O|$e D$$(c D$$  $T$ T$s\$D$ |$e D$$8c D$$  $T$ T$K̺\$D$ 跴|$e TD$$\$D$ |$e *D$$|c D$$  $T$ T$\$D$ 迱|$e D$$c D$$  $T$ T$ \$D$ s|$e vD$$c D$$  $T$ T$>\$D$ '|$e D$$c D$$  $T$ T$̺\$D$ ۰|$e D$$c D$$  $T$ T$\$D$ 菰|$e hD$$c D$$  $T$ T$\$D$ C|$e D$$c D$$  $T$ T$̺\$D$ |$e D$$c D$$  $T$ T$\$D$ 諯|$e ZD$$c D$$  $T$ T$\$D$ _|$e D$$c D$$  $T$ T$캺\$D$ |$e D$$c D$$  $T$ T$\$D$ Ǯ|$e LD$$c D$$  $T$ T$̺\$D$ {|$e D$$c D$$  $T$ T$̺\$D$ /|$e D$$c D$$  $T$ T$̺\$D$ |$e >D$$c D$$  $T$ T$p\$D$ 藭|$e D$$c D$$  $T$ T$\$D$ K|$e D$$c D$$  $T$ T$\$D$ |$e 0D$$īc D$$  $T$ T$ \$D$ 賬|$e D$$ȫc D$$  $T$ T$\$D$ g|$e |D$$ԫc D$$  $T$ T$\$D$ |$e "D$$ܫc D$$  $T$ T$.\$D$ ϫ|$e D$$c D$$  $T$ T$\$D$ 胫|$e nD$$c D$$  $T$ T$\$D$ 7|$e D$$D$ (vd  $D$#D$ueD$ D$ c L$$ $D$o\$D$ 迪|$e D$$Ԩc D$$  $T$T$:\$D$ s|$e %D$$,c D$$  $T$T$x\$D$ '|$e D$$0c D$$  $T$T$\$D$ ۩|$e qD$$\$D$ |$e D$$c D$$  $T$T$D\$D$ 豟|$e \D$$c D$$  $T$T$F\$D$ e|$e D$$c D$$  $T$T$'\$D$ |$e D$$c D$$  $T$T$P\$D$ ͞|$e ?D$$D$vd X$D$ c L$$ $D$Mʺ\$D$ o|$e D$$c D$$  $T$T$4\$D$ #|$e u}D$$c D$$  $L$L$T$D$ ۝|$e uD$$D$ vd e ,ËD$$g= vd D$XۋD$$M{D$$?%D$$1=vd D$"D$$PD$$D$$D$$BD$$ܣD$$Σ=$vd D$迣wD$$豣D$$裣D$$蕣_D$$臣D$$yD$$kQD$$]D$$OD$$ACD$$3D$$%D$$5D$$ D$$D$$'D$$ߢD$$ѢsD$$âD$$赢D$$觢eD$$虢 D$$苢D$$}WD$$oD$$aD$$SID$$ED$$7D$$);D$$D$$ D$$-D$$D$$yD$$ա=(vd D$ ơD$$踡D$$誡0D$$蜡D$$莡|D$$耡"D$$rD$$dnD$$VD$$HD$$:`D$$,D$$D$$RD$$D$$D$$DD$$ؠD$$ʠD$$輠6D$$讠D$$蠠D$$蒠(D$$脠D$$vtD$$hD$$ZD$$LfD$$> D$$0D$$"XD$$D$$D$$JD$$D$$ܟD$$ΟD$$ƚD$$踚D$$誚0D$$蜚D$$莚|D$$耚"D$$rD$$dnD$$VD$$H麿D$$:`D$$,D$$鬾D$$=vd D$(!D$$齽D$$cD$$י D$$ə鯼D$$軙UD$$譙D$$蟙须D$$葙GD$$胙D$$u铺D$$g9D$$Y߹D$$K酹D$$=+D$$/ѸD$$!wD$$D$$÷D$$iD$$D$$ۘ鵶D$$͘[D$$还D$$豘駵D$$裘MD$$蕘D$$臘陴D$$y?D$$kD$$]鋳D$$O1D$$AײD$$3}D$$%#D$$ɱ荀e D$;A?$+$u8$ĐË$ $$T$D$D$ D$HL$L$l$$$\$$l$D$L$ T$H9$L$lL$D$^D$ l$Q$7ƒrЃT$D*1L$0Q$T$0$ $$\$D$D$ L$09$$$T$$\$L$ sD$D$DL$L$hT$T$d$$$l$$t$|$0|$ .D$L$T$\$d$\$h\$\$D\$T$ L$D$$D$$QT$D$ Ƅ$ĐƄ$ĐÃNZtƄ$Đé$tщȃL$DQw;ut$$tƄ$ĐË$܃u$ ̍^$@=|$Ge u ͻ$ͻ賔Qat뭋$(^$<|$Ge u ͻͻTw˃L$DRi$ $$L$D$7D$D$DL$L$hT$ T$d$$$\$$\$D$d$D$hD$D$DD$$D$$@D$wD$ $ĐÀ $)Ç݃41ڃ\$Dkw1t18$Ѐt كu ȍ^$;|$Ge u ͻi ͻ茒Y krt뭩t$4$ꋔ$$u$1Ç݃^$]:|$Ge u ͻ ͻБ it뭩t0$+Ç݃cˋ$K$΋$3Ç݃Ë$ $$L$D$D$ D$D$HL$L$l$$$T$$T$D$ D$L$T$H9t1$ĐÉ$D$lD$L$D$ ׃x0M$ $$T$D$.D$ D$(1 T$,JD$(9L$,$$$T$$\$L$ D$D$hL$L$DT$T$d$$$l$$t$|$,|$ D$L$T$\$d$\$h\$\$D\$T$ L$D$$D$$QT$D$ !Ƅ$ĐƄ$ĐÃ1҉˃L$DiY18$ $$T$D$:D$ D$@$ $$T$$\$ D$ L$@9$$$L$$T$(D$ D$H$ $$T$$\$D$ L$H9*1L$4AD$4$ $$T$$\$gD$ L$49$$$T$$\$L$ D$D$DL$L$hT$T$d$$$l$$t$|$4|$ D$L$T$\$d$\$h\$\$D\$T$ L$D$$D$$QT$|D$ Ƅ$ĐƄ$ĐƄ$ĐƄ$ĐƄ$ĐÀt$)Ç݃$u$u^$+5|$Ge u ͻͻ螌i?t뭩t$Ã$拜$+ƒZj51҉˃L$Dik18R$ $$T$D$D$ D$@$ $$T$$\$D$ L$@9$$$L$$T$D$ D$H$ $$T$$\$D$ L$H9w$$$L$$T$D$L$ $D$@1 \$` ى‰L$`T$$ $$T$D$D$ D$H$ $$T$$\$D$ L$H9uƄ$ĐË$$$D$$D$LD$D$hL$L$DT$ T$d$$$\$$\$D$d$D$hD$D$DD$$D$$@D$D$ $ĐË$e$$$9$|$Tt$P$l$T$D$ D$$L$L$LT$T$\$P$$$-`,$$t$$|$ >D$ u[D$TD$pD$PD$tD$$D$xD$LD$|`$$D$L$pL$.CD$ $$yƄ$ĐÉ$ ^$.|$Ge u 383 (^$W.|$Ge u 33ʅ$Ƅ$ĐË$D$DG E$|$ D$DG E$|$ D$DG E$|${ D$DG E$|$` D$DG E$|$E D$DG E$|$* D$DG E$|$ G E$|$ G E$|$ "me $|;A$k$#d  d e $ d L$L\$PL$Li ù5d |d 5e Q$d T$DD$HT$D%r u΀T$0l$(\$1A9}u v:t "tu݅Q99;,:9$l")Ӊ!ӍC9}4"t \uC9C)݉ۇ!Ջ|$89ttf1T$ \$t$l$$L$4 $D$|$}D$ ul$$t$|$8붋D$ $D$D$\D$L$ T$tD$<D$@D$D(ÉT$H |9uRD$d\ÉL$$D$D$d\É $T$'D$ $T$'D$ $L$'D$ P-e ;av*D$ L$T$1kiғ419|T$,e ;a D$t|HPT$$ыD$uML$9u!D$$D$D$D$D$ É $`D$D$_ 0$D$ 0$D$ 4,?e ;a D$tm 9uED$$L$L$1D$t D$ ËD$$D$D$'D$݉$`D$D$ 0$D$* s+Ne ;avr D$tM 9u%D$$D$D$eD$D$ É$`D$D$ 0$D$莵 *re ;avD$@t @D$1*e D$;A|$XB$HWH(=$Q11l$U$$Éi(9h(p$9&T$t$T\$$ ދ L$$D$$Q(Y$l$9\$PD$LD$ $LD$D$pD$ttHL$pHP ʉT$tD$XD$\L$LtQT$XQY Ӊ\$\T$X\$\l$tt$p9t D$$D$H4$T$l$ gD$ tڋD$L$PL L$$ $D$D$DL$$T$TTT$$$D$L$D9uD$Lt&D$$@$Q(9fƄ$ĘÉ$D$L$ $H DŽ$DŽ$tQ$QI щ$$$T$L$0D$H$.D$L$$H DŽ$DŽ$tQ$QI щ$$$\$9t D$$jD$0$T$\$yeD$ $͉‹$뺉?Ƅ$ĘÉ $D$Hf11҉D$@L$T$<$11"|$ o$L$@L$T$<ƋD$@x9{$C(9l$ t$(|$TD$$[D$L$ T$9D$HT$<\ \$, $,$L$D$D$hD$ltHL$hHP ʉT$lD$xD$|L$HtQT$xQY Ӊ\$|T$x\$hl$lt$|9t D$(D$8$T$l$cD$ tڋ$$L$,L$D$D$DL$(T$TTT$$$D$L$D9uD$Ht&D$(@$Q(9aƄ$ĘÉ$~D$L$$H DŽ$DŽ$tQ$QI щ$$$L$T$4D$8$ D$L$t4T$9t D$(D$4$L$T$bD$  ԋD$@L$$ $1D$D$`D$dtHL$`H@ ȉD$dL$`D$dvOƄ$ĘËP„Ʌ|I;Ƅ$ĘƄ$ĘƄ$Ę谟 詟 袠 蛟 蔟 #(e ;avD$L$9tg$D$uAD$HT$Z9t D$É$T$D${D$ D$ËD$$D$uD$#ee ;a D$4t5D$$L$,9t 1D$8 É$D$(D$D$0D$pmD$ ًD$$H`T$($ыD$D$L$L$T$,Z`l$0,$ӋD$L$9t D$8 ËD$$L$d`D$ tދD$$HPT$($ыD$D$L$,QP\$0$ҋD$L$9uD$$L$( $ЋD$D$L$,T$0$ыD$$D$D$ D$8 !e ;aQ hD$XD$\D$`D$dD$lL$p9mPY9NZ90'P"Y"f9gP Y f9V1\$S\$ll$p؉X:X 9#p  4f119-qq 4y fuV119T$4t9=,$\$|$t$ D$tD$1D$ D$xh11΄0$D$4NjD$4냾$l11? $1\$ S\$l؋L$pXX 4h"fuv19}gT$ $T$7D$D$0L$ L$DT$p$\$ \$D$0$D$DD$D$tD$D$^D$xhD$xhÄX 9)݉Q$:D$xhD$xhËQ$QQ$XX$9t 1D$xhÉ$HD$D$DL$L$0T$p$,D$L$T$0$T$DT$D$L$ D$tD$D$렉$D$D$0L$L$DT$p$D$L$T$0$T$DT$D$L$ D$tD$D$u D$lL$p D$xhËP(Y(9t 1D$xhÉ$lD$D$0L$L$DT$p$PD$L$T$0$T$DT$D$L$ D$tD$3D$렃ZeP(Y(9P D$HD$LtZ\$HZR Ӊ\$LQ D$PD$TtZ\$PZR Ӊ\$TT$P\$Tl$Lt$H94$T$l$ZD$ D$lH(L$,T$p1l$]l$,t$p|$l9h(p$9&,[z(R$9e D$;A$ 9$9$$=D$D$|$$$$DŽ$Pd $u\$l$|l$FD$L$ T$_$$ݸD$D$0L$L$d$$辸D$L$T$<$<T$D$T$dT$ T$0T$:T$D$L$D$ D$(D$,L$$L$\ $D$D$ L$$$1E94~ 9u~$9ut$`DŽ$$$DŽ$u$$D$}D$ L$L$D$Pd $`D$ D$`D$LD$L$$L$D$迲D$L$ $$ĬË *L$lD$pǵ$t$l|$|$he  0D$\$D$,D$D$D$ D$D$$:D$L$hAA ċD$7T$;$PT$8PT$9PT$:PT$;$Z$\$7\$D$D$ D$L$hAe $A $Q$$T$we L$JD$hH($"f@,$f@.P(fP0 $7D$L$hA2$$D$L$hA3ADŽ$$$$$DŽ$u$$D$D$L$ D$L$Pd $`D$ D$hD$NJD$L$$D$L$PD$ L$$$ĬÈX.@/P,@-T$hz(-(y $(y$‹$(Ћ$Uǵ$|$t$*^$L$T$觯D$L$ $$ĬË$$KD$L$$ټT$D$ L$ D$D$L$L$tD$x0$D$tD$WD$ L$ $D$c $`D$D$腥 $`D$D$g pe D$;ADŽ$DŽ$$ $$$L$\$$,oG @%_$}D$H$D$h$t$\e a+$$$111t$,D$@CD$@CD$ACD$BCD$C<$D$@D$D$D$ |$D$Hp$$T$l\$,l$0D$h$$l$l9t$H [59L$,q95l$lt$,T$0T5e u \&׉$\$d|$(`$l$L$T$ t$l$D$T$pD$hL$,\$d|$(넉T$D$$KcD$"<$D$"D$D$D$ D$$$\$D$t$,1rD$<QT$IL$?$D$D$H$$$TR[P$ӋD$$ $T$'D$& $D$'D$ 0$D$t $`D$D$薜 $`D$D$x 0$D$ 0$D$ Me D$;A|$P1 BFL$PT$T$Q 4Q f11҉$T$ 1۽@|$P/\$0Cl$ $$͉։Nj$$T$ l$$9\$0$U9a9ĝf/Az$T$$t$(A"fWA H9JBD$L929*t$($  fL$@ $D$L$$TT$H\$l$(9wJ$9l$($L1 $\$D$#$L$HT$(D$D$3$$L$L$LL$l$ T$l$t$D$DL$$T$H$i 3 $|$T$t$ D$Nt$|$D$L$T$$\$0$$ߧD$L$$T$L\$l$(9wH$9l$($ $\$D$"$L$LT$(D$H$3$$\$L$l$ T$l$t$D$HL$$T$L$oT$@3$|$l$t$ T$Jt$|$$$T$@\$0l$$VjE9Z/)Q ?4Y"f11҉$T$,D$$IX9 1Kl$($ $\$D$!D$4@L$,$$l$Lt$(ыT$,닼$\$$9$D$4,K99ĝft$(L$$$,$ڥD$L$$T$L\$l$(9w$9+D$H$3$$\$L$l$ T$l$t$D$HL$$T$L$랉$L$<3$|$\$t$ L$mt$|$D$4L$D$ L$$1C9,u 9u퉬$DŽ$$DŽ$$$u$$D$D$L$ D$L$Pd $`D$ $D$*)D$L$$D$L$,D$ L$$ $Í ˡ$DŽ$$$ u $[$|$$e  v $@ $ $L$0L$D$D$ D$]D$$聑D$$AMcD$/$P$T$/T$D$D$ D$$A$ED$-$L$4$l$HQl$\$$D$  }11ӄމ녻$nLA A 9l q 4$$y"f1D$, $$T$#D$$L$L$TT$$\$,g$D$L$ 49 $3$[݃e $E$$0$T$ $$T$L$T$TT$0e D$,$$$D$D$L$TL$  9$D$,D$D$豗D$D$PL$L$LT$ $1ۋl$T4D$D@|$ $ЋD$pXD$L$8,D$PL$L$t$,9\$pl$T$$\$~D$D$DL$ $P $ҋD$$L$DQ|$$ҋ$L$TLH!ȉD$8L$D$DHP$$ыD$$L$D$$ҋD$L$8$ l$pt$L9S ׋$ʀtm$Te l$,u \$D$D$$L$ZD$L$ T$\$pl$L9$4[$D؋e L$LuT$LωƉ*$$$$$ĄË$$$D$($$ 4D$$D$ 111?D$,$1 $k Ή$t$`$ML$|U$]$ $P$HH 4P f11ҋ\$`9r h-95Q $tJ!T$<1ud$$$D$D$|D$D$ D$L$D$}ZD$ϋ$+e $Eu1$zL$ 4΄\9T=I)$ii"f)q 4y fK119|4+=\$\<$t$\$\$ 'RD$L$T$$kk 4s f11|$d9D$|$$,b5F(,$ЋD$$L$L$tT$\$$t$d1$$$L$T$|T$\$l\$ ND$L$T$$L$D$$D$ $D$D$xD$$4D$lxD$\$$\$d$L$tT$\$$t$d9}~9|$lvLL$xT$$$T$L$DD$ D$0L$$P\$t\$$l$ $D$ 5 9$NL$L$蛏D$L$T$ \$d9$$ 9 $T$\$D$ $D$$D$$D$D$d$9@\$|$\|\5e u+$D$D$$$Tߋ$F11݄EF:E$*11΄5)$Nj$$jY"ftH$9ft$9~$$ IL$|$D$ $$\$@$$$D$+$L$$ $$T$$\$$l$ D$ D$T$L$D$ $$$6 6 $`D$D$ P 5 6 0$D$D $T$'D$ O 6 0$D$iD 0$D$OD h5 a6 D$0$ $ЋD$$L$$T$t$$ҋD$L$$$$5`D$$,$$0$$<$@$$L$$P$$$D$D$D$ 証D$L$$ $0$$ D$QD$ L$ $D$%C >4 74 05 0$D$B 4 5 0$D$B D$4$ $ЋD$$L$$T$H$$ҋD$L$$$T5 $$\$$`$$l$$p$$|$$$TD$D$D$ 5D$L$$$0$$D$OD$ L$ $D$A 2 3 0$D$A 2 $D$D$ $D$ |$iLD$D$D$ L$$$ 0$$D$ND$ L$ $D$@ 0$D$@ 0$D$@ 0$D$@ 0$D$@ 0$xD$}@ 0$pD$c@ 0$hD$I@ 蒵}e ;a"TD$`HH$P(\$l9L$4ًT$$WD$>D$dHT$lD$0L$,D$4DD$D$`$WD$lL$0DL$T$,T$pL$tD$xTÉ$][D$L$T$l9DD$(\\$$ T$`$L$#WD$tp 4$9tD$D$8L$` $T$(T$mWe L$u+D$8D$`$L$$L$WL$T$`D$8?|$8y$D$D$ D$XD$ D$\D$D$D$D$ L$L$ 0$D$> ,/ $D$D$ D$XD$ D$\D$D$D$!zD$ L$L$DD$H0$D$DD$KD$ L$ $D$= $D$D$ D$XD$ D$\D$D$D$D$L$ D$LL$P0$D$LD$KD$ L$ $D$= 0$D$< Ce ;a+HY'D$LHL$,PT$DX\$@h l$-ȭ,$D$\$T$ L$JD$L$T$ T$8 $D$D$D$0L$ L$(T$T$$\$\$4$v|$D$ 49iT$@RӃe \$DC|$! G E$|$#! 0$8D$ ! 0$0D$  8e ;aD$ t,L$t D$É$?=D$D$Í^$U|$Ge u *  * +G E$|$B  苕Ve D$;A|$$|$d1詭$ $$T$$T$^Ct$ |$d-L$4L$;|$D$@tD$tD$ ËD$UUD$ Í^$N|$Ge u 7若*P!t 몋D$D$ ËD$G E$|$v 0$HD$\ 0$@D$B 苍ve ;avi D$,$D$7D$,$˽D$$$D$(D$D$,D$D$ :D$L$T$\$\$0L$4T$8D$< {e ;a 9$L|$D$H$wH QWWe "G|$T$Y ы@D$$D$ $D$(D$T$D$ L$ t D$PXD$,\$0T$4L$8Ë|$Ge uG1Y|$1J뢋D$ v $KD$ e u&L$AYˀYL$|$‹D$ |$L$҉É1ޢ؉0$XD$ 0$PD$ 'e ;av` D$,$D$ǺD$,$[D$$$D$(D$D$,D$D$0D$ D$4D$D$8D$D$ 虊e ;a (D$,H$D$@$غD$,H L$L$@T$<\$8$T$L$ L$ D$D$#D$$L$ T$T$8L$D$ D$H(ËD$0؍L$<뭍0$hD$= 0$`D$# le ;a(D$4$ۺD$@$诹D$4D$0L$8 $L$u D$L$f럃u D$L$뎃uD$L$D$ AsD$G E$|$  e ;avSD$$菵D$$D$軳D$HT$9wPÍ0$D$] 覃e ;avZD$$D$$D$KD$HT$9|H9PÍ0$D$  /e ;a,D$8$D$ӲD$8$gD$D$[D$0H L$L$DT$@\$<$T$L$ GL$ D$D$ D$$L$ T$T$|$D$,L$()ȉGD$)ȉG~QT$Z -e ˋ\$ u-D$$`t T$0|$4 D$81ĕ΋ e u D$T$븋D$裕ul$ ]UD$D$(T$,9\$ k9c$=|$D$ HT$(9}\$,)Ӊ_e  uD$D$0|$4D$$D$8D$ ^$M=|$Ge u ͻ ͻÔD$ G E$|$ 0$D$ 0$D$ 0$D$ |e ;aD$ iD$P(@$\$l$$5t$(9)|$,99D$ \$$)<|$D$(L$$)ȉGD$,)ȉG~QT$ Z -e ˋ\$ u-D$ `t T$0|$4 D$81\΋ e u D$T$ 븋D$;ul$]UD$D$^$o;|$Ge u  D$G E$|$ 0$D$ 0$D$ {^v\$$|$@t$($ыD$$D$DD$D$,D$D$0D$ D$@D$D$$D$D$(D$D$D$hLËt$`>v딋D$\$D$`D$L$dL$t$ D$HL$4|$`aD$P$D$TD$L$XL$l$ t$8D$HL$4T$TD$\$ D$L$wF$D$ T$4T$\$H\$ L$D$ D$<D$HL$4^$X-|$G e u wFwF˄D$P$ D$L$@P $ЋD$‹D$8L$d11 $蝞L$X^$,|$G e u wF(wF<D$8G E$|$Q D$D$ u D$UD$ ËD$aUD$ ÍUD$ ÍUD$ ÍUD$ ÍQwNL$QZ v-ZvZUD$ ÍUD$ ÍUD$ ÃwQL$QZv0ZvUD$ ÍUD$ ÍUD$ ËL$Qw%L$QUD$ ÃL$Q$D$L$@x $ЋD$t D$L$WD$$D$L$@P $ЋD$t t D$L$ UD$ ÍUD$ Ã$L$Q $D$L$@x $ЋD$t D$L$D$$D$L$@P $ЋD$t t D$L$UD$ ÍUD$ ]e ;a D$L$ $ЋD$D$$D$L$w<u)T$QL$$D$(D$ ʀT$, Ãu؋T$fσuT$ƒuT$T$P]Ne ;avw D$L$ $ЋD$D$$D$L$u1D$ZQL$$D$(D$ ʀT$, ÃuD$b\me ;a D$$L$( $ЋD$D$$4D$L$u@D$ZD$Z@QL$,D$0D$ ʀT$4 ÃuD$D$@[Oe ;a$D$4$D$8D$D$ L$T$ $D$T$D$ D$L$L$ T$T$$L$T$\$,\$ \$0\$oD$D$ u \$,1X u\$,SE u\$,131D$ G E$|$ Ve ;a(D$4` L$  u^D$0Z$!D$ L$L$D$D$ $D$8D$ D$ u \$01D u\$0S1 u\$011D$$G E$|$ Qe ;a$D$0`  uFD$,Z $D$D$4D$ D$8D$D$L$T$T$ u \$018 u\$0S% u\$011D$$G E$|$ Le ;a$D$0` L$ T$($T$,T$D$跀D$L$T$ $T$L$D$ TD$L$D$L$D$ $D$4D$ D$8D$D$L$T$T$e ;av$B$0D$ 4L$ D$e>e ;ae vu e R9mfȖ3oHc 3 $ _ ȉD$ D$ L$9u( e uud e Í=ud U $`D$D$ %>0e Yu!$L$L$D$ D$ D$輋Í|$9;u׉#e ;av7 Yu4D$t$bD$L$L$D$ 艿 =밍|$9;uĉ#e ;av7 Yu4D$t$D$L$L$D$ ) "=밍|$9;uĉ#e ;avNYuKD$t5H$L$D$ D$D$$D$ KD$L$D$(L$,貾 <뙍|$9;u#e ;avWYuTD$ t>H$L$D$$D$D$(D$ +D$L$T$L$,T$0D$4) "<됍|$ 9;u#e ;av7 Yu4D$t$2D$L$D$L$ ɽ ;밍|$9;uĉ#e ;av+D$$D$D$D$ D$ D$n;e ;av,D$D$D$$D$ /yD$ D$;e ;avMYuJD$t4HP$T$L$$nD$ L$T$D$ L$$T$(購 :뚍|$9;u#e ;av>Yu;D$t%H@$L$D$$nD$ D$B ;:멍|$9;u#e ;avMYuJD$t4H@$L$D$mD$L$ T$L$ T$$D$(û 9뚍|$9;u#e ;ave$YubD$(tLP@ $T$D$D$,D$ D$0D$D$4D$nD$L$T$ D$8L$Yu;D$t%H@$L$D$tmD$ D$2 +8멍|$9;u#e ;av>Yu;D$t%H@$L$D$DD$ D$¹ 7멍|$9;u#e ;av>Yu;D$t%H@$L$D$lD$ D$R K7멍|$9;u#e ;av=Yu:D$t$H@$L$D$$D$ D$ 6몍|$9;u#e ;av5 Yu2D$tP@ $T$D$ { t6벍|$9;uƉ#e ;avMYuJD$ t4H@$L$D$$D$ L$D$$L$, 5뚍|$ 9;u#e ;av] YuZD$$tDHP$T$L$D$(D$ D$,D$D$L$T$D$0L$4T$8 s l5늍|$$9;u#e ;avMYuJD$t4HP$T$L$D$ L$T$D$ L$$T$( 4뚍|$9;u#e ;avUYuRD$ tD$t(H@$L$D$DD$ D$_ X2릍|$9;u#e ;avUYuRD$ tYu;D$t%H@$L$D$TD$ D$ /멍|$9;u#e ;av>Yu;D$t%H@$L$D$D$ D$蒱 /멍|$9;u#e ;av=Yu:D$t$H@$L$D$褐D$ D$# /몍|$9;u#e ;av=Yu:D$t$H@$L$D$dD$ D$賰 .몍|$9;u#e ;ave$YubD$(tLHP$T$L$D$,D$ D$0D$D$4D$|D$L$T$ D$8L$Yu;D$t%H@$L$D$D$D$ b ['멍|$9;u#e ;avMYuJD$t4P@ $T$D$D$ D$ D$$D$D$(D$輞 &뚍|$9;u#e ;av=Yu:D$t$H@$L$D$D$D$ ܢs l&몍|$9;u#e ;avMYuJD$ t4P@ $T$D$D$$D$ D$,D$L %뚍|$ 9;u#e ;avAYu>D$t(H@$L$D$D$D$ 踟 x%릍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$  %뢍|$9;u#e ;av=Yu:D$t$H@$L$D$D$D$ 蜠裦 $몍|$9;u#e ;ave$YubD$(tLP@ $T$D$D$,D$ D$0D$D$4D$D$8D$D$D$ uD$ D$ ye ;avBD$$L$L$D$_MD$ L$ $D$ D$D$e ;avJD$T$8u1JRX@9t 1D$É$L$\$D$ 1Oe ;avD$D$ e ;avD$D$ e ;a-(L$0 T$,ks9{R tj099l$ )ۇ!,1T5F9}r?OL$ O e u(É 딉L$t$ 3 $ hL$L$D$,T$ \$l$q 9~9T$$\$ 9t$L$t$PD$0L$T$,t$\$$l$ Ã(v> o? e ;a\/\$ D*0ʉ])9~ J9rL$<Y+\$H9D0B9D*0T$t[P9D(-A A 9dD$ $D$()Љ!D$)׉|$\$ D$L$$      { t m f 菢Je ;a,D$0HT$8\$$h09w`9l$ t$($D$4D$T$D$$|$0GD$ Ge u D$(,ËD$(nL$ 3$t$L$l$ \$:vl$t$D$0L$ T$8\$$ax 衡e ;a,D$0HT$8\$$(p9wa9t$ l$(D $D$4D$T$D$$|$0GD$ Ge u D$(,ËD$(}L$ 3$l$L$t$ \$Iut$l$D$0L$ T$8\$$` 谠e ;avt D$$PXj9ZXD$( Í3$L$T$\$ l$tD$L$T$|$$We u ʉ蜷pe ;a0D$8=L$4QT$ i~9~Jz9~T$(3$\$T$l$ |$t\$D$l$xD$8L$4T$(t$ 멅9\$,l$$)ۇ!݉,$D$T$D$ <D$L$ ȅL$$9|$4GO e u D$,0ËD$,wL$4QY)s9SQD0Í3$l$\$T$ t$&sD$L$T$|$4We uˉŋD$8O H q\e ;avz ȴc $-D$L$Ѹ9u?f@~H  e u @ @$@%@)D$ Íx nى $T$'D$3 ϝje ;a L$AA e u\AAe u.AAȴc $ѸD$L$ Íy1軴y1豴ʍy1襴Ye ;avD$H0@$L$D$ e ;avD$H4@%L$D$ 赜e ;aD$#9 t'#uD$H(t D$ @,D$ ËD$@)D$ Ã+uD$H't D$ @+-t0u‹D$@*D$ ËD$@&D$ Ye ;a,D$0HT$8\$$h09wx9l$ t$($D$4D$T$D$$|$0GD$ Ge u"D$(D$8D$@D$DD$H,ËD$(ֲىL$ 3$t$L$l$ \$ol$t$D$0L$ T$8\$$I e ;a,D$0HT$8\$$(p9wy9t$ l$(D $D$4D$T$D$$|$0GD$ Ge u"D$(D$8D$nD$0@L$$YiT$\$l$ T$4$ЋD$D$ L$L$(T$T$\$$$D$D$DD$ D$HD$(D$L,衖Le ;avO ud 0  $D$D$$D$D$(D$ D$,D$D$L$T$D$0L$4T$8 *e ;a$$D$ L$(L$L$,L$L$0L$ mD$ PXL$T$\$ $:D$D$L$L$T$ $D$D$4D$D$8$腕`e ;a,$D$$L$8L$L$ $D$$D$D$(D$D$ L$D$D$$D$$D$D$(D$D$ L$,뙃xtD$ $D$$D$D$(D$D$ D$,D$D$D$7;݅e ;a7D$,GEu5L$ $D$ D$L$(L$ D$D$4ÃFtJGu3L$ $D$ D$L$(L$ D$D$뿋L$ $D$뭋D$ $D$ D$D$(D$ D$fD$sfbsH(똃g\vuD$ $D$ D$D$(D$ D$gD$H~e ;a,D$HbHiL$0Q'T$#iq~9VQ3(T$DT$(T$ $D$4D$D$D$0@'L$(L$ $D$<D$L$HL$|$0GH_9wB9-lf,O_ e uD$#G',ÉD$(L$$-3,$T$D$\$ L$W\$T$D$(L$$|$0낍3$\$t$l$ |$zWD$L$T$|$0We uΉËD$HWbL$0 $D$D111؍=d 跂륅tji>°| P.M65;90.u-B9$\$D$tD d L$L d e u`D$Pd L$,D$0L$,t>QӃ uʀ\$H$L$D$T$ D$TD$D$111΍=d D$P蜁뙋D$PL$L돉$D$D$ @\$&?W$D$\$ .|$(~.8T592px P 99Xh0t`t)$t$\$l$ D$TD$D$l$\$$t$ 4$\$l$D$ L$T$HB e u5J$D$TD$D$uT$H\$$l$t$ qDË|$(?\$T1$\$|$t$ D$TD$ͺD$D$b P%y_B>f5390tZ%yP-<9u<@7$ZL$ZD$ D$@\$fWWʼn$ÇމD$D$D$ \$q%yn.1u5`39p8?5 '9um0xtH>°z-`B9u-f$ZD$D$ \$?XW҉$t$|$D$ \$5댁>°댉$|$t$D$ \$6=JAmT5`<9uvHtFA-&9u)($l$l$D$ \$C|҉$D$L$ D$\$PWW닁A닁Ju5390'5`'9ut0tG=J- 39u*($l$D$D$ \$щ$ÇމD$D$D$ \$_눁=J눉$t$D$D$ \$.g5\wu}529ul0tF\-09u$h0$t$l$\$ 8Չ$t$D$D$ \$돁\돁΀u5&90u529up0tFqSm-`&9u)([$l$l$D$ \$O҉$ƉD$D$D$ \$#댉$ƉD$D$D$ \$CD$TTu!B $귺D$D$ڣDÃvtډ$D$Z߉1zz1z?D$Pz-ce D$;AG#$>"$t `!$G e w!GWe )!$_$oփ$Y  $q X $l$t$ID$ D$rg2L$|T$x3$l$L$\$ T$7$\$l$L$|T$x$r$$$D$$D$D$ L$ $ЋD$D$HL$$Z\$|,l$xr:9890t$t$$L$D$nD$x$GL$tOe \$|l$H\$9wK9-155,ވ\މ_O e uf\$|-3,$T$D$L$ \$"T$L$D$x\$|$w‹$eЋ$W$3$|$\$t$ l$"t$|$D$H$$\$|l$x$$T$L$D$ $D$$@D$?J$l$t$yD$ u!$$$$$$$L$$T$ D$L$T$ Ã$$hp8^9C^X7&$T$L$$D$ $D$$@D$É$$3$|$t$l$ \$ D$L$T$$We u$΋$ÉTcރ'$$$$˃G,GWp9NPW{D$$1$$$L$$T$\$`\$ D$L$T$$$T$L$D$ $D$$QT$0D$`H$$L$`$l$$D$@D$ L$`9$W,xWZo79 9  ĝf _o e 7O+$$$L$$T$D$ L$@,T$`T$ $Ѝ$$ag$$MD$@$Z\$|,l$x2z9 9 $|$t$L$D$iiD$x$GL$tOe \$|l$@\ui$9HO:-3,$T$D$L$ \$D$L$T$$We u‰`‹$`Ћ$뇉$3$t$\$|$ l$|$t$D$@$$\$|l$x$'O,5J`T$|\$x3$t$T$l$ \$ t$l$L$`T$|\$x$GPo9PW 3 $\$D$l$ T$D$L$T$$We u ÉȋL$`_ȋ$O$HQX(9QPD }3$l$L$\$ T$*D$L$T$$We uʼn _3$L$D$T$ t$D$L$T$$We u$$‰ȉY^$l$t$+D$ L$ $ЋD$L$$Z,l$|2z99$|$x$L$D$4fD$|$GD$xGe u*$$$$$$]щ\$xD$D$3$t$\$|$ l$|$t$D$D$$\$xl$|'$l$t$D$ L$$$D$L$$D$ A YGHL$|_9wu9\$x$Љ$D$D$dD$|$GD$xGe u$d$\SD$x-3,$T$D$\$ L$\\$T$D$xL$|$M$vOQo9wK95귺-4 D WG e u[T$|L$x3$\$L$l$ T$l$\$L$xT$|$s<$L$蘴X$l$t$wD$ $ $D$$D$ Bw=u-E<$L$D$D$ $D$譺EЃu Eu E뱃uME뤍^$3|$Ge u ZB u*E1ɉ<$D$L$D$ $D$"uE1΃ uE1^$|$Ge u C(CZ u E1r u MEbE1Xw_ u/E<$ZD$D$ $D$VfE<$D$D$ @$D$+;u>EM<$ZD$ZD$ D$@$D$HEM<$L$D$ D$$D$wË$X{ŋ$Xŋ$_߉1Xy$$$L$T$D$L$ $J e u9B$$D$D$u$$Íz5X$$G E$|$; $G E$|$ $G E$|$ $G E$|$     ޼ ׼ м ɼ ¼ 軼 贼 譼 覼 蟼 蘼 葼 ?e ;aD$ D$L$$T$9T$ʋB`&9(u,@Bv11AT$(D$,L$0ÉB5d td 5e d T$ D$t$ v ΀9ƒt$^wyu%9t Љ9u Ӎ^$I|$Ge u Uu 넃u supb^ uV1ۅÇޅۇÇ!ۇÇ t$9t u1뢃 u1떍^$P|$Ge u CCT u 1H u 0X7 u1)w969Ӹ%=d eT9Ӿm11~D$G E$|$S D$G E$|$8 Q z )ʉT$L$)!ً\$|ىL$\1 @\$Ll$\9D$4kl$X\$<~DwnO99ĝf2oO e ML$<OQo9wUu9ml$H5-귺, D WL$HO e u/IT$HL$D3$\$L$l$ T$l$\$D$4L$DT$H|$phL$dT$XT$h\$dw-$ЋD$D$(L$T$pZ\$H,l$Dr:99zt$@|$`$L$D$=PD$D|$pGL$@Oe \$Hl$(\T$`97HO=<$D$t$|$D$(L$PT$p\$Hl$D11Gt$Hl$D3$T$t$L$ l$T$L$D$4\$T$H3$t$T$l$ \$l$t$D$8$T$H\$L|$pD$`E.D$D 3 $t$D$l$ T$l$t$D$DL$LT$H\$p$L$|$t$ T$$D$L$T$\$pt$x|$ttC}$L$|$t$ D$LD$$D$MD$D$LL$T$ T$'\$x9l$tt *tR,$\$L$\$ 袚D$L$T$\$pC4K%tD$'L$Lt$x|$tC4C%݉L$0L$| $$T$$\$D$ jD$L$T$\$pC4K%C4} C4C%C%tl$0E1щ{T$HCH L$Lk39wl9l$Dt$`$F)D$D$ LD$L|$pGD$DGe uD$`T$HxD$`CD$D3$t$D$l$ L$l$t$D$DL$LT$H\$pUl$tx|$tL$0L$| $$T$$\$D$ +D$L$T$\$pC0K$t$C0} ؉C0C&C*l$0E1щT$@CH L$Lk39wll9dl$Dt$`$39D$D$ JD$L|$pGD$DGe uD$`T$@dD$`BD$D3$t$D$l$ L$gl$t$D$DL$LT$@\$pUl$t$+u @'-u @&@*0p&ވX*$Ulj)x9p9h\$0)\$,!Ӌpl$,T5T$LH89w}.9&L$D|$`7$\$l$ID$L|$pGD$DGe u!D$`D$0L$x9ȋT$tËl$8D$`:AD$0L$x9ډ\$Tt$D3$|$t$L$ T$|$L$D$pT$L\$Tl$,t$D<lj) "          ܥ դ Τ Ǥ  蹥 貤 (Ve ;abDD$1|$$1@1ODS'~e ;a3,14$l$\$D$ v諺D$ @L$89D$ T$4‹+[~yt$0~NA9 AF 뤉l$$\$(3$T$L$|$ D$D$L$T$|$0We u\$(l$$=t$0AD$0HXk9KH ,Í3$T$\$L$ l$D$L$T$|$0We u ˉ‰y=%e ;a|$W\$9~uT$ \$9t$L$T$E|$O\$ 9wL)ىO-e !ٍ u(ud d \$$L$(D$,11<Ӊ 1%Le ;av} 0$|$D$(Ge uLD$$$|$D$,D$D$0D$ D$4D$D$L$T$D$8L$D$F01FD$0$ *L$D$D$ u D$8,ËD$0$ L$D$XD$ #D$0$ ԟL$D$-D$ D$0$BD$D$D$ vD$8,D$8,D$8,ÃTD$0$ ğL$D$D$ u D$8,ËD$0$ L$D$~D$ D$0$BD$D$SD$ upftjAD$8,Ë0yd 4yd D$D$ D$L$ @$D$D$nD$L$ $L$: 4yd 0yd D$$D$(L$$D$(@$D$$D$D$L$ $L$ 3 .e ;aD$ $D$$D$ L$D$  L$D$oD$$XL$D$oD$D$4$D$4$D$4$^D$ D$,L$L$T$<T$ T$ \$4$D$D$$D$ D$ D$4$D$,D$D$D$D$L$$L$@D$H0WD$@D$H0e ;aD$ $L$$L$źT$D$ CںT$D$OD$D$ $D$ $jD$$Xu D$ $D$L$D$(L$,ÃqtNxt֋D$ $D$(DD$D$ L$T$$D$L$T$ D$L$롋D$ $2D$L$D$(D$,e ;a D$,D$0pD$,|$0@$D$,D$ZD$ L$ $D$&~ D$4D$8\$4T$8@$D$4D$D$ L$ $D$} +Ve ;a D$$$D$HЃ L$D$$$eD$HЃ w_tD$ ȈD$(D$) Í$l|$Ge u II Hw Hɸ딍Hw H낹1vD$D$$$JD$(D$D$) ÍHw HɸHw H1D$(D$) D$D$pD$|$@$D$D$`D$ L$ $D$,| uPe ;an0D$4$+ VQ D5D$4$D$L$tzL$4QYiq ~9~ÈD$#T$$3$l$t$\$ |$VD$L$T$\$4Se uCΉD$#m|$$-D$4HP@ t,T$D$L$ $D$L$L$8D$<0Í$@|$Ge u E ED$(D$,pD$(|$,@$D$(D$҆D$ L$ $D$z re D$;A$$$@  $$L$$T$蛏D$L$T$ $twQ_ Q xl@9$x9$?,d  d e $d $$$QӃ uʀӃ\$@D$HL$D $D$\$#AD$D$\$`, %$T$AD$D$,D$ @D$L$T$\$\C(^D$d9T$()ЉD$4!Ћl$`D$<$\$8D$L$ T$(щL$(cT$\Z$Z j(j9}j \$tl$l9}BmL$hً+[$D$l$\$ 0D$t@D$tD$\H$H D$($D$D$D$\$0$11[vD oD $D$AR ZD SD LD ue ;avV D$|1L$ $D$D$L$Q| 9wA C 0$xD$Q e ;aD$@PHP)ыl$9 *9HtYHX9wm)!)9~8l$ L$9t$L$l$D$ D$$D$(D$,Éĉ$l$T$D$l$11B B e ;aD$@PHP)ыl$9 *9HtYHX9wm)!)9~8l$ L$9t$L$l$D$ D$ D$$D$(Éĉ$l$T$D$l$11 B B .e ;a8D$<@P11؉L$0T$,$D$D$L$ e ;a D$@PHP)ʃ|VQ|\9wXPt%P9s<T$D$D$ É$D$TL$D$11< = \e ;a<D$ =L$APQY)ӃZ9Yir99T$)Չۇ!$D$L$D$ -)D$L$Q\$Å|u9wqYD$$D$(D$,É $D$)T$D$ L$^11ML$ $D$/D$$D$(D$,n< g< `< 艿e ;aD$@PHPh 9V@@ @PD$uD$$D$(D$,Ëd d D$$L$(D$,9w`)!)\$9~GT$ \$9t$L$T$ED$ L$A ~APD$$D$(D$,Éa; 芾e ;av]D$@PHPh )t$9~54*|29w.9w*p )!͍ +~@PL$ T$t$É: e ;avjD$HX 9~'9sO SP @PL$D$ D$@@ @Pd d D$L$ D$V9 ze ;aD$HPh 994+s1MH @PÇމD$D$ D$$D$()!ى $)T$D$- D$ L$T$J JPD$L$ D$$D$(@@ @Pd d D$D$ L$$D$(@8 ie ;aD$ HP~'P 9|)ʉP @PD$D$Í${|$GJe ulpD$|$ÍlLŻ`e ;av|D$ HPt#@PH ~IH D$D$Í$N{|$GFe u6bpD$|$Í6b-he ;a8D$<$D$@D$D$D$(L$T$ T$ \$\$4wP119l$0t$$,$L$T$.D$0D$DD$ D$HD$$D$LD$(D$PD$4D$T8ÉL$,3$D$D$D$ T$Ďt$l$D$(L$,T$ \$4i7 +e ;aD$HPh 9)!ډ$)L$D$D$D$ HD$L$Q \}RAd -d 1y|B9w>9w:A AP)׉ۇ!t$ )ЉD$$L$(l$,\$0É11&6 6 H#e ;avp$D$($D$,D$D$D$L$T$ \$l$l$ $\$T$L$ bD$L$D$0L$4D$D$8D$ D$<$蹸te ;a4D$DD$D$t/L$ 9wCT$$)‰!‹l$T$,)L$0\$4D$,D$0D$4%# NYe ;aD$ $L$$L$T$(T$\$,\$ D$nD$|iL$$9snT$ s@|UL$(9wMT$0D$4L$8ÉD$\$()É!Ӊ$)L$t$D$L$ȋT$ 뭋T$ R" K! t/e ;avgD$ $D$$D$D$(D$D$,D$ 7D$L$T$$L$T$D$,D$ D$L$T$D$0L$4T$8e ;aD$ $L$$L$T$(T$\$,\$ \$0\$l$4l$D$t3D$0L$$9wCT$()‰!‹l$ T$8)L$<\$@ËD$ D$8D$$D$`D$ pL$XH e uL$THD$\PÍxD$T褷`$_D$ L$XH e uL$THD$\PÍxD$TXϟe ;avWD$,$D$0D$gD$L$ $L$$L$L$(L$D$ D$L$T$D$4L$8T$<Re ;avWD$,$D$0D$D$L$ $L$$L$L$(L$D$ D$L$T$D$4L$8T$<e ;avWD$,$D$0D$D$L$ $L$$L$L$(L$D$ SD$L$T$D$4L$8T$<re ;avED$ $D$$D$D$(D$XD$ D$L$T$D$,L$0T$4e ;a(D$,$L$0L$T$4T$D$ & $D$D$pD$ D$$L$L$T$T$\$,l$0t$410z)ȋt$4)Ήۇ!t$,ˉʼn֋D$$L$T$~F\$,l$0t$4|$ $l$t$D$ L$T$ \$9s)l$$DD$09vD$8L$8ؗuk1ɍq9i9aL$$)͉ۇ!,$D$\$T$ D$D$PD$ D$D$$D$T8É4$L$l$\$ D$|T$Hl$Dt$9}r*҅~ t\$L$g  萏e ;avAD$HP @9Ç9ڇÇ!9 t D$)Ӊ\$(e ;avD$@D$D$ e ;aD$H PX99ڇÇ!9 @HXhp 9))!\$9~UL$ \$9t$T$L$ҭD$H T$ ыhH ՉhL$$D$(D$,É맋d d D$$D$(L$,  e ;aED$(T$$!˅ ˄L$Y9؇Ç9Ç!9 ߋIut9))!ʍL$9~Jl$ T$9t$D$l$谬D$ L$9} d d D$,T$0L$411벋d d D$,L$0D$4Í$L|$G$e u""D$,pD$0|$4Í"W  而e ;aD$@H PX9ڇÇ9Ç!9 0u/uE9sA˃H P\$D$ D$Ëd d D$D$ L$ ˋVe ;aD$ @HP Å҇Ç!ɇÇ ݕtJ$GK|$G.e uڹpD$|$Íڹ譢P HD$D$Ae ;a-D$HP X9هÇ9Ç!9 PPXhp 9<1s3p hÇ߉D$D$ D$$D$()!ى $)T$D$D$L$Q ‹l$ qQ Ɖql$T$ D$$D$(@d d D$D$ L$$D$( 踉e ;av|D$ H}J$bI|$G<e u8pD$|$Í8ȠH H@D$D$he ;a[D$ @L$L$T$ÅɇÇ!҇Ç ݕtZ$H|$G$e u*"D$D$ pD$$|$(Í"ߟщH PL$T$ D$$D$(ÃuX l$Pl$EuP\$Ӊl$!$G|$G!e u*mD$D$ pD$$|$(Ím!蚇e ;a,$D$(@H PX9ڇÇ9Ç!9 0xt$D$4D$8D$<D$@$Å9)ωۇ!ύ>\$,[T$)͉l$l$D$ D$0$ӋD$L$T$\$9OD$ l$(u ֋Eu ЉE9ttD$ t$4T$8L$ Oe ;a+,D$09HT$8\$$hp 9w}9t$ l$(D $D$4D$T$nD$$L$0AD$ A e u#D$(AD$8D$f։L$ 3$l$L$t$ \$ #t$l$D$0L$ T$8\$$D e ue+ 0$D$ :Ne ;avAD$H P@9Ç9ڇÇ!9 t D$)Ӊ\$Me ;avD$@D$D$ Me ;aD$HP X99ڇÇ!9 @PXh 9)ډ!ًT$9~Ul$ T$9t$L$l$lD$HT$ ыh HՉh L$$D$(D$,É맋d d D$$L$(D$,s Le ;aED$(T$$!˅ ˄L$Y9؇Ç9Ç!9 ߋ uw9)Չۇ!ыT$9~JD$ \$9t$L$D$`kD$ L$9} d d D$,T$0L$411벋d d D$,L$0D$4Í$` |$G&e u"MD$,pD$0|$4ÍMb 0Ke ;aD$@HP X9ڇÇ9Ç!9 0u/uE9sA˃HP \$D$ D$Ëd d D$L$ D$R {JVe ;aD$ @H PÅ҇Ç!ɇÇ ݕtJ$ |$G1e uzpD$|$Íz]aPH D$D$IAe ;a&D$H PX9هÇ9Ç!9 PHX h94*s3hX ÇމD$D$D$ D$$)!͍L $D$ D$ L$Q‹l$q QƉq l$T$D$ D$$@d d D$D$L$ D$$F oHe ;av|D$ H}J$|$G>e unDpD$|$ÍnDx_HH @D$D$Ghe ;aUD$ @L$L$T$Å҇Ç!݅ tZ$?|$G&e u*ND$D$ pD$$|$(ÍN^щHP L$T$ D$$D$(ÃuXl$P l$KuP\$Ӊl$'$|$G#e u*@D$D$ pD$$|$(Í@]PFe ;a&$D$(@HP X9ڇÇ9Ç!9 0t$D$4D$8D$<D$@$Å9D$,$D$0D$)͉l$ۇ!L$D$ (D$L$T$\$9OD$ l$(u֋E uЉE 9ttD$ t$4T$8L$e ;av8D$@IT$T$T$ T$$ыD$ L$D$$L$(Q>e ;avP D$$@IT$(T$T$,T$T$0T$ T$4T$$ыD$L$T$D$8L$|(9tOZRI9Y$L$l$L$DL$ L$HL$L$LL$D$v|$  ر$JD$8HP\$l$ 9 e L$,ӋT$l$P9\$(D$ L$@$)ʼnl$$ۇ!ŋt$Ll$0l$\$n D$ L$ :92\$P9&D$T$Z!ȋt$LD$l$D$,$ӋD$L$T$ \$(څuPT$(D$HT$@Zjl$\$\$,$ыD$L$T$ \$(څT$TL$XD$\<ÉT$TD$XL$\<ËD$@L$0L$L$$L$L$, $ЋD$L$ T$\$(ىL$TD$XT$\D$ 9sA 9s:T9~ӋL$T$<$9|CD$ D$ @ 9 b-e ;a0D$4$L$8L$賆D$L$<D$< 0 $D$D$D$D$ L$L$$T$ T$(1ۋl$4t$8CT$(͋t$8L$$ϋL$9}r*҅~ t\$ L$跔 e ;av\D$HT$1ii< >|9r*҅~ t\$ L$4 ]e ;aD$(tsL$T$ 1l$])‰!Ћt$ƉȉL$T$ \$ $T$l$$l$D$ x-D$tL$(ȋT$ 9vXD$D$,ËD$$D$D$$D$ D$SD$ D$,ËD$$D$ D$D$@D$,2 [e ;av8D$$D$D$D$ D$D$$D$ ,D$D$(e ;av8D$$D$D$D$ D$D$$D$ WD$D$(e ;av0D$$D$D$D$D$D$ D$ Ie ;a8D$HEL$@9L$D $D$ D$L$ L$T$@\$H)ڍu|$.D$(|$Dt$d,.t]$$1O9}2sg ۍt$DωtՉ$ĄDŽ$ĄË$$WDŽ$Ą1 Ze ;at$cL$|T$xb9}L4)}E9u뉔$tÉ $\$l$t$ l$D$,$T$0$l$|t$x؉L$0~C9L$0$L$wD$D$,L$ T$0)ʉT$0$$1WDŽ$tË$ $D$t$|$T{,D$(|$4t$Ti,tPD$|P\$xJ|/9s` |$44t׉$tDŽ$tË$L$|DŽ$t聋 z Ne ;av:D$HT$ \$I|9s, 8ЕuL$D$ ?e ;a((D$@L$8hD$@ 0 $D$D$D$D$ L$L$T$ T$$\$@K\$@1t$,|$0)!ET$$\$@NjD$ l$t$,|$094$|$D$4D$L$8L$ #D$|pL$<R\$09Fl$t$9/t$$L e t$8ƅuL$, 9R׋D$,r$|$L$T$9T$$\l$0+e <ʅu%D$,AT$DD$HD$ D$L(ËD$,$֋D$,$T$0T$\$4\$L$ D$@nL$, $L$0L$D$D$L$ T$L$DD$HT$L(D$DD$HD$L( ه ҈ ˇ Ĉ e ;avS$D$($D$,D$D$0D$D$4D$ D$D$8D$gD$L$T$ D$8ؗuU1ɍ99L$ !$T$\$'D$ D$ D$@,É4$L$\$ )D$ |T$8l$4t$0D$8 899|$!$T$L$&D$ D$HT$$B9|iL$9UL$49H)ى!ˋL$0ى $D$D$8D$D$ e D$;A$$$$$L$2D$D$X1$襊D$L$XF»\$\$L$h$u n ~.8X&u98$b0ӟ9$zu`1݈B9} ,9rT$\$[D$L$T$ $$ӋD$L$$$Á~.8u9uZjuЉ띋T$\뗽ߋ$M~.8$릋$mrT$t$D$L$\$ $$Ջ$L$hT$\_B>fwq_ua=9uP$u/_B>f:539u$m밁_B>f뾁&Xk=9$tC n59u&$mt Aڋ$R/l$D$L$\$ $,$ҋ$L$hT$\u nrt/Pԑ89$z$|$0$$$$1D$<$q})Ӊ\$d!\$)щL$L$dL$ D$$$׋D$<@L$0T$\$$$|$hڋ\$\|$0D$<$T$<9}9y?i  9B:D$$$$$$$1D$8$wm)Ӊ\$d!\$)щL$L$dL$ D$|$$$ՋD$8@L$$T$\$$t$h$ڋ\$\$D$8D$$T$89}<׋9n~ @9BD$,$$$$$1D$H$F)\$d!\$)L$L$dL$ fT$$ $ЋD$H@L$,T$\$$$|$h$\$\$$$D$HD$,l$H9}j9e $6 $$lu=@9$=;9$?ut /t/?9uP$($mrT$t$D$L$\$ $$Ջ$L$hT$\밿rt/뇋$R/l$D$L$\$ $,$ҋ$L$hT$\of=J΀f9$zu81B9}&,t9 9 ՋT$\΀8&9uH%$[D$L$l$\l$ fT$$$Ӌ$L$hT$\봋$K΀싔$y.u9$th29uK$r$mD$L$\$ fT$$$Ջ$L$hT$\븋$mfT$D$L$\$ $$Ջ$L$hT$\NA=&9$'`'9uu$1=Ju 39uQt $r$R$l$L$\$ D$$$ҋ$L$hT$\몸z=J늋$R$l$L$\$ D$$$ҋ$L$hT$\t$$.1*Msvҟ9R$z|$$$$$D$|1D$LD$|q})Ӊ\$d!\$)щL$L$dL$ D$$$׋D$L@L$T$\$$$|$hڋ\$\|$D$L$T$L9}9yZ 7d@ҟ9GB:$D$($$$D$t1D$DD$trE)Ӊ\$d!\$)щL$L$dL$ f|$$ $ЋD$D@L$(T$\$$$|$hڋ\$\$D$DD$(T$D9}D$ L$@( $ЋD$L$$L$D$|3D$D$$D$ D$D$$D$!D$ L$ȉL$(D$(ËD$$D$ D$L$Z>D$ L$$L$D$D$(%e D$;A$HP$$ыD$ wOu($@|$ $ЋD$$ĄÍHvЃvDŽ$ĄÍHvu؋$Hd$$эD$D$LL$L$D11l$HUl$<\D$LL$D9}]T$H\$<$H,T$$$э|$Pt$LD$dL$` $D$D$}DŽ$ĄÉ$ĄË$H($$ыD$L$ $D$D$D$@$@T$ $ЋD$L$@ȉ$Ą\7e ;avkD$HPXk|M9wI9wE(pm )ډ!ىL$D$|$ 4$D$L$QQfD$1 δye ;avkD$HPXk|M9wI9wE(pm)ډ!ىL$D$|$ L$fL$4$ՋD$HH1 >ye ;aviD$HPXk|K9wG9wC(pm$)ډ!ىL$D$|$ 4$ՋD$L$QQD$0 谳{e ;aviD$HPXk|K9wG9wC(pm)ډ!ىL$D$|$ L$L$4$ՋD$HH/ {e ;avqD$HPXk|S9wO9wK(pm()ډ!ىL$D$|$ 4$ՋD$L$T$ZZL$ D$$_/ 舲se ;avqD$HPXk|S9wO9wK(pm)ډ!ىL$D$|$ L$ L$L$$L$4$ՋD$HH. se ;avD$ $D$fD$輱e ;avD$ $D$fD$|e ;avD$ $D$D$>e ;avD$ $D$D$ge ;av# D$$D$L$D$L$ 趰e ;av# D$$D$D$D$D$ ve D$;A$  q5$$$T$L$D$ D$D1_L$T$$$T$$\$L$ Y D$L$T$$$T$D$L$ 2D$THD$D9|Ë$$mD$L$L$|$D$|D$l$$?D$L$$$$$$$D$$D$L$lL$ D$I(aO$$$T$L$5D$$L$ L$@$$$\$$l$D$$L$ L$L1\$XS$L$L9T$X$$$L$$\$T$ ~D$L$T$%`=u$$T$L$\$ 낉$\$h$D$@H,T$XT$$$э$$$$t$$\$hy_uዄ$$$L$$L$L$hL$ H$$$T$L$D$ D$H1_L$P$$$T$$\$L$ D$L$T$$$T$L$D$ eD$PHD$H9|.  tZ $$kD$D$\D$\$$$D$$D$ZD$ &$$:D$L$$$$T$$T$D$ L$*}uU$$D$L$D$tL$xD$t$$$D$$D$D$ %#$$wD$D$dD$dD$<$$TD$D$`D$`$$$D$$D$L$<ZL$ ZD$$NuN$P Xh9+]X$$$D$L$D$ R":1$P Xh9!+]X$$$D$L$‰D$ D$f%uI$$mD$$ $$L$$L$D$ D$%$$D$$ $$L$$L$D$ D$$HtZ1$P Xh9+]X$$$D$L$T$ D$X($$tD$L$$$$T$$T$L$ D$$ uJ$$D$$ $$L$$L$D$ D$'H$$D$$ $$L$$L$D$ D$w']$ V$ O$ xe D$;A-$D$dP$$$T$L$ D$ D$H1_L$T$$$T$$\$L$ RD$L$T$$$T$L$D$ +D$THD$H9|Ë$$$D$L$w.D$ L$@P $ЋD$D$duk$@ZZD$hZL$XD$X$ $D$bD$hZD$\D$\$ $D$;Ju$@떍^$f|$Ge u !  D$du|$HZZL$pD$xD$|L$x$$L$D$D$p$$$$$D$L$veu$H녍^$e|$Ge u !  $$$T$L$z,D$$L$ L$<$$$\$$l$RD$$L$ L$D1\$PS$L$D9uT$P$$$L$$\$T$ $D$L$T$%`=u$$T$L$\$ /낉\$d$$D$ $$$T$L${D$ D$@1_L$L$$$T$$\$L$ 2D$L$T$$$T$L$D$ D$LHD$@9|lP$$$D$L$;*D$ L$@P $ЋD$D$du0$$Q Yi9 +A@A7u $ȍ^$b|$Ge u "  u$tu$a$SD$dwxu"$$ $fD$Yxu $֍^$a|$Ge u H88u $녃u$r$dD$dwwu!$$ $D$u $׍^$ a|$Ge u r}bu $놃u$s$e1D$du*$$$L$D$u$΍^$=`|$Ge u 谷zu$uu$]$ BL$$$D$L$D$ t($HP X9zHAH$H PX9K֍P}P$$$D$L$V&D$ L$@P $ЋD$ D$d u5$ZZD$`D$`$ $D$P_u $ȍ^$^|$Ge u sͻqsͻaD$d uB$Z$$$$$L$D$u $뻍^$^|$Ge u sͻsͻx$$$D$L$$D$ L$@P $ЋD$ D$d wRu0$$QY i9;*A@Au $ȋ$뼃 u $묃 u $뜃 u $댍^$\|$Ge u C(Ci OD$d wDu"$$ $fD$u $֋$ʃ u $뺃 u $몃 u $뚍^$0\|$Ge u CGC裳7 D$d wCu!$$ $D$KZu $׋$˃ u $뻃 u $뫃 u $뛍^$k[|$Ge u CgC޲W D$d wMu'$1ɋ$$D$L$u$1ы$1à u $1뱃 u$J랃 u $1댍^$Z|$Ge u CyC lD$dG E$|$ % D$dG E$|$% D$dG E$|$$ D$dG E$|$$ D$dG E$|$$ D$dG E$|$$ D$dG E$|$~$ D$dG E$|$c$ D$dG E$|$H$ D$dG E$|$-$ D$dG E$|$$ D$dG E$|$#     $e ;av1D$$D$D$D$ D$D$HL$ HȘe ;avwD$$D$ D$D$$D$D$ L$QYi4(|99w59w1)!Ս+uAÉD$$D$D$L$  2me ;a.D$ttH n t/wblu@9u D$ Áu7;9u D$ Át/u 9u D$ D$ Át/ځԑuy9udT$ZtS?i uC9u2Zt% u @9u BuD$ ø\$ ûʁ \$ ËT$똋T$딁~.8wx&u9Ab0uNӟ9u9T$Zt+~.8# 9uBD$ ø\$ ËT$Á~.8T$뿁_B>fw=_u-9_B>f 39_B>f߁&Xku-9N n 9On n߁f&.1*Msurҟ9u]T$ZtL 7u<@ҟ9u+Rt.1 `39T$ úс.1\$ ËT$럋T$뛁?wQvuAҟ9u0T$Rt? '9T$ úЁ?Ё&ٚu19;fS @9ED$ Áfہ=JwSAu&9'u-`'9=J 39=J߁΀wNu>f9u-T$Rt΀ &9WT$ úӁ΀Ӂ.u9(a 29Nדe ;avvD$L$T$\$1ރˀ) E҇ÇށÇ!҇Ç t9r9s )ED$!  Cne ;aPD$T$ 1111D$y|$|$|$~|$ ۇ߉|$ !L$L$ |$ !|$ ˉ|$|$ |$ |$D$ ! q|$D$L$9<a ~D$(D$,A؉D$0uwډL$Ç߉ ! D$(ى͉ ! ! Ӊ\$,D$@D$0D$(D$,D$0őe ;av{e vu e  Rw$D$)D$L$  xd e u $xd e Í=$xd 赨.ie ;av1Yu.D$ t藴$L$D$L$ ؐ붍|$ 9;uʉ#e ;avCYu@D$t*D$$D$D$D$ D$D$$fD$ ֱm f뤍|$9;u#e ;avAYu>D$t(D$$D$D$D$ D$D$$D$  릍|$9;u#e ;avIYuFD$t0D$$D$ D$D$$D$D$(D$ D$,D$耲 耏랍|$9;u#e ;av1Yu.D$ t跲$L$D$L$/ (붍|$ 9;uʉ#e ;avCYu@D$t*D$$D$D$D$ D$D$ fD$$ 趎뤍|$9;u#e ;avAYu>D$t(D$$D$D$D$ D$D$ D$$O H릍|$9;u#e ;avIYuFD$t0D$$D$ D$D$$D$0D$ L$D$(L$, Ѝ랍|$9;u#e ;av1Yu.D$ t臮$L$D$L$ x붍|$ 9;uʉ#e ;avCYu@D$t*D$$D$D$D$ D$D$$fD$   뤍|$9;u#e ;avAYu>D$t(D$$D$D$D$ D$D$$D$  蘌릍|$9;u#e ;avIYuFD$t0D$$D$ D$D$$D$D$(D$ D$,D$耬' 랍|$9;u#e ;av1Yu.D$ t觬$L$D$L$  ȋ붍|$ 9;uʉ#e ;avCYu@D$t*D$$D$D$D$ D$D$ fD$$]  V뤍|$9;u#e ;avAYu>D$t(D$$D$D$D$ D$ D$ D$$  릍|$9;u#e ;avIYuFD$t0D$$D$ D$D$$D$0D$ L$D$(L$,w  p랍|$9;u#e ;aD$@L$1B9}  u#$ID$D$ ǀ@=L$9t$L$D$@TD$ 1D@A}r,L$T$1 ,\(@C9}rD$` Y R 0$D$ 0$D$ Ge ;a #$H|$|$t$d$X tX tS=LL$1B@} s9u@$\  0$ D$V 0$D$< 腈@e ;av8 #$=H|$|$t$訢D$ƀD$X 1e ;ahL$()ʍ RL$T$$l$t$|$11D$&DJT$l$$\$(l$L$L$99 h9l ͍H9L ? 9T$9l$ \$ J ?,/9sDJl$ ?,/9MDJl$ ?l=9&$)Å9 $,X9D ?8T$9\$B ? 9L$u+@tJ9saDB@9sILÃuB? /9s@L@t׍J9s#DʉXà           { t 蝅xe ;a,L$0@T$8BD$$Tl$$)3$T$T$XD$D$ L$L$T$ T$(\$0$T$L$D$ \$4\$\$8\$\$<\$$D$(D$D$D$D$ D$ ;D$L$D$@L$D,Ë\$8CD$$Tl$$)Aye ;ay8L$L$$T$ 11|$1lD$Yu;D$t%H$L$D$ L$L$D$ i멍|$9;u#e ;av+D$$D$D$D$ED$ D$>ie ;av,D$D$D$$D$ED$ D$he $4;Av@LYu:$Pt!#$H$TL h렍$P9;u#e $0;AvNPYuH$Tt/蔂$X$H$L$\P  h뒍$T9;u#e ;aD$$L$L$胫D$L$Q$D$D$$D$ L$Q $D$MD$L$Q$D$D$D$ L$ $D$D$D$ D$>gIe ;aD$HT$Z(291ɄJX9HZ jp 9te1Ʉt[HZf9uJHZ8t5JX9t 1D$Ã$BD$D$胤D$ 111ˉ4$L$l$L$ D$T${1t1m,$L$\$L$ D$T$#fe ;aD$L$T$ \$1D ot$|$9}D4+D$439s/yވލEt$49r D$ G @ ieTe ;av$D$D$ &$D$(D$D$L$ D$L$ w$D$D$D$D$ D$3D$L$D$,L$0$dee ;aV4D$8L$D$HD$L$0$D$D$$D$L$ D$ L$${We ;avD$HD$L$ GWe ;avAD$$$D$(D$D$@D$ D$L$T$ D$,L$0Ve ;av3D$B$D$D$L$ L$D$ Ve ;av>D$ $D$gD$ D$@.D$L$L$$D$(;Ve ;av=D$ $D$$D$D$L$T$ \$l$]UD$(L$,Ue ;av6D$Hy$D$L$D$L$ L$D$ Ue ;av,D$H$L$VD$ L$L$D$=Ue ;ahD$l0$L$L$'D$ D$4L$L$ T$T$$|$81Dm`$L$lL$l$8l$b0D$4L$ 1D$8$2D$(PD$4L$ \$8t7\$<k9T$(t.-e <Ѕu믉k릉$L$T$$T$Ü$D$ D$D$'D$ D$0L$L$T$T$1 YыT$l$ 9}_\$,D$4 ؋Q -`,$t$lt$L$T$ ]D$L$,T$9s6e l$0|uDk뎉D$pL$tT$xh1pD = fS1e ;av,D$H(@,t L$D$ Ë|ud 0 L$D$ Se ;avD$H@D$L$ Re ;av D$@$D$Re ;av+L$T$J( e uD$ B,Íz,D$ inRe ;avQD$ @$ D$D$L$L$1#T$$D$$ӋD$PD$L$9|كQe ;avQD$ @$D$D$L$L$1#T$$D$$ӋD$PD$L$9|كQe ;av:D$@D$`$D$D$D$ D$ "[D$D$$/Qe ;a0D$4HL$ ` $T$8T$\$<\$ ^D$L$D$HPI\$@\$\$D\$$ыD$L$ D$4HtZ@D$`$D$8D$D$Ge ;avY `&$D$D$L$$ $L$(L$L$,L$ L$0L$L$4L$L$8L$1D$D$< Fe ;avRD$0L$$D$4AD$ $@D$L$D$(D$ D$,D$D$8D$D$D$ D$LD$$D$P0É뜋|ud -0 ;e ;avD$tЃÉ$;e D$;A $Q Yi umf U-W QT$\U-9 9 t$()։t$,ۇ!4*t$@t$,T$4*-=SQWQ e ЅAl$L$Y$t'tuʅtGJ@$A6L$뭉T$$D$(D$$D$(ÍyD$H냉$D$A 0%e ;av D$@ D$\0e ;av(=@od  e u CÍCG0e ;av Pc /e ;a `J$D$L$H e ubL$HD$L$H$  $TD$ P; e uL$HL$ ÍxD$FljFݍxD$F/Fe ;av2L$ T$J e uD$BD$B$ÍzD$NF.e ;a8@od H(@,D$0D$4d d D$,L$(T$0$D$L$ D$0L$4D$($D$,D$PD$D$ D$0D$D$D$8Ë|ud 0 Z踩 -e ;a#pBD$D$T$ $ D$ R e uL$H`T$ L$$D$(ÍxD$h9‰ȉԍzD$T9끍ٳ$|$@@O!e ;a<(D$,HT$0$ыD$D$,$L$0L$D$L$ D$HL$ $fD$HPuwHtCL$4L$ L$8L$$@D$ץ$D$ D$/D$ D$$i(e $u D$H뢋T$z@8됋D$4@L$T$ D$L$8 $뤋D$,D$D$0D$ D$4D$D$8D$$AD$4u(Y e ;aD$L$UEхtCPtuy9uftV]ruJ 9u7tŁju `9utD$ D$Ét$ D$þ߉‰L$ D$É͹듍L$D$ 0׋L$Ly1 3벍xÉ3"$|D$Lx‹D$X2ЋT$XD$$dHÍ0$D$ 2=e D$;ADŽ$DŽ$DŽ$|$X1O3$Q$$ҍt$|$X8L$L$/|$Dt$X7L$/|$l12|$l2$L$l$T$p $6|$|$8O$L$@e Ot$lp7|$@$~7$$$D$P>D$D$8D$ D獴$D7D$L$…!Ӆ ڄD$8$D$ 4c 0c T$L$ $kD$ `S e u/L$8H$$$蝠ČÍxD$80‰ȉ‰D$4L$0D$8HL$< $^D$L$D$ {{,e ;av}X|$D2t$D2D$dD$D$hD$ t$|$01D$\$D$`D$|$t$01MD$L$$T$ D$lT$pL$tXLge ;a D$D$L$ L$ T$C $D$$D$L$ e umL$HL$H e uCL$ H L$$H e uL$(H L$,D$0ÍxD$(*܍x D$ *벍xD$*11A0$D$֝ 0$D$輝 e ;a4L$8Qt[|$1F+\$T$ L$8Q Y\$$T$(QIT$,L$0 . $D$L$L$D$ D$yL$T$T$e ;av+B$D$wd wd D$L$ e ;a3e vu萎 e ?=Hg4$D$qD$L$ wd e  wd <$e L$ nd <$e L$uO nd @$D$-fe L$u nd e Í=nd %=nd %먍=nd %t=wd %<"e ;avlHYul|$P1d&|$ [&L$LIR $ҍt$|$ +L$L$|$4t$ +|$Pt$4*L$L$dH x|$L9;u#e ;av?YuYu;D$@L$T$8T$T$Yu;D$@L$T$PT$T$TT$ $ЋD$L$ L$XD$\k멍|$9;u#e ;avQ D$$L$L$KD$L$Q$D$LD$L$ $D$LD$D$ e ;aD$H\$k39tt1ɄtjH Pk s9t;1Ʉt1HS[@9t 1D$É$L$T$QD$ 1݉$L$l$QL$ D$\$1뤉$L$l$QL$ D$\$l1e ;avkHYuk|$d1d|$ [L$LT$PI$эt$|$ !$L$L$|$4t$ $|$dt$4#L$L$xHy|$L9;u#e ;av&Yu#D$ @L$ $ЋD$D$$3|$ 9;uՉ#e ;av. Yu+D$@L$ $ЋD$L$L$(D$, 빍|$9;u͉#e ;a8(D$,$+D$D$$D$%_ ZYD$_ ,9D$D$D$,$ D$D$ L$f$@fD$ _ PL$swT$ Z\\YXZ. D$D$0(ËD$,$; D$$f\D$D$0(D$0(D me ;a(D$,$D$*@:_  ZYȅٍ-@8_ t9aD$L$D$,$kD$D$  ЍT$YY $dD$ @6_ PL$T$ Z\\YXZ.D$D$0(É\$D$,$D$$beD$D$ D$,$D$$:eD$  fXYD$fXYf.rD$~XD$0(\D$0(L$0(É|V~ e ;avG $-D$D$ $L$L$L$L$ND$D$ D$ e ;a L$D$$D$L$(L$虠D$D$L$ L$i$D$L$$ e u9L$(HL$H e uL$H D$, Íx D$xD$(WBe ;avjD$HpN9uKu#D$ $D$D$D$D$% ËBL$L$L$L$$ЋD$@É˹ze ;av( D$@I$ыD$L$L$D$ e ;av& D$$D$L$ ȉD$ 3e ;avuD$HP tA$ЋD$L$L$D$ É$)D$D$L$L$ T$$ D$ D$T$  ʉT$D$ oe ;av D$$D$D$ ^e ;av D$$oD$D$ e ;al,D$4T$8!م ˄,ӃӇÇ݅Ç!$D$L$\$ `D$D$()L$T$T$$\$0$L$()ȸL$$ȉD$L$T$D$0$yL$T$D$9Ël$9Ç!9 ޖulj$L$D$4D$D$8D$ D$L$L$e ;aD$ H:D$L$ $PT$T$D$ L$ $D$T$$ЋD$H=3D$L$ $PT$D$L$ $D$T$$ЋD$HɃÍ0$D$҃ 6e ;a,D$0HpN9uJPT$ $L$4L$L$8L$L$e ;aD$0\$,+s|$T$ D$1D$ D$"t$C t$I\$ \$,\$ 9}2t9rKT$(Ћ,$t$\$ T$ 9ӋD$0|$ԈD$,(p\$4D$8D$<s D/e ;avtd $D$D$ e ;av5td $D$D$D$D$D$L$ L$ D$$e ;av% td $D$D$uD$D$ de ;av! td $D$D$ (e ;avSD$$};D$HP I$ыD$D$L$L$ T$$>D$D$D$ D$ e ;avSD$$ ;D$HP I$ыD$D$L$L$ T$$>D$D$D$ D$ Fe ;avC D$$:D$HP I\$\$\$\$$ыD$$= e ;avJ D$$=:D$HP I\$\$\$\$$ыD$D$$H= e ;ae ;aD$Q}^HQP} ^HH_sDLY(_s1D(@ÉY  ‰T$L$ l "]e ;avmD$Q}^HQP} ^HH_s.LY(_sD(@ÉYT$\$ cl we ;ae vuo e bH$D$D$ L$L$L$D$D$D$L$ L$`L$үD$L$H e uGL$H pN $D$e L$u td e Í=td x D$e ;av" B$D$L$L$D$ e ;av% B@J $ЋD$L$L$D$ de ;avYD$$L$L$2D$L$Q$D$p2D$L$ $D$D$ wD$ D$e ;aD$HT$(r9tx1ɄtnH Xj r9t?1Ʉt5JZh9Ëh9!˄tJ@8D$11$L$l$8L$ D$T$1렉,$L$t$i8L$ D$T$h-e ;avBD$$L$L$D$uD$ L$ $D$1D$D$7e ;avVD$T$9u?JX9u1J RX @9t 1D$É$L$\$7D$ 11e ;av:1L$ D$ T$$L$-L$D$ @=|ىL$oe ;av2D$L$1B} .u{D$ D$ e ;av:1L$ D$ T$$L$-L$D$ @=|ىL$e ;av2D$L$1B} .u{D$ D$ ge ;avh$D$(HP I$ыD$(@T$\$L$D$$D$ D$T$\$ZD$L$ D$,L$0$|e ;au@D$DT$LZl$P9t$Hf DHS9f DHZ9@f DHS9f DHZ9xf D@ K9fTt$TL$Xl$\@É\$4fD$*3$t$\$l$ L$7t$D$l$HD$*\$4뢉T$ ̑d ȑd 1fwH9] ̑d ȑd 1fwH9| ȑd ̑d 1fwH9 ̑d ȑd 1fwH9 ̑d ȑd 1f_ L$ T$@$|$G e uP /L$O e u!D$ G D$LD$P D$T|$X8ÍO ω‹D$ 5Ѝ/&뫉D$PD$TD$X89\$@4h9\ l$L11 \$L$(@$"|$G e uP 0L$O e u!D$(G D$LD$P D$T|$X8ÍO ω‹D$(aЍ0R9\$@4h9D Ƌl$L11?\$4L$ @$f|$Ge uP L$ O e u!D$4G D$LD$P D$T|$X8ÍO ω‹D$4Ѝ9d\$@4h9QD Ƌl$L11^\$L$$@$誤|$G e uP XL$O e u!D$$G D$LD$P D$T|$X8ÍO ω‹D$$ЍX9\$@4h9D Ƌl$L11}\$L$,@$|$Ge uP L$O e u!D$,G D$LD$P D$T|$X8ÍO ω‹D$,-Ѝ9\$@4h9D Ƌl$L11\$0L$@$2|$Ge uP pL$O e u!D$0G D$LD$P D$T|$X8ÍO ω‹D$0qЍpb9sI\$@,p9s:t ʼn11^ z^ s^ l^ e^ ^^ Re ;a\\D$` A$D$L$`f $D$dD$T$hT$\$l\$ l$pl$t$tt$[D$,L$$T$4\$0l$l$Lt$ |$T$X\$Dt$l|$d@$衡|$Ge ui aL$DO e u:D$XG D$dD$xD$LD$|D$l$ $$\ÍO ω‹D$X뷍a뒉D$@L$TD$` I|$l$t$ \$p\$\$t\$$ыD$$L$ L$ 6$$(l$D$T$ L$胤\$D$T$H$DŽ$8DŽ$<DŽ$@$D$H0É$$$D$ đd L$UD$ u$$$,$($8$$<$$@DŽ$DDŽ$H0=e ;a4D$8HL d d ,HPhl$ $L$T$]D$L$T$yL$8QX9\̑d -ȑd X9̑d ȑd T$,\$ @$D|$Ge uH l!L$ O e uD$,G  D$<|$@4ÍO ω‹D$,؍l!|볉AA @A D$<D$@41҉1O\$(l$@$蛍|$Ge uH L$O e uD$(G  D$<|$@4ÍO ω‹D$(؍ 11L$0T$$@$|$Ge uH L$$O e uD$0G  D$<|$@4ÍO ω‹D$0W؍ H볉T$e $;A^l$pH~$D$L$ΜD$$@L$T$\$ ىÉ$<$$$($X1$p $$X$@Z$$ $$D$X2 d $ 9 $$Q$(9w$<i< e u$D2$8$0$,$|$$DD$5$8$0$,$$<l$L$\$ T$D$L$\$Q$$PDŽ$tDŽ$xDŽ$|$$lÉ$4$T$đd D$D$ u$4$ $<$t$$$x$($|DŽ$DŽ$l{e ;av(D$$D$zD$ L$L$D$ae ;avvD$$D$L$d 9ttމL$ D$$ÉD$L$ $D$đd T$D$ u D$L$D$ D$$ne $H;A8$@1$< $D$[t$$M$$4$$($%$@$($L$4$P8Je $0;AP$X1$($T $D$t$$(m$ $$$$<$(E$X$<2$l$$$pP3>e $;A^l$pH ~ $D$L$辗D$$@L$T$\$ ىÉ$<$$$($X1$p $$X$@J$$ $$D$X" d $ 9 $$Q$(9w$<i< e u$D2$8$0$,$|$$DD$%$8$0$,$$<l$L$\$ T$D$L$\$Q$$PDŽ$tDŽ$xDŽ$|$$lÉ$4$T$đd D$ D$ u$4$ $<$t$$$x$($|DŽ$DŽ$l{e ;av(D$$D$jD$ L$L$D$Qe ;avvD$$D$L$d 9ttމL$ D$$ÉD$L$ $D$đd T$ D$ u D$L$D$ D$$ne $H;A8$@1$< $D$Kt$$=$$4$$($$@$($L$4$P8Je $0;AP$X1$($T $D$t$$(]$ $$$$<$(5$X$<"$l$$$pP#>e $;A^l$pH ~ $D$L$讒D$$@L$T$\$ ىÉ$<$$$($X1$p $$X$@:$$ $$D$X d $ 9 $$Q$(9w$<i< e u$D2$8$0$,$|$$DD$$8$0$,$$<l$L$\$ T$֒D$L$\$Q$$PDŽ$tDŽ$xDŽ$|$$lÉ$4$T$đd D$D$ u$4$ $<$t$$$x$($|DŽ$DŽ$l落{e ;av(D$$D$ZD$ L$L$D$Ae ;avvD$$D$L$d 9ttމL$ D$$ÉD$L$ $D$đd T$D$ u D$L$D$ D$$裼ne $d;A?$$1$ Q$t (ft3$$5%Ad d $$$(ËAQil$ $T$D$Xt$$$$$$$$t.$$5&$$$$(Ë$ 0H@$H AH $$$aDŽ$$DŽ$(/e $\;A$DŽ$,$.1$$(Q$t (ft@.$,$.5.d d $0$4$ËAQil$ $T$D$ZD$$"t$$$^$$$$"$ $"$$($t; /$,$.5"/$$0$4$Ë$(0H@$H AH $ $,$.$"DŽ$0DŽ$4$sNe $d;A?$$1o$ Q$t (ft3$$5'd d $$$(ËAQil$ $T$D$\t$$$$$$$$t.$$5(|$$$$(Ë$ 0H@$H AH $$$1DŽ$$DŽ$(e $d;A?$$1$ Q$t (f t3$$5)d d $$$(ËAQil$ $T$D$Q\t$$Q$$$$$)$t.$$5* $$$$(Ë$ 0H@$H AH $$$DŽ$$DŽ$(菶e $,;A8T$\1󫋔$XZ$t (ft5$\5@qd d $p$tTËBJjl$ $L$D$`t$$@󥋄$($$$,$@ʹt)$\5`s󥉔$p$tTË$X0P@$P BP $\$,DŽ$pDŽ$tT&e ;a(D$,H$t (ft0d d D$0D$4D$8L$D$ L$T$\$(l$$T$P\$8)ف d d |$`O usODd 5@d fuQu;oG e u D$PDŽ$DŽ$\ËD$PTۉ$$\Bf11륀uO,d 5(d 111{uO4d 50d bu׍O$d 5 d I$$\Ë\$@|"\$Tf Cf$l11L$HD$DŽ$|DŽ$XÍ 3 $L$PL$D$D$ D$a]D$\$83$l$\$T$ t$6]l$T$$lL$P\$8t$<|$D,D$Tt$H@$lH|$Ge uN aL$HO e uD$TG  $|$XÍO ω‹D$T譟ҍa螟뭉$|$XÀvđd d 11 ߇e ;aD$ H rq@ HX9h,$)ى!ˍ L$D$l$ 蕜D$ P@L$$T$(D$,D$0D$4Ëd d D$$D$(D$,L$0D$4 (e ;aHTD$X$L$\L$T$`T$\$d\$ l$hl$l$ll$ D$L$T$ \$$l$()\$Xq9f݈݇߈\n9\f 0߈\0ߋu9 (߈\(߉L(߈\(^9t݉f 0߈\0߅>969.D$p\$tT$x)!D$|DŽ$$DŽ$DŽ$TÉt$| h9&l x9| 1ۉ1L$(\$@@$@|$Ge uP lL$(O e u!D$@G D$\D$` D$d|$hHÍO ω‹D$@՗ЍlƗ9v\$P,x9c| 118\$DL$,@$?|$Ge uP xL$,O e u!D$DG D$\D$` D$d|$hHÍO ω‹D$DЍx9\$P,p9t 11TL$0T$<@$&?|$Ge uP L$0O e u!D$w6$D$L$D$ 赁D$L$$$  ze ;aHD$LEQҁq.&.u L$PT$X\$Tl$\Ή1ɉL$,1҉T$(GD$LÉ9}cp9~ى|$(\$#D$83$L$D$T$ t$ML$D$T$pD$8\$#l$,|$(덍uE|$\|$Xl$,t$(ËD$Ll$\t$P\$<t$,9vk<.|$()@l$,9tVC9\$Lt$4-3,$L$\$T$ D$LL$D$T$@\$111111$$D$$ 0D$D$y$D$D$zsD$$ L$$0$6-|$$0Ge uH$ DŽ$ DŽ$ $ $ p$ $ Ë$ j$ $ $ $ ȉ$ DŽ$ DŽ$ É$ $8$ $4@$[,D$$ $$ L$$4L$ 1ݺL$ D$t79~%5Бd -ԑd D$<1D$X1D$,D$|$Ge ux 쫺L$0O e uF$LG ;$p$r5; ^ $x$|\ÍO ω‹$LUZ뫍쫺FZf|$&L$4|$FZL$F $$`T$\$$hT$ T$4T$D$L$T$ L$8$X@$6|$Ge ux ̺L$8O e uF$XG <$p$r5<] $x$|\ÍO ω‹$XMY뫍̺>YDŽ$F$H1YL$(f$FL$&f$HL$*f$J$Lt$F|\$F$p$r$HQ\DŽ$xDŽ$|\9T$@$`t Q9L  t$(1fL$*L$@1k$Pl$,@$|$Ge ux }ͺL$,O e uF$PG `:$p$r5b:~[ $x$|\ÍO ω‹$PW뫍}ͺW9 T$@$`t Q9L  ϋL$@11KT$<$T@$|$Ge ux L$e ;avfD$>e ;a$D$(L$0Q\$49w2l$,|f9wbD l$@T$D\$HD$LD$P$ÉT$ 3$D$,D$L$\$ T$l$\$D$(L$0T$  >Se ;avfD$=e ;a,D$0L$8QT$ \$<9w^l$49\$$l$( $D$D$\D$(D$HD$ D$LD$$D$PD$TD$X,Í3$D$4D$L$\$ T$\$l$D$0L$8T$ k =$e ;aYe vu  e jֽ$D$0aD$ L$ d e d $D$-)D$ L$ d e đd H$D$&D$ L$ ȑd e d̑d b$D$,蹞D$ L$ Бd e ԑd SZ$D$聞D$ L$ d e d O#$D$ID$L$ 8d e  D$*$L$L$T$T$ |$ Ge ɺD$*$L$L$T$T$ |$ G e uyD$*$D$D$L$L$ |$ G e uD$0vd e ÍN=0vd D$NٍN낍ɺN2>rNҺbN=ܑd PN,=d >N=d ,N=$d NN=4d N=,d M=Dd Mp=d M&=Ld M=d M= d MH=d M=d xM=D$L$ű$D$D$$D$܆D$$HL$ `  $L$(L$T$,T$ A|$e unD$D$$$yD$$$D$D$L$(L$L$,L$ L$0L$uD$H PXh@L$4T$8l$<\$@D$D ËD$G덉D$HAHL$$ $yD$$臇D$HP X@T$4L$8D$<\$@D$D e $u D$$HT$$zbGq/1e ;a,@$D$AD$0L$L$ $ uD$0HHL$ `  $T$4T$\$8\$ |$e uaD$$D$0$vD$0D$D$$D$ D$4D$D$8D$D$NjD$ DL$ e $u D$0HT$0zD%-Pe ;a64T$HЋD$ L$\$,$t$ԍOω‹D$t>럍O ω‹D$4=gD$h=6$  0$D$ ,&We ;a!0`Ʒ$D$8D$D$D$ D$(L$L$T$T$  $|$|$,e 50[BL$8T$,\$41l$$El$8t$,L$4\$49?},tϋLJr e D$$L$4\l Ze jT$ $D$D$pD$L$[ttQ@I<O9u[u9J*Rt$$\$9ߍvt$(LT e u,$׉É;؉111{Z߉;'׉Ɖ;D$(D$@D$D$DD$ D$H0Í $|$0[D$l>QŸ 軟 #e ;a$D$( c c c $T$L$D$ L$,L$T$0T$U D$D$"L$L$#T$($T$,T$T$0T$ D$ D$4D$#D$5D$"D$6$D$4fD$5$#>e ;av D$@D$"e ;aD$@N$L$T$:D$\$@l$D  ݛ ֛ *e ;aN\D$`P\$d9/,tD$L$l$ANNt$<|$3$D$|d$D$t D$|L$3NN-OD$|HXl$hu}ml$ |$t$$L$\$6D$t D$|L$3NN-ON$t$@l$D$`G$DŽ$DŽ$0$ $]ÍO$ω‹D$`볍Oω‹D$d녍OZW-w $D$4c T$ D$ tc c D$`L$H $D$wd T$O D$ t d d XD$`L$H=je ;a8D$PD$TD$XD$\D$@H`NT$@e T$T$D$ыD$L$ 9D$\$D$L$ $D$L$T$ 11늉׉ʼn|륃3 %e ;a  D$$D$L$(L$T$,T$Ѐ$\$\$SD$ L$ $D$UCD$$L$(1B9}l9,m 94v f9t؅||9wxT$l$,)͉ۇ!ݍ($)ʉT$|$SD$$L$(T$9w,T$,)ډډ!Љ$)L$l$ 3 3 2 蹶e ;av D$D$萶e ;av8D$L$9s%T$@\$9s If9D$2 1e ;avYL$T$ 9sC\$,1 谵e ;a(1D$L$09}iD$HL$ $ľD$L$T$09\$,,<9svl$5e ,u L$ 량D$닋D$,D$L$ D$4D$$$D$D$DQD$L$ $L$@(0 e $ ;AH`X$$y$($,$( щ ف׸ʚ;?=$ 3 $D$D$L$T$ \$DŽ$DŽ$ DŽ$$$$1f$f$Ƅ$$$\$L$|$ $t$$<.~ $$\$Hd d E$<$|$$d$$ $$<$$+D$L$T$ \$l$qވއ߈X$f$hr$ۇƉ$l$p$$t$x$|$$$`fDŽ$hDŽ$lDŽ$pDŽ$tDŽ$xDŽ$|DŽ$$$`fDŽ$hDŽ$lDŽ$pDŽ$tDŽ$xDŽ$|DŽ$$$`Ƅ$H11Avđd d #11$0ʉ. Fe $|;A$$$f9uz$ $f9tƄ$ $ $f9u܉獴$ $$$tƄ$ Ƅ$ Ƅ$ [e $;AE$XO$1ADŽ$DŽ$DŽ$$Q,$\$$\$$\$ $$ҋL$T$j3$D$D$xD$$TL$$PT$$L$$H$$Dt$$|$$l$ $$$$$Hl$|$t$ $$ыD$L$T$Z$X1$9$X$$\$T$L$ $0$TD$$$$0<$X$$@$PH$$<$@.$f$$L$$H$$`$D$<$$$XA$$$DŽ$DŽ$ČÉ$ $5Y$5$ $$ČÉ$$5`X$5$$$Č) e $;A;$1DŽ$DŽ$DŽ$$Q,$\$$\$$\$ $$ҋL$T$\3$D$D$D$ L$T$$$$`$$L$$T$;ID$L$ $D$$D$D$ $L$D$L$g$$Y ډ$ 9$9$$`$$D$$D$vHD$ L$$L$$D$$ L$ $L$D$L$T$*$$P1$$9$P$$\$L$D$ xt$$8D$$,$8a$P$t$$H0$$D$H$f$|$$$$,K$$D$tC$$P0$$,DŽ$DŽ$ĄÍ$5K$5d d $$ĄÍ$5J$5x{d d $$ĄÍ$5`Id$5h6d d $$ĄÉ$($5 H$5X$($$ĄÍ3$T$T$6{L$ D$$ $$$5F$5Hy$$$$ĄÉ$L$5E`$582$$L$Ąo$ h$ a# Z$ 胧e $|;AJ $ho$諿$(1UDŽ$\ DŽ$` DŽ$d DŽ$h DŽ$l fDŽ$獴$$$ $$؋$$$ $l$,f$f$$$$$$5L$$ƍD$$׍T$$\$ $$$$P$$1$$@$@$$$$$$$$$H$p$mw$T獴$T$ D$$$L$l$@$$ $$L$$$@Y։D$$L$ $T$$x$D$\$$$$xL$$T$$\$ $p\$$\$$l$,D$(L$$T$ \$b$$|$,1躼$xI$$э$,$tL$$e$$,U$e$$2$$ ى щʁ€׃ …!ʄa?$h1茻DŽ$DŽ$DŽ$ X $$|T$$\$AL$$1,$| $$T$$ff\$$$ʽ$$$l$$$E$$$$$`$$\$h$ռ$$覿$$$h$|I$$ы$h$h$D$L$d 9ux $D$đd D$sD$ tY$$($h%$\ $DŽ$h DŽ$l (Í$(5Pݻ$\ 5课d d $h $l m(Ë wd 9 0c 9tT$$$(5Ol$\ 5>$h $$l (É$$L$4c T$=D$ t c c |$hi$$L$wd T$D$ t d d 9$h$1I$| $$T$$ff\$$$$$$$$$$$-$$$`$\$h$$$ʼ&$|H $$$荼$ $$1$ $ˉm$t$(5`Nn$\ 5@$t$h $l &Ð%Í$(5 R$\ 5Ld Hd $h $l %Í$(5 Mи$\ 5袻 d d $h $l `%e $`;A $2fz$$$$$$$tJd 9t!d d $D$H É $D$đd T$D$ t$2fu $.tx$2ftNftHfu!xd |d $D$H Ëpd td $D$H DŽ$DDŽ$H $1xd $9c $$D$đd D$D$ 9D$XG DŽ$DŽ$ $$ĠÍO ω‹D$X6f볍V#'f뎉D$TL$0$H$$$諹D$$@$ $ЋD$D$@L$L$(wd 9tr0c 9t1DŽ$DŽ$$$ZĠÉ $D$4c T$蝘D$ tc c 뢋D$@L$(똉 $D$wd T$fD$ td d hD$@L$(QDŽ$DŽ$D$0$D$T$ĠÐĠÉ $$T$D$D$ -$$|$`t$xgj脡$D$|$ 5d Hj$ ,SL$duĠ1D$l\$pщsDŽ$DŽ$$$ĠÅtQ9r`tQ9FtQ9hj$H$$$/D$$@$ $ЋD$D$,L$L$Dwd 9tr0c 9t1DŽ$DŽ$$$ĠÉ$L$4c T$!D$ t c c 뢋D$,L$D똉$L$wd T$D$ t d d hD$,L$DQ$H8P4T$L$$D$ !D$L$t1DŽ$DŽ$$$ ĠDŽ$DŽ$DŽ$DŽ$ĠÅɉD$LL$D$LG DŽ$DŽ$ $$>ĠÍO ω‹D$LUa볍LFa뎅DwV5 *Ie ;avK@ȸ$D$D$D$D$ 腥D$$藤D$L$D$L$.Ie ;aD$$L$ L$D$ L$%9u11ɉD$$L$(ÉD$L$@]$|$Ge u@ L$O e uD$G  럍O ω‹D$__뻉ʉq?He ;av+D$$D$D$ L$L$D$Ge ;av+D$$D$D$ L$L$D$Ge ;a(D$,$L$0L$L$4L$L$8L$ D$L$T$%9u11҉L$L$$L$ O e uD$(G  둍O ω‹D$(TD$${T뽉L$D$0$YD$$!D$ D$4D$8D$<,l$@뉄$HT$L$L$| $@D$L$T$ $L$D$0}D$D$8L$ $$ZT$\$T$\$@D$D$LL$L$HT$ $$L$D$r$$D$HD$D$LD$|D$ L$$$\$D$L$ HD$HPj9JHLl$X)<Ӌ e $  $$T$D$l$ GD$PXk9D$L$X@=T$`\$0D$40$\$\$[D$ D$\L$L$(T$T$,0$D$L$T$ \$`\$\$0\$\$4\$MD$\D$pD$(D$tD$,D$xSd1Bd0e ;a8D$DD$HD$L`d $!v`d D$$WD$?D$<$D$@D$D$ ld u"D$DD$HD$Lr8Í$ld D$F=D$T$X@tL$4\$(D$,0$\$\$D$ D$0L$L$ T$T$$0$D$L$T$ \$4\$\$(\$\$,\$ELD$0D$DD$ D$HD$$D$L跶81D$DD$HD$L莶8Ð脶8+/Fe ;a0c D$,c T$$\$4111A|$,9<ȋD$(|$ !tωL$ u:$l$t$D$(D$ D$D$4l$t$L$ T$$\$4$l$t$UD$ D$N4l$t$떅u L$8D$<0É.e ;a,D$0f$D$ L$T$\$l$uT$4L$8D$<\$@l$D,ÉD$L$T$$\$ l$( ȱ$q|$Ge  jĺG  e  AӺOG e uzGG e uNGL$ O e u D$(G$D$L$T$$0&O$ω‹D$(_DэOω1KD륍Oω17DvOωAӺDCjĺ D ȱ$W|$Ge  jĺG  e  AӺOG e GG e u]G$d d O e u-G$D$4D$8D$<0D$@|$D,ÍO$2CƍOω1C떍Oω1 CgOωAӺB0jĺBS+>e ;a,D$0f$D$ L$T$\$l$uT$4L$8D$<\$@l$D,ÉD$L$T$$\$ l$( ȱ$|$Ge  jĺG  e  AӺOG e uzGG e uNGL$ O e u D$(G$D$L$T$$0&O$ω‹D$(AэOω1{A륍Oω1gAvOωAӺLACjĺ:A ȱ$|$Ge  jĺG  e  AӺOG e GG e u]G$d d O e u-G$D$4D$8D$<0D$@|$D,ÍO$b@ƍOω1N@떍Oω1:@gOωAӺ@0jĺ @(>e ;a8DZ$)D$L$@~JD$T$H\$<1 ͋L$@|$YE e uTǍt$DE9t+Ml$@9|Ƌ\d Xd D$LL$PD$T8ÉD$LD$PD$T8É\$l$ DZ $D$L$L$ BD$T$H\$l$ ' e D$;A)$$?{$D$$ WL$讦|$DdDt$DYDD$D$Vt$|$X7D$pt$@"D|$t$XDD$(^e -|$@t$DC$$$L$<$D$D$e L$ $H,`$$L$D$Re L$ 8$H0$T$<1l$8U Ë$T$8\$4$B|$l$BH,l$ll$0L$  $L$xT$tT$L$ <6D$L$0$H0L$ ` $T$lT$D$t!D$4@$9R{ĬË$H0T$xT$0\$t\$葫ĬÐ脫Ĭ($e ;aD$ D$$D$@d $D$D$D$ U@d $v@d D$$WD$'uZ`$pd D$D$D$D$ L$@tT$ D$$裪ËD$$CT$D$ؐ胪D$ D$$i#e ;aD$(D$$@d $D$D$D$ =@d $u@d D$$WD$u_$ld D$D$ D$L$$L$ /D$L$tD$(芩ËD$ $D$$D$D$ؐfD$(T!e D$;A|$\;:$D$D$L$ T$\$l$\$4l$H@]$\|$G e ur %L$4O e uCD$HG DŽ$DŽ$DŽ$ $$ĴÍO ω‹D$Hy8뮍%j8뉉$L$T$D$ L$T$\$L$ $1111ϋL$ ΋L$ t$$|$X|$x=|$\t$x=L$`fLf3L$lƋD$pl$(t$T\$,/!9rL$::}"9l$8<k9_$t$D$l$ D$L$$$ĈÍ 3 $t$|$l$ D$t$D$l$$$\$(|$4V~k_l$89>:|$(lj؉|$(=D$D3$t$|$l$ \$Dt$D$l$XD$D$$|$4렉l$8뜋l$8؉$$L$$D$S$D$D$UD$L$$$ĈD$ND$QD$UD$Y 0L$N$D N.QX S0\$NTl 4 CD4O.l x iO0LT,1D,P.T@ sc0DD(qh$\$D$D$ D$L$$$ĈÀdsALi <)-0DN0LlT$$|1ЉT$@iҚ T$<)Ѓ0DDL$<iҚ )уA0DD$$L$@iH0LdsJL ЗiҚ )ǃG0Dt0T$[l$ D 藉l$@i l$D$D$?D$0 1D$TL$PYiqD$ D$$D$(D$,=c c \$D$D$T$L$ 9t $D$|$D$D$,D$D$-D$D$.D$D$/D$ u1D$P$D$TD$D$XD$D$ WeuD$P11뫋D$D$D$HD$D$LD$BD$ `u D$D1D$P$L$TL$T$XT$D$ sne ;aveD$L$11B9}:,tCuu"BB9}s!,tD$É\$D$c e ;avOD$$D$D$L$L$OD$ uD$ D$$ÉD$ D$D$$ze ;avMD$u귺D$$D$(ËL$ $D$D$ D$D$ L$D$$L$( e ;a3D$PX $T$\$;D$ L$T$\$k s[uUuD$ L$$T$(l$,t$0\$4D$ D$$D$(D$,D$0D$4Ãuu D$ D$$D$(D$,D$0D$4ËD$PXu ȉщ4D$ D$$D$(D$,D$0D$4e ;a,D$0${D$D$(L$L$T$T$ \$\$$l$4,$t$8t$|$<|$D$ L$thT$9uWD$4\$ l$(t$$1 GD$4l$(t$$9})9sA4>9s9,/!8!8ÇtD$@,D$@,D$@,ËL$8D$4` e ;avAӺD$D$ e ;aHD$L$[D$ L$T$\$l$t$tu귺D$PD$THÉD$(L$@T$,\$$l$e ;a,0D$$D$8L$41D$B؃T$(.HȉD$4\$8$\$袷D$L$ T$t6=/T$89)ʉ!ʋL$4ыT$(moD$<D$@D$D0D$<D$@D$D0ÉÉdD$<D$@D$D0ÅD$$D$L$%L$T$&T$\$'\$-3,$D$D$4D$L$T$ c -c 9~pD$ L$T$,9t$l$\$D$ v|L$T$,J vdL$J vPL$Jv<L$JT$뷋D$\1덉L$P$L$L$0T$(\$H!-Nl$ \$, ȱ$|$Ge  +ǺL$8Z8B4_ e G QD$(T$0\$4!-N\$,l$  ȱ$ފ|$Ge  +ǺL$<B4R8W e G A@I11ljpD$lD$p%D$t|D$xH1se ;as D$$t?H?Rau 9ET$(Әu 9D$(tD$,D$0 ÍHL$@D$@d $计D$ D$L$L$@N$萅|$GGe uFL$L$O e uD$G ND$,|$0 ÍO ω‹D$؋D$뵸7BD$ @N $|$GGe uD$ND$,|$0 ËD$cme ;avTD$t HP D$ É$L$T$D$ t D$ D$ Ue ;a,D$0tZHPh @l$D$D$4$\$T$L$ D$/D$L$ T$$\$(D$8L$u6L$Pudp4u udp6tL$PL$P $D$$T$D$ nD$ D$T`D$Tl 蕊 e ;a0D$DPd @ Td $ЋD$D$(L$L$, DZ$J|$D$(Ge u^L$,L$DO e u1D$@GD$HD$LD$PD$T|$X0ÍOω‹D$@JD$,=띋L$@ $D$kD$t\`ȡ$uI|$D$DGe u.D$@|$HD$LD$PD$TD$X0ËD$@ɠ͋D$4$D$8D$D$ $D$wd T$D$ td d \$`D$TL$ D$|D$D$lD$ $|SD$p c AIu$$T$lЋD$`tHtx$$ٟ9]Jj$l$L$$D$`PD$L$\$ $L$D$$D$ $$L$D$Ћ$$$$$t0111퉄$$$$ $Íٟ9UH@u 1ۉʼn1밉L$@$D$D@N$L$L$]TD$D$|$G e uP 7DL$DO e u!D$@GD$HD$L|$P(ÍOω‹D$@ȕЍ7D蹕뫉D$HD$LD$P(ËD$,$D$0D$D$4D$D$8D$ D$Ne ;a(D$,~O $L$0L$L$4L$L$8L$ z D$L$T$uL$GL$ O e uD$G$ 0HO$ω‹D$lcݍO\c뵍WLc덍W_넍W._Y_)D$DD$H(Í%D$DD$H(1_GZe ;a(D$,pI $|$t$0hd D$L$D$ L$$ ȱ$|$Ge  L$,Z8B4_ e GGe uoG QD$  $ID$L$ T$uD$$T$(L$,ÉD$L$T$ ȱ$|$Ge  L$ B4R8W e GZe ;aD$H @$ 9uFH @$D$L$D$L$T$ u 1D$ ËJ$D$$L$T$D$L$ T$u 1D$ ËA$D$¸l=/e ;aD$HuC acceu9Jfptu.H$P %9 uhH$@  9uFA I`$L$D$D$L$ T$u 1D$ ËI$D$ ` $D$T$D$L$ T$u 1D$ ËI$D$ʹlD$ Ãg: ,$D$L$uD$ T$t$(؃u,=unavu#Cf=aiuClue1ă뿉t=u4Ƌ=notfu$C=oundtuȋ=tryauC=gaint볃\$$L$l$$l$D$D$ rD$l$D$(L$T$\$$D$(L$T$\$$l$\6e ;a D$,D$$$D$(D$kD$L$T$ tQL$T$P$uD$L$ e uL$HD$, ÍxD$LD$$ PUD$дu( $D$D$&D$D$,h Ð^ 5e ;a ICӋt$4|$$L$ۋ\$ t$4|$$T$L$L$9}\wn)͉ۇ!l$9sNTe )9w:)‰!ЋT$Љ$\$D$ D$L$ .D$D$(1 A e ;avdD$L$9uKL$ T$1C9}4s>,uw 4~w 8؇ޕtD$D$D$茛 e ;aH3$D$D$iD$D$,L$L$(T$ T$@111D$,L$(T$@\$0l$Dt$8\$8l$Dt$4|$LT$L$D$ L$P $׋D$L$T$=\$,91L$d L$$9t0;D$TD$XD$\L$`D$GL$O e uD$G$ 0HO$ω‹D$-ݍO-뵍W׉1-뉍Wt-^5b-.%D$(D$,1de ;axD$ b; $L$$L$舏D$ L$T$ \$u L$(D$,ÉD$L$ ȱ$|$Ge  L$ Z8B4_ e GB@RGL$O e uD$G$ 0HO$ω‹D$,ݍO+뵍W+덍W+b+2%D$(D$,1he ;axD$ b; $L$$L$(D$ L$T$ \$u L$(D$,ÉD$L$ ȱ$p|$G e  jL$ Z8B4_ e GB@RGL$O e uD$G$ 0HO$ω‹D$h*ݍOX*뵍WH*덍W8*bj&*2%D$(D$,1}he ;av%D$ D$De ;av%D$ D$e ;a<PL$D9D$HHP X(ɇÇޅ҇Ç!҇Ç k5 9S$D$4L$ T$$$D$@$D$ D$L$$L$ D$L$T$\$l$4tt$ )Ɖut$$މu -%9uu/11҉D$L\$PT$TL$X!ȅ ȈD$\<ÉD$0L$8T$(\$,@]$|$Ge uK nL$(O e uD$8G D$0\$, mO ω‹D$8(Սn'D$LD$PD$TD$XD$\<ûD$LD$PD$TD$XD$\<Ë\$H1ɺ@Ze ;a4$c D$8$L$<L$L$@L$*ՋD$ L$\$C 9u]e $Lb$c D$8$D$D$ L$v|I$L$D$L$uD$FÄt=~D$(D$Ð D$q e ;aBPD$d$L$hL$T$lT${D$ L$T$D$($L$dL$T$hT$\$p\$ D$L$$D$L$(HL$hˆP$IˆP%T$dP(H,T$`P8e  T$\P4D$@,t+tt SD$ÍSD$ÍSD$ÍSD$Ãu3@,t tuSD$ÍSD$ÍSD$à t|We ;a@`$D$p11ɋT$xD$0L$HB L$dY(\$\$|$ЋD$L$ T$\$QT$d$\$h\$\$l\$\$0\$ \$H\$D$L$!D$(L$$T$ \$D$d@0\$L$0T$(\$H!-Ol$ \$, ȱ${|$Ge  +ǺL$8Z8B4_ e G QD$(T$0\$4!-O\$,l$  ȱ$~y|$Ge  +ǺL$<B4R8W e G A@IOT$4\$, ȱ$Tt|$Ge  $O e $OL$,O e L$4OG e uYGDd @d O e u)G$DŽ$0$$ĬÍO$/ʍOω1뚍Oω‹D$4iOω‹$111$qD$L$L$L|$X1|$X$$$$\$L$$nd \$X$\$T$$T$ $\$D$L$T$jL$DT$0$JO\$(D$@ ȱ $Tr|$Ge  $O e $OL$(O e L$@O OO e u^$OL$0O e u-D$DG$DŽ$0$$ĬÍO$ω‹D$D(čOω‹$듍Oω‹D$@]Oω‹$%11$DŽ$DŽ$ĬÃuudp4Xuudp6E$|OT$<\$$$V5Ot$ l$8L$PD$T ȱ$p|$Ge   $O e $OL$$O e L$L$0T$(\$H!-0Ol$ \$, ȱ$W|$Ge  +ǺL$8Z8B4_ e G QD$(T$0\$4!-0O\$,l$  ȱ$U|$Ge  +ǺL$<B4R8W e G A@ID$4H|$O e uPL$$O e u'D$0GD$(D$P|$TD$,D$XD$8D$\<ÍOω‹D$0-$뫃u5du" 5'O11둻 0$D$ G~be ;aXD$\ $L$`L$L$dL$L$hL$ L$lL$L$pL$L$tL$8D$D$HL$ L$DT$$T$@\$4\$Tl$,t$(|$0|$<#^QBA0 9 ]l$P\$\[,5t\$8t$L P$,=D$PH|$O e ulL$8O e uCD$LGD$HD$xD$DD$|D$@$$D$<$D$T$XÍOω‹D$LJA돃u5Hu( 5'31v1o0$D$ ^|e ;a$D$(Q01T$8I,tj r9t D$<%D$@XD$D$É4$\$l$ȹD$ tǍ }$;|$D$8HO e uRD$($D$,D$D$0D$D$4D$ 0 D$|$8D$L$T$ L$D$ L$T$\$\l$,\$\l$,~0[t111t$<1T$(L$$D$XL$hQ|$|1]{\$|$$$L$<$L$hQT$`$\$`\$l$4l$ UsL$Yis9CCAe z$|$D$|D$|L$xz$T$\$l$ t$6D$L$T$|$xWe u ˉ‰qnyt$t|$8,e $uT$hJы\$\l$,t$t|$8T$hz&yىL$PT$LD$p$L$T$D$ ]D$;QHL$L9<D$DQl$pT$l$pt$Ht$\$W-D$ L$T$\$uK\$DCl$P9D$dt$L)މۇ!ދD$p)݋\$\t$dT$<ωl$,$'D$D$D$lD$ D$HD$fD$D$TL$L$ $\ |$D$ Ge u!D$Tp$$ĐËD$Twڍ$ |$Ge u#\p$$ĐÍ\jw$D$XD$D$$D$D$(D$ Dg\$l$111DŽ$DŽ$ĐÍ$f|$Ge u#p$$ĐÍvDŽ$DŽ$Đ      e^e ;aDBL$LT$H!l\$PKI}J$n|$Ge uǻpD$T|$XDÍǻuD$,T$Hl$PL$L\$#$L$l$D$ =詝D$uJ$|$Ge u3RpD$T|$XDÍ3RXuD$$D$H$L$LL$T$PT$8D$$vL$P9jP\$L9TT$(|$01uL$#L$0$L$HL$T$T$PT$ dL$T$T$4L$8$L$PT$()щ!ыl$HL$L$L)щL$\$ dL$T$L$$D$?@D$ e d ̷$D$@D$ e d $D$ ?D$ e zd $D$ ?D$ e <d lU$D$ D$ L$ 8d e  F$D$±D$L$ hd e  ld h|$D$花D$L$ @d e ] Dd  $D$RD$L$ d e  d $D$,D$L$ d e  d $D$D$D$ 3t$e uc=Мd ikE$D$ 襰D$L$ Pd e u Td R1M8e HÍ=Td 5e܍|$4k$Мd D$D$4D$gz=d d+=d d=Dd d=ld dMD$$d=td D$(dD$$d=td D$,dH=d sd=d cd=d Sd=pd CdF=@d 3d=Pd !d=`d dj=pd c =ld c=dd c=\d c~=4d c6=,d c=$d cc=td D$0|cOlcH\cLcX_=d b=d |b=d lb=d \bF=d Lb=d e ;avB$0w>e ;avZ(B$D$,D$D$0D$D$4D$ D$8D$D$L$T$\$ l$$D$e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\${D$ 1݉4$T$l${L$ D$\$=qe ;avpD$$L$L$W~D$L$Q$D$@~D$L$Q$D$)~D$L$ $D$D$D$ D$ =te ;aD$HT$Z*091ɄH Z jp9th1Ʉt^JZhp9t/1Ʉt%HZ8u@J8D$11$t$L$^zL$ D$T$1밉,$t$\$;zL$ D$T$x1q,$t$\$zL$ D$T$5;e ;avMYuJD$t4HP$L$T$D?D$ L$T$D$ L$$T$(蓽 ;뚍|$9;u#e ;avVYuSD$ t=HP$T$L$D$$D$ D$(D$D$,D$lND$D$0  ;둍|$ 9;u#e ;av>Yu;D$t%HP$L$T$:D$ D$袼 :멍|$9;u#e ;av>Yu;D$t%HP$L$T$d8D$ D$2 +:멍|$9;u#e ;av>Yu;D$t%HP$L$T$D8D$ D$» 9멍|$9;u#e ;av>Yu;D$t%HP$L$T$8D$ D$R K9멍|$9;u#e ;av>Yu;D$t%HP$L$T$5D$ D$ 8멍|$9;u#e ;av>Yu;D$t%HP$L$T$6D$ D$r k8멍|$9;u#e ;av>Yu;D$t%HP$L$T$44D$ D$ 7멍|$9;u#e ;av] YuZD$$tDHP$L$T$GD$ L$T$\$l$D$(L$,T$0\$4l$8 s l7늍|$$9;u#e ;ave$YubD$(tLHP$T$L$D$,D$ D$0D$D$4D$;D$L$T$ D$8L$Yu;D$t%H$L$ D$L$ D$L$ )멍|$9;u#e ;av7 Yu4D$tH$L$D$D$ 虫 )밍|$9;uĉ#e ;av7 Yu4D$tH$L$D$D$ 9 2)밍|$9;uĉ#e ;av+D$$D$D$D$oD$ D$(e ;av,D$D$D$$D$fD$ D$(e ;av=Yu:D$t$HP$L$T$ D$ D$3 ,(몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$4 D$D$(販 '뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$ ; 4'뢍|$9;u#e ;av=Yu:D$t$HP$L$T$4pD$ D$Ө &몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$oD$D$(R K&뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$oۧ %뢍|$9;u#e ;av=Yu:D$t$HP$L$T$kD$ D$s l%몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$TkD$D$( $뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$Dk{ t$뢍|$9;u#e ;avYD$$L$L$D$诬D$ L$Q$D$eD$L$ $D$dD$D$#e ;aD$T$8ujHXjr9t;1Ʉt1H@ Z R9t 1D$É$D$T$uaD$ 1݉4$\$l$ZaL$ D$T$1B#]e ;avaD$$L$L$D$D$ L$Q$D$cD$L$ $D$D$ ID$ D$"e ;aD$D$L$ $iD$thD$HT$Zjp9t11Ʉu 1D$à D$B $D$ 8`D$ ׉,$t$\$!`L$ D$T$벋D$T$1"Le ;avYD$$L$L$eD$L$Q$D$peD$L$ $D$D$D$ D$!e ;aD$HT$(r9th1Ʉt^H Xj r9t/1Ʉt%JX8uJ@8D$11$L$l$kL$ D$T$1밉,$L$t$ykL$ D$T$x =e ;av/ Yu,D$@I$ыD$L$D$L$ Z 븍|$9;ủ#e ;av0 Yu-D$H@ I$ыD$L$D$L$ 뷍|$9;uˉ#e ;av/ Yu,D$@I$ыD$L$D$L$ 븍|$9;ủ#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8똍|$ 9;u#e ;av/ Yu,D$@I$ыD$L$D$L$ 븍|$9;ủ#e ;avD$YuAD$(|$@I L$ t$,;$D$ ЋD$L$D$@L$D$E룍|$(9;u#e ;avD$YuAD$(|$@I$L$ t$,U;$D$ ЋD$L$D$@L$D$룍|$(9;u#e ;avD$YuAD$(|$@I(L$ t$,:$D$ ЋD$L$D$@L$D$e룍|$(9;u#e ;avOYuLD$ I,@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8똍|$ 9;u#e ;av. Yu+D$@L$ $ЋD$L$L$$D$( 빍|$9;u͉#e ;av. Yu+D$@L$ $ЋD$L$L$$D$( +빍|$9;u͉#e ;av. Yu+D$@L$ $ЋD$L$L$$D$( 빍|$9;u͉#e ;avNYuKD$ @L$$T$4T$T$8T$T$T$$ D$L$ ‹Zj)9 j9}jt̋jj9~M%99 vd -vd )ljۇ!ЉD$\$t$l$L$ 9L$Qi A5e ueA tLqI<99)Ήۇ!ȉD$\$|$T$l$ Ëvd -vd 릍y 1&떋L$11ҋ\$ 댉vd vd D$D$D$L$D$   *Ue ;aL$T$ ًZ+Zts9~gJ)˅tDJ jtB)؋e uB D$l$L$Íz 1%D$D$D$É݉ˉ듉L$$T$ Z+ZD$L$jD$D$D$Ëvd vd D$L$D$ e ;a$L$0uBL$(Q YA-e uA D$8\$||$T~|$$F(F4L$DT$@$'ډ|$@$D$L$|$$달$$D$L~ L$x$T$dD$ $T$L$'D$tL$x9‰$D$H$k Pk(4(${,K$9&9$$)$$T$D$$$A($Q,e j$Q$Q8Y4kq09SQ4$|@T$TЋ\$d9l$x)ʼnۇ!ŋ$)Ë$|$@k11ҋ\$L$v$T$PY,i(q$t$l$\$ $D$$L$L$ $Z4$9$r4׋R09$$$$$1D$<1D$($CM$l$ $$$L$<$D$4D$(L$ $l$<9}\$(99T$4)ډ$!Ӎ9$L$1 e 4uOu$6G9D$Pt8$$$$$$$Í$fD$L$$H 4xd 0xd P e uH$$뀍x‰؋D$P`uwD$P$R0$\$\$\$ l$$L$ $`&$t$\$T$ l$+D$L$T$$S8e uC0ˉƋ$${0ߍy$‹$$3$L$l$|$ t$誗L$|$D$H$$$$$$D$L$D$ "qD$}D$HL$x$$qL$d9 )D$@)ȅ L$D9 $$D$L$,D$ D$`  $YD$L$$$ZX\$`X,xd -(xd h -e uXэ\$L$xʼn؋L$d~;$\ u&)م \$x9 ‰ȉ[1ۋ$;"IJ$)t$@l$DD$L$$߉ˉы$|$0$$D$L$T$, $T$|$D$ "D$"L$09 D$8$Z(,$r,z$9 9 $$  $$L$D$Q$$A($A,e y$,$A$D$8@T$,9a $L$0)L$t!$鉌$ $)‰T$lT$\$zD$ "$H(P$Yh,9DYX( "L$l T$tJ$Il$Dt$@$<3$T$L$l$ \$4D$L$T$$S,e u C$‰r$ 鋌$9D$l$\ 9HY Y(i,sy$9ki("ȋ\$tL$l 3$|$\$l$ t$hD$L$T$$S,e uC$$ˉNjD$l$뎋$1ڋT$@)B`T$D9T$ $D$T$(D$ D$\  $E~D$L$$$ZX\$\XD$ @$D$D$D$ TD$L$D$$L$(e ;a D$,~TL$(1 \$ ى‰L$T$Yit$$4$D$\$l$ D$L$u0D$@L$,9|D$$@$輶D$L$L$4D$8 ÉD$4L$8 gRe ;aD$ L$f\.u D$$ËT$T$ $D$uD$ u؋D$$L$ L$T$D$ D$uD$$D$ D$D$$]D$D$$ËL$|D$$良$e ;ae vu. e m+S))䧼$D$D$ L$ @xd e +Dxd P$D$D$L$ (xd e  ,xd X$D$'SD$L$ 8xd e  HD$L$L$PL$-D$L$ T$\$l$l$L$LL$$L$PL$(t@D$ D$8D$<D$@D$D 0 $L$$L$$'D$L$ D$8L$D$$@0 e u H,(Íx,#蜀We ;ava$`&$M@D$D$ L$( $L$,L$L$0L$ D$D$L$4L$L$8L$D$ D$<$e ;ava$`&$?D$D$ L$( $L$,L$L$0L$ L$4L$L$8L$L$@4$T$L$ D$ D$rD$L$$0T$D$D$ L$:D$D$}D$L$ D$LL$PD 9wDe ;aLD$P$D$TD$D$D$ qD$L$#$L$ D$D$ SkD$D$L$L$,y$D$D$ID$ D$0L$L$ T$T$$1 ]L$ T$$l$9}h\$(D$, ؋I$L$ D$L$ T$\$l$(t$ 9|$04NtD$XD$\T$`\$dLÉD$@L$DT$H$D$@D$D$L$ D$XL$\D$`D$dLÍ$5D$D$4D$8D$<$D$4D$D$L$ D$XL$\D$`D$dL) Rue ;a0D$4$D$8D$D$H8 e uL$LH4@<D$TD$X<Íx4D$L-{֋D$DD$D$HD$ D$$D$(0$D$D$D$L$ D$$L$($D$*D$$D$D$ D$5D$L$D$TL$X<ËD$DD$,D$HD$0D$4D$80$D$,D${D$L$ D$4L$8$D$D$4D$D$ D$D$L$L$TD$Xt uƋ=falsuAeuD$0(D$0(ÃՉD$L$$ $D$T$D$ D$ D$L$$QD$L$$rT$BD$ $T$L$D$t3D$,H$@ u falsu@eD$0(11D$ =,]=ڭ'= w^=FWuL PiT$9u$D$,H @$u0D$0(1= u Pl9tˋD$,X= T$=u~ pjT$9t=ub j9u3D$,H$@ u D$0(11=ڭ'uk9uD$,@$D$0(=ڭ'ًT$=?ܬFwv=Cud jT$9 =?ܬF6i9(D$,H$@ u0u D$0(Ãu f=0s1=?ܬFT$=`ui PkT$9u%D$,H$@ uf=[]D$0(1=uwwzu( j9=,]pk9t{=,]T$=E_=wB=,u0 jT$9t=80l9%=T$=yuL lT$9=u, i9=E_0j9=E_T$=D5wB=˧u0 iT$9l=D50k9=D5T$=9uE PjT$9*=}lu k9=o^?l9,T$wRRe ;a4D$8HL$0PT$(1C9,`ukE9c<)`uI9A)ۇ!ͅ|$(l$0$L$\$l$ |$@)‰!D$\$XD$L$ T$0T$MD$ L$$D$D$5T$ D$D$L$O$\$T$ i$D$$D$L$$5D$D$ND$L$D$L$$$$D$5D$D$ D$WD$L$ $$İ|Hwe D$;AD$HD$LD$PD$T $ D$D$8$Q00$D$T$D$L$ T$L$XD$\T$`D$$D$dD$hD$l@D$dD$$D$hD$XD$l$$D$dD$D$\D$0L$XL$<1L$$ $$L$)É!D$T$ HD$L$L$@D$D|$p1_0$L$PL$D$L$ D$pL$t0$L$HL$D$L$ D$xL$|0$L$@L$[D$L$ $$$L$8L$T$pT$D$ D$D$HD$LD$PD$TD$,PD$0L$<9T$,ы\$4@D$($D$-8l$D$ [D$D$  $D$T$$)‰T$ID$L$ T$ \$(9l$4l$PT$TL$HD$LB9@vD$8tSH X@9wX$)ȉ!ЉD$)ˉ\$l$ LD$L$$$Ĉù귺15  3Ee ;av+D$$D$D$ L$L$D$De ;avqd $De ;a8D$$$$11ɉL$@$T$XΉl$@߉l$@먋$~A$r:$HD$@ID$Lt$@|$HD$0D$@D$L뚉t$\T$`D$|DŽ$DŽ$DŽ$3D$|D$* _ ȉ$0$D$\D$JD$ L$$$$$ D$D$!D$|D$ D$D$D$L$T$H$T$0$$$$$$$$$ĜD$*hN$y!~ F=$uN$$$$$$$DŽ$DŽ$ĜË$Q1~-u$$똃~!$Nۇ1Hr111gDŽ$DŽ$$$$$$$DŽ$DŽ$ĜÉt$dT$hDŽ$DŽ$DŽ$DŽ$ 3$ _ ȉ$0$D$dD$D$L$ $$$$D$D$!$D$ D$D$/D$L$T$H$T$0$$$$$$$$$ĜË$$~d ~d T$H$T$0$$$$$$$$$ĜDŽ$DŽ$$$$$$$DŽ$DŽ$ĜË$$ ƺL$D$gL$ $E~ )e ;a@D$LHT$H11ۋl$Pt$T|$XD$8ЉŋD$8؉ƋD$8~lT$D$D$L$D$PD$ L$TL$\$X\$l$\l$eD$L$ T$$\$(l$,t$0|$4tT$`\$dl$ht$l|$p@Él$`t$d|$h\$lT$p@耥 (e ;aXL$\T$`\$dl$h11 ӉʉL$\D$Dt$T\$dr Ml$hۇT$`kl$@t$0L$H\$\SlSXkPKTq9JQSTTt$02Le uT$HL$`T$@l$hXωŋD$H:?ڍ0$l$L$T$ t$D$L$T$\$\SXe uCP|$TŋD$Di{P>SXkTϋKPuP\$P9FUt$\VTT\$0 e  9NTL$D$ $D$gD$ D$@D$L$L$$D$(e ;avm$D$($D$,D$D$@OD$ D$D$L$L$ B$D$蕱D$ L$D$0L$4D$D$8D$ D$<$\we ;a(D$,$D$0D$D$4D$uD$ D$MD$D$L$T$ \$$u(B9u3D$8D$@D$D(WD$8T$@\$D(É$T$'D$ȭ D$L$ L$D$ e ;avy(D$,$D$0D$D$D$ @gD$D$ L$L$$T$\$- ',$\$T$YD$ L$D$4L$8D$ D$D$L$$L$oD$L$ t ‰ȉD$dD$hD$lXD$dD$hD$lXR R R R R R S %e ;a8D$<$L$@L$D$L$ T$tFD$,L$0T$4,$D$,D$oD$L$ D$DL$HD$LD$P8ËD$Ie ;a<|$$t$X^|$De u[t$$ED$@$jD$D$DD$D$HD$ D$LD$D$PD$D$TD$D$pD$D$tD$ Ì<ÍN$|$D$$D$~Ie ;avn<N$-D$D$8L$@ $L$DL$L$HL$ D$D$|$t$LeL$dL$0L$hL$4D$8D$lD$ L$L$\D$`$D$!D$\D$D$ D$ D$L$$($,Ë$Q$1 " $T$@T$$T$+$$蚃$tf$$)l$8IL$ 0@\$"$t$D$ |$D$ Ge uD$8닋D$8{뀋$@DŽ$(DŽ$,Ë9e u:뿉D$P-h/$xd|$$$Ge \$ |$HGG G $,dD$D$D 3 $D$D$wD$ L$L$,T$|$t1~\$tL$,L$xT$| p $L$H$DŽ$DŽ$ e u||$Dt$t$$ DŽ$,L$D$$ $WL$T$\$l$u $($,Í $D$DD$L$tL$藽1l$ 蔺$ D$d$$D$hD$lD$p0$D$dD$c;D$L$ D$lL$p$D$!D$lD$D$ D$ D$L$$($,s.e ;avkD$D$ 6e D$;A$ r 0$D$L$t$L$ L$TT$T$$\$\$(|$t1!"$l$D$tD$C}D$(L$$T$TD$t$D$(L$$T$TD$(L$$T$d\$tD$xKX$T$L$ L$ D$D$\$yD$$HT$ \$l$(98t$dt$TL$$l$(L Ƌe uSωOET$0\$`0$\$d\$D$l$ L$ut$D$l$HD$$T$0\$`녍 $U`D$D$X 3 $D$D$?sD$D$0L$L$,T$ T$\$ `D$L$,H L$0H e kL$\H H e 8L$XHD$hD$lD$pD$lD$h,D$pD$h$L$dL$L$$L$L$(L$ D$L$D$h$D$XHX @9l$4,$)؉!ЉD$)ىL$l$ 踦D$L$$L$$D$L$ $0T$D$D$ L$:D$D$DD$L$ $$ĤÍ귺t=I8xD$X%xD$\1M $D$) h3e D$;A$$$D$D$D$ 蔫D$L$lD$8L$$/$]|$D$$Ge /D$8|$PGG G $]D$D$H 3 $D$D$rpD$L$ L$DT$|$d1ڵL$DL$dT$h\$l p L$pL$PL$tDŽ$DŽ$ e T|$Ht$d4$t$hDŽ$,L$H$$ $L$T$\$l$L$ T$4"$L$D$gD$ D$@1 T$0JD$@T$ 9QL$0D$4ȋZ\$(T$<$\$-l$D$ D$ZD$L$u_PX\$L@ D$,L$T$ " $T$@T$輬|$D$,Ge u D$LMD$LS?D$!D$D$$L$T$\$ \$4L$(T$8$u0n$T$L$8D$ D$NyD$L$T$D9~ $D$L$D$4D$ D$$D$yD$D$(L$L$8$$D$_D$(L$8$Z8T$HZk2ϋJ9-KJL e ޅu :ĜÉ|$@D$(0$t$\$L$ l$FD$L$T$|$HWe u|$@ˉƋD$({豉D$0L$@D$TD$XB4D$0$ D$L$ D$TL$X$D$D$TD$D$ D$D$L$$T$@T$T$0T$D$ L$wL$D$$HPI$ыD$L$u=striuAf=ngD$\D$`$H L$ 0 $ D$L$ D$\L$`H$D$ D$\D$D$ D$8D$L$$T$8T$T$(T$L$ D$vD$L$‰ȉD$dD$h$H L$ 0 $ D$ L$L$dD$hH$D$ D$dD$D$ D$D$L$$T$8T$T$(T$D$ L$vL$D$RL$,T$tD$L$f+1YL$,D$<ustriuRfngD$lD$pL$0$fD$L$ D$lL$p$D$D$lD$D$ D$D$L$$T$ee ;av&D$T$9uJ@8D$ 1de ;av+D$$D$D$D$?D$ D$de ;av&D$T$9uJ@8D$ 1cde ;av+D$$D$D$D$D$ D$de ;av&D$T$9uJ@8D$ 1ce ;av+D$$D$D$D$D$ D$ce ;av&D$T$9uJ@8D$ 1Cce ;av+D$$D$D$D$D$ D$be ;av&D$T$9uJ@8D$ 1be ;av+D$$D$D$D$D$ D$nbe ;av&D$T$9uJ@8D$ 1#be ;a4D$8zD$D ~xD$$D$(0$D$@D$JD$ L$L$$D$($D$D$$D$D$ D$D$L$D$LL$P4D$D$ 0$D$@D$D$ L$L$D$ $D$D$D$D$ D$TD$L$D$LL$P4D$,D$00$D$@D$ZD$ L$L$,D$0$D$D$,D$D$ D$D$L$D$LL$P4ËD$@L$DD$LL$P4ÍD$LD$P4I`$e ;avuD$H P X9}GwX)ʉ!ى $D$D$L$ T$J(J J(J uJ4AJ4D$@(D$ _oe ;avRD$ $?D$L$ Q +Q(Q Y(uY i9sT uQ4JQ4D$ 7_e ;a (L$,Q Yi$q 99|$1_wL$0L$T$,J$L$)ۇ!\$L$ J4L$$J, $L$L$>L$0 udD$,H PX$h |c9w_9w[)݉ۇ!  $D$5D$D$ ED$,H4L$H4H H$(ÍAvtD$,  ^e ;avnD$H PX$h |P9wL9wH)݉ۇ!  $D$5D$D$ OED$H4L$H4H H$R {]ve ;av|D$$D$L$ $L$L$D$FD$ u8D$H +H(H P(uP X9s" uH4IH4D$ D$  \he ;avnD$$oD$L$ $T$T$D$FD$ uϋD$H +H(H P(uP X9s uH4IH4" K\ve ;a4D$<$D$@D$D$DD$D$HD$ D$LD$KD$L$L$|$ 1]tD$8H$L$$T$(L$L$,H4L$0@,$D$ D$QD$P4[[e ;avG$L$(I,L$ |$1s |$1sD$ $L$L$ľD$u؃$2[e ;aD$,lD$(L$,T$4DT$4\$0$D$cD$D$ `m $|$D$Ge L$L$$O e L$ OL$,O e uyL$(OL$4O e u?D$0GD$G,|$ G4|$$DXD$mD$ D$8ÍOω‹D$0xqz,D$lq뭍Oω‹D$(VquOω‹D$ =qDD$-q\$0D$(L$,YXe ;av3tXL$ $ӋD$uD$ @,$_6Ye ;aD$@(H PX 9hpt$l$ )ى!ˍ  $l$snD$L$QY ؉A Y i9%)É!1AQ Y$i 99)݉ۇ!؉$L$D$L$Q )‰Q Y$9A $%\XD$ ÉD$ $D$D$L$1벉$ʝD$D$ەD$ L$=D$H H P$9$D$|D$ É$D$`D$U N G pW;e ;av;D$$D$ D$ xL$D$ eD$L$ )L$$We ;a4D$H PX 9)ى!ˍ PX91ɄHP X 9)ډ!ك}j1Ʉt1HP X 9)ډ!ًP@9}"1uD$D$D$D$É $D$T$&D$ ɉ $`D$D$L$ D$pD$D$É $\$T$ٓL$ D$   Ue ;av;D$$D$ D$ xL$D$ ecD$L$ )L$$NUe ;a2D$H HH P X9 )ʉ!ك1ɄP Xh 9L$)!ՍT}[1҄tH $LXD$É$D$ ]D$L$A $zD$@0XXD$É$❺D$D$GT$ D$L${1G $ʝD$D$L$ D$  Se ;azD$ H H P X9U)ʉ!ى $D$D$D$ !iD$L$ Q DA $_D$L$toteD$ P P P PP t5HX 9)Ӊ!щ $D$lD$ H L$H $tXD$$ËD$ 뢋D$ $ 4D$D$%D$ D$D$lD$D$$ËD$ $D$D$D$ D$D$*D$D$$) " KRfe ;aD$H PX 9)ى!ˍ 1ɈL$upH HH $D$D$t@D$HP X 9w)ډ!ى $D$D$H L$H $tXD$ËH H $pD$v $`D$D$ML$ D$F   ,Qe ;a0D$4$D$tWD$4H0ulXD$80É$aϻD$D$D$ D$D$gD$D$80ËD$4$OD$uBD$4$D$D$D$ D$D$D$D$80à u =p:|"`$'y.unD$4H P X9}i Ѐ w=H +H(H P(uPX 97  uH4IH4`XD$80ÍPXD$80Ã+uD$4몃-tHЃ vD$$&D$tAD$4H +H(H P(uP X9  uH4IH4TXD$80ËD$(g)~tD$ D$$ & $D$oD$ L$L$ D$$D$4$)>D$D$%D$ D$ D$D$9D$D$80É$EtD$u D$rD$4$D$XXD$80ËD$4$D$D$4H0IH0|XXD$80D$(D$,&$D$D$D$L$ D$(L$,D$4$\D$D$D$(D$ D$D$TD$D$80ËD$4$D$ DD$4H0AH0VHXD$80ÍxXD$80ÍhXD$80ÍdXD$80ËD$4$D$ D$4$D$=uD$4$D$D$4$2D$D$ D$ D$D$oD$D$80ËD$4$D$_|pXD$80à M 01 * # LL'e ;avY D$ $D$ $qD$ u+u֋D$ $D$XXD$à Ke ;aDD$H$[D$D$ $k D$uۋD$HH +H(H P(uP X9T uH4IH4H PX$h )9!9\$0l$,T$8$wD$,L$0)ȉ!D$8l$]T$(L$$\$4#$ vd L$\$T$ TD$D$(L$$T$8 .\$uKl t |    trueu"D$H$D$XXD$LDÃu9D \ l t$   =falsu D etD$H$D$ 랋D$H$D$눍#$ vd D$D$4D$D$(D$ SD$D$D$H$fED$<D$@&$D$ D$D$ L$L$e ;av D$D$>e ;av D$D$p>e ;av D$@D$=>e ;a8 $D$D$(L$D$ Xl$t$D$DL$l$t$|$,_$l$t$hD$ D$>>D$L$T$DZ \$8R$T$(1SL$D$04$D$L$$T$0T$T$T$D$ L$=D$$hD$L$T$(\$89}Fl$$4~t$4$D$L$D$ D$=D$L$t$4cD$HL$L@118i7$e ;av D$@D$=7e ;adD$h{HL$$,D$@He \$KHKL$4KL$0K e u~L$XK L$ Ql$$9)D$\5e vt$@9\$$D$ e uML$,HL$0HL$ HL$H e uL$$H D$<(Íx D$$$CxD$,C+$e ;a0D$4H L$,@D$$1113$\$l$|$ t$11D$ P\$l$D$$L$,9}ST$ 4ы>v~|$(t$$\$l$D$ D$0\$l$t$|$(v\$8l$<0*-e ;av D$@D$}*e ;a10$)D$L$4QY\$$i 19t$ D$,D$\$t$ 0 $l$\$T$F>$e L$4Q\$uNSIKL$$KL$ K e uD$,C D$8\$<0Í{ D$,A{@멉T$ l$(0$D$D$ \$D$t$L$4T$ \$$l$( $)e ;av D$(e ;avD$D$ (e ;av D$@D$(e ;aviD$HL$ @D$$+D$ e u&L$ HL$H L$D$ÍxD$ ?({e ;av D$ 'e ;av0D$D$ 'e ;av D$@D$m'e ;aviD$HL$ @D$@$ D$ e u&L$ H L$H L$D$ÍxD$ i>&{e ;a(D$8HT$4Љ$L$D$D$  D$D$ L$L$T$T$$<$5e L$uIT$,QT$0QT$QT$ Qe uD$$A L$<(Íy D$$=yD$,r=転 %e ;av~0D$4H L$,@D$(111QT$$ы0@$\$l$\$ D$t$D$+D$$P\$l$ D$(L$,9|\$8l$<0;%fe ;av D$@D$ %e ;a10$D$L$4QY\$$i 19t$ D$,D$\$t$ 0 $l$\$T$DA<$Ve L$4Q\$uNSIKL$$KL$ K e uD$,C  D$8\$<0Í{ D$,;{;멉T$ l$(0$D$D$ \$MD$t$L$4T$ \$$l$(苠 #e ;a $L$0T$,.YL$(QYqk9&SQL9 e <ޅu$:|$ D$,0$t$\$T$ l$`D$L$T$\$(Se uC|$ ƋD$,ʉى낍{6:0$D$L 0$D$2 {"e ;a0D$4H PI$ыD$L$T$4Z -9$ T$D$L$ D$ D$D$P(D$L$ T$4Z\$,RT$(1Ql$$2R$D$L$D$ D$t$T$'D$$hD$L$ T$(\$,9|D$8L$<0ÉÉȉd!e ;av D$@D$-!e ;aQ0$D$L$4QY\$$i19t$ D$,D$\$t$ 0 $l$\$T$d=@B$ve L$4Q\$unSQSAI K e uBCL$$KL$ K e uD$,C`D$8\$<0Í{D$,7{7뷍{7뉉T$ l$(0$D$D$ \$MD$t$L$4T$ \$$l$(苜 e ;av2D$@ tPD$D$ Í辺D$D$ We ;av D$@D$-e ;avyD$HL$PT$ @ D$ :$D$ e u.L$HL$ HL$ H L$D$ ÍxD$6ke ;aS p`$9D$ e  L$tH L$xH$H<e T$|P8D$4$aD$AЉ$\$4D$ L$T$ \$l$D$|D$`$D$dD$hD$l0$D$`D$D$ L$L$hD$lּ$D$ D$hD$D$ D$9D$L$DŽ$$$pM'WL$4AAA QAA *A A$DŽ$DŽ$pDŽ$$$pÃ~\i$L$D$D$ @(D$D$$L$L$(T$D$|$$L$D$D$ @D$L$T$GD$4H  H @HP$L$D$D$4@ H t!$DŽ$DŽ$pH uHuϋD$|D$8$D$8@ $D$L$ T$4BJ@ $:D$L$ T$4BJ[D$XD$\\$XX(\$\$L$L$XL$D$ D$D$L$CD$4@@0Wf.!D$4Hf.u{!$DŽ$DŽ$p@(@ $lD$L$ $L$D$D$4H f.!D$4H f.u{}@ $oD$L$ $L$D$D$4H f.!D$4H f.>8@ $D$ L$T$4JB@ $D$L$ T$4BJ[DŽ$$$pÍx8‹D$|,ЋT$|xD$t, e ;avD$H<@8D$L$ e ;av D$@D$e ;av\`$]t$|$|$ e uP1`D$D$ D$Í`$|$t$.-e ;avD$H@ D$L$ e ;av D$@D$e ;a D$$HL$PT$ X\$h l$pt$@D$=B<$Ke L$urT$QT$ QT$Qe u?T$Q T$Qe uD$A D$(L$, ÍyD${*y D$m*뺍yD$_*e ;avD$D$ e ;av D$@D$}e ;aviD$HL$ @D$$D$ e u&L$ HL$H L$D$ÍxD$ y){e ;av D$e ;avVD$D$ e ;av D$@D$]e ;avwD$HL$PT$@ D$ $D$ e u-L$HL$HL$ H `L$D$ ÍxD$K(me ;adL$h crYT$$D$(|$D1( 0 $L$$L$٨L$ T$T$DL$HL$hQ@ȴ\$LT$PQǴ\$TT$XI\$\L$`  $D$L$DL$D$ D$*wL$T$T$lL$pdÉT$D$ |$,1-( 0 $L$L$-L$T$ L$,T$0L$hQ@ȴ\$4T$8IǴT$1\$,l$<$|$$D$$xËD$4$؋\$4ix$xȋ$x!AhQ($$LJ, $$LL$$$L e $xz,|$Du!$i$t$DYU$|$$D$I$xʼnЋL$,AhQ(|$\-$`!J, $$`L$|$\$`$xy,|$@e u!t$\|$pt$@1T$4\$|$D$\D$DŽ$|DŽ$tÍ0$D$C 0$D$C 4 4 4 4 蹸De D$;A$$!t$$$ Lb$$=trueD$#$L$4:$we L$u:$AD$4AD$#A $$Íy$21놃$$$L$$$L$T$ $L$D$L$T$u`$$ÉL$L$ $D$T$诹L$Lċ$HhAHhDŽ$DŽ$D$dD$h0$$D$UOD$ L$L$dD$h$$ L$D$L$dL$ D$D$謷^   C$$ 0 L$D$D$ D$D$1$QhBAhAhvt,$L$$9$u$D$D$Í$$D$TD$X$$D$DLD$ L$L$TD$X$$XD$D$#D$TD$ D$D$[WQ(|$l$J, $$L$X|$l$F$y,e ut$l)$$|$D$lD$؋$$$$L$T$D$ $D$<$L$P<$-tD$ L$|$ vHx O?9uԉl$D$ $|$t$D$ uD$$T$\$(l$롍D$HD$$D$L4D$,D$0P@ vlD$0$$GD$ L$L$,D$0D$8$ D$D$D$,D$ D$D$~D$HD$L4* ) 'e ;ae vu@- e bh*i#$D$ D$xD$ D$ # $D$T$D$ ?D$#$L$L$T$D$  D$#$L$L$кT$D$ ۽D$#$L$L$T$D$ 詽D$#$L$L$ȤT$D$ wD$#$L$L$rT$D$ ED$#$L$L$úT$D$ D$#$L$L$0T$D$ D$#$L$L$NT$D$ 诼D$#$D$D$ L$D$ }D$e uD$ vd e Í= vd D$~Ye ;av%Yu"D$ @$lD$D$4|$ 9;u։#e ;av$Yu!D$ $flD$D$Í|$ 9;u׉#e ;av%Yu"D$ @$kD$D$蔪|$ 9;u։#e ;av$Yu!D$ $kD$D$EÍ|$ 9;u׉#e ;av%Yu"D$ @$EkD$D$|$ 9;u։#e ;av$Yu!D$ $&kD$D$襩Í|$ 9;u׉#e ;av%Yu"D$ @$jD$D$T|$ 9;u։#e ;av$Yu!D$ $jD$D$Í|$ 9;u׉#e ;av%Yu"D$ @$jD$D$质|$ 9;u։#e ;av$Yu!D$ $iD$D$eÍ|$ 9;u׉#e ;av%Yu"D$ @$eiD$D$|$ 9;u։#e ;av$Yu!D$ $FiD$D$ŧÍ|$ 9;u׉#e ;av%Yu"D$ @$hD$D$t|$ 9;u։#e ;av$Yu!D$ $hD$D$%Í|$ 9;u׉#e ;av%Yu"D$ @$%hD$D$Ԧ|$ 9;u։#e ;av%Yu"D$ @$gD$D$脦|$ 9;u։#e ;av%Yu"D$ @$gD$D$4|$ 9;u։#e ;av$Yu!D$ $fgD$D$Í|$ 9;u׉#e ;av%Yu"D$ @$fD$D$蔥|$ 9;u։#e ;av$Yu!D$ $fD$D$EÍ|$ 9;u׉#e ;av%Yu"D$ @$EfD$D$|$ 9;u։#e ;av$Yu!D$ $&fD$D$襤Í|$ 9;u׉#e ;av%Yu"D$ @$eD$D$T|$ 9;u։#e ;av$Yu!D$ $eD$D$Í|$ 9;u׉#e ;av%Yu"D$ @$eD$D$责|$ 9;u։#e ;av$Yu!D$ $dD$D$eÍ|$ 9;u׉#e ;av%Yu"D$ @$edD$D$|$ 9;u։#e ;av$Yu!D$ $FdD$D$ŢÍ|$ 9;u׉#e ;av%Yu"D$ @$cD$D$t|$ 9;u։#e ;av%Yu"D$ @$ucD$D$$|$ 9;u։#e ;avD$D$D$D$ /ڡe ;av$Yu!D$ $cD$D$蕡Í|$ 9;u׉#e ;avD$D$D$釒Re ;av%Yu"D$ @$ebD$D$|$ 9;u։#e ;avD$D$D$D$ ʠe ;av$Yu!D$ $bD$D$腠Í|$ 9;u׉#e ;avD$D$D$wBe ;av%Yu"D$ @$UaD$D$|$ 9;u։#e ;avD$D$D$D$ 躟e ;av$Yu!D$ $`D$D$uÍ|$ 9;u׉#e ;avD$D$D$g2e ;av%Yu"D$ @$E`D$D$|$ 9;u։#e ;av$Yu!D$ $&`D$D$襞Í|$ 9;u׉#e ;av/Yu,D$ t$_D$D$Q  J븍|$ 9;ủ#e ;av/Yu,D$ t$B_D$D$ 븍|$ 9;ủ#e ;av"YuD$$^D$D$$藝ō|$ 9;uى#e ;av"YuD$ $^D$D$$Gō|$ 9;uى#e ;avaD$$L$L$D$%D$ L$Q$D$D$L$ $D$D$I%D$ D$踜e ;avqD$T$9uZJX9uLJ Zh p9t1Ʉt@J9D$1$t$L$DL$ D$T$11(se ;av9Yu6t$ t S9D$L$L$$D$( Л뮍|$ 9;u‰#e ;aD$$L$L$D$L$Q$D$lD$L$Q$D$UD$L$Q$D$>D$L$ $D$D$#D$ D$Ye ;a3D$HT$Z*091ɄH Z jp91ɄHZjp9tj1Ʉt`JZhp9t11Ʉu 1D$à D$B $D$eD$ ׉$t$L$NL$ D$T$1뮉,$t$\$+L$ D$T$v1o,$t$\$L$ D$T$31,,$t$\$L$ D$T$™e ;av;1L$#D$ \$$L$IL$D$ @|؉L$^e ;aD$$L$ 1B,49t u l\9tD$(Ëlt9tҋl t||$| 9t볉T$\$4$D$D$|$l$ D$$L$ T$\$zD$({&e ;av"YuD$$YD$D$$7ō|$ 9;uى#e ;av"YuD$ $hYD$D$$ō|$ 9;uى#e ;av"YuD$$XD$D$$藗ō|$ 9;uى#e ;av"YuD$ $XD$D$$Gō|$ 9;uى#e ;av"YuD$$HXD$D$8ō|$ 9;uى#e ;av"YuD$ $(XD$D$8觖ō|$ 9;uى#e ;av+D$$D$D$D$ D$ D$Ne ;av,D$D$D$$D$ D$ D$e ;av"YuD$$WD$D$跕ō|$ 9;uى#e ;av"YuD$ $VD$D$gō|$ 9;uى#e ;av"YuD$$hVD$D$,ō|$ 9;uى#e ;av"YuD$ $HVD$D$,ǔō|$ 9;uى#e ;av"YuD$$UD$D$wō|$ 9;uى#e ;av"YuD$$xUD$D$'ō|$ 9;uى#e ;av"YuD$$(UD$D$דō|$ 9;uى#e ;av"YuD$ $UD$D$臓ō|$ 9;uى#e ;av"YuD$$TD$D$$7ō|$ 9;uى#e ;av"YuD$ $hTD$D$$ō|$ 9;uى#e ;av%Yu"D$ @$SD$D$蔒|$ 9;u։#e ;av$Yu!D$ $SD$D$EÍ|$ 9;u׉#e ;av"YuD$$HSD$D$(ō|$ 9;uى#e ;av"YuD$ $(SD$D$(觑ō|$ 9;uى#e ;av"YuD$$RD$D$(Wō|$ 9;uى#e ;av"YuD$ $RD$D$(ō|$ 9;uى#e ;av"YuD$$RD$D$跐ō|$ 9;uى#e ;avpD$$L$L$D$ D$ L$Q $D$xD$L$Q($D$D$L$8 $D$D$D$te ;aD$D$L$ $D$ D$ D$@ L$I f.uqzoA0H(Q(f.!‹D$H0f.!!ڄt5D$P<@8Y uuT$(9-+BĈT$$l$D$t~D$(L$9T$8%Xl$=,/9݈\ݍX,79݈\݃\$Dl$Ht$@|$,‹D$8-D$,L$@\$(l$9s[t$8S\$Dl$Ht$@NjD$8$D$L$T$ D$L$L$LD$P<ÉL$LD$P<       wke ;av'D$tHD$L$ D$D$ we ;av5D$tH P@T$L$ D$D$D$ D$Twe ;a,D$0H$L$D$D$ L$T$0Zu D$4L$8,ÉD$(L$$B J $D$D$PD$ L$$T$(T$T$$T$T$ D$D$L$|D$L$ D$4D$8,ove ;aD$ L$1B9BokvkvٍkЕ w0uD$D$D$L$ D$$D$(À+tˀ-tƀ.t:t8D$T$B)щ!ЉD$\$ D$$D$(Í$X5|$Ge u:D$D$D$D$ pD$$|$(Í螌D$D$D$L$ D$$D$(D$D$D$L$ D$$D$(  tLe ;aD$$L$L$T$ T$T$$T$ D$|rL$(tD$L$}\1҄tPzH$ L$D$D$ T$UHD$L$L$TD$X@ɉD$$L$8 $D$D$T$ D$$L$8r1~Y10$D$t$\$ L$ID$L$\$At$,u f..D$TD$X@ËL$L/7D$D$L$HL$T$D$ +D$@|RL$H9wJ$L$DL$D$D$LD$ D$PD$GD$L$ٽ Ҽ ˽ Ľ @xe ;avD$@D$@e ;avgD$$D$ D$D$ L$T$tD$$D$(T$,ËD$$L$#D$D$$D$(D$,2@e ;a$ $t$,|$|$ e l\L$,QKT$(Z|$ _e #YtT $D$L$ $D$D$D$ D$L$T$ $D$L$jD$ D$0$ËYuYuY  e ugGG e u;GG e uG|$0$ÍOω1lVOω1XV븍Oω1DV댋Y uBY4u;Z4B0_4e G0YyD$ D$D$$L$ L$T$D$ OD$t,L$ 9)!ȋL$ȉD$$T$(ËD$$L$ L$:T$D$ !D$u*D$@L$ 9wE)!ȋL$ȉD$$T$(D$$D$(D$$D$(茵 腵 8e ;avGD$$o$CAD$L$T$ T$ L$$D$(D$,D$0B8e ;a$D$ D$D$$D$D$(D$ ?D$L$$L$Ot$D$ L$uC|$e uTD$,D$0Í $|$t$RԉD$,L$07Fe ;aD$L$19}YBkvkvۍkЃ vӃ;!tɍk܃ vƃvD$ Ã@ =t@t_t~tډ$L$T$\$ T$D$L$D$ 6;e ;av9e vuڵ e fw2^mRe `6e ;avQ D$$L$L$wD$L$Q$D$wD$L$ $D$yD$D$ 5e ;aD$H\$k39tt1ɄtjH Pk s9t;1Ʉt1KSX@9t 1D$É$L$\$D$ 1݉4$T$l$PsL$ D$\$1뤉4$T$l$-sL$ D$\$l51e ;av>Yu;D$t%H$L$苯D$L$ D$L$¶ 4멍|$9;u#e ;av>Yu;D$t%H$L$蛯D$L$ D$L$R K4멍|$9;u#e ;avYD$$L$L$tD$L$Q$D$tD$L$ $D$D$QD$ D$3e ;aD$HT$Z*09tX1ɄtNH Z jp9t1Ʉt@J8D$1,$t$\$ 7 0 ) "         e ;av3D$$D$D$D$L$ T$D$ L$$T$(e ;avUD$HT$I| 9s8 /uA|#9wT$ L$)ȉ! D$\$"  De ;av3D$$D$D$D$ D$D$ L$D$$L$(e ;avSD$HT$I|)9s6 /t.u)ȉ!D$ \$D$ D$] e ;av;D$$D$ D$D$L$ T$\$D$$L$(T$,\$0.e ;av;D$$D$ D$D$L$ T$\$D$$L$(T$,\$0e ;a&$D$,1Ʉ;D$L$T$ $tD$0D$4L$8T$<$D$D$D$D$ \$D$D$(D$D$,D$ D$$D$D$D$ L$D$0L$4D$8D$<$ËL$( $D$dD$L$ D$0L$4D$8D$<$ËD$($ L$D$NL$ D$,e D$;A$$$L$D$ D$`L$$$$$\$D$$L$ L$,T$`9 1ۄ$+.u11ۅ+/Ç݅s0/Çޕ8؇ޕT$T\$|$$$L$D$\MD$ N11A9}4 /uD$D$L$9 D$011D$0ӉL$,\$(T$@jpxD$|$t$ D$D$ՋD$L$,\$l$T$(…t\$$T$ l$4L$c $D$D$0D$<d L$$9t D$D$HD$ D$LL$PD$4D$T8É $D$4D$d T$<D$ uL$$뷋D$D$HD$ D$LD$PD$T8É $T$'D$ e ;av|,|$D$L$tK щ ف׸ʚ;?؉D$ $T$с=L$0,Ë\$ ʉhe ;ae $i6e tsi f_n$D$$D$D$(D$D$L$T$\$ \$,T$0L$4D$8l 됍|$ 9;u#e ;avWYuTD$ t>$D$$D$D$(D$D$,D$ D$L$T$T$0L$4D$8Il B됍|$ 9;u#e ;avOYuLD$t6$D$ D$D$$D$D$L$T$ T$(L$,D$0k 똍|$9;u#e ;av>Yu;D$t%@ $D$;D$L$ D$L$bk [멍|$9;u#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8똍|$ 9;u#e ;avNYuKD$ @L$$T$(T$T$,T$T$0T$ $ЋD$L$T$T$4D$8L$<[뙍|$ 9;u#e ;av D$ e ;av D$@D$e ;avD$HT$|9wPd e ;aQ0D$4HIT$<IXh9",t9uۉL$l$$D$8D$t$8%D$ uD$4L$T$<먋L$4QI\$9T$\$H\|\ -e uD$@DD$DD 0ËD$@PߋD$DED$8D$ T$$D$(D$,0$D$ D$!D$ L$L$(D$,D$4$^ D$D$D$(D$ D$D$K0b b 4e ;aH0D$4HIT$<IXh9tl9uډL$\$,$D$8D$t$#D$ uD$4L$T$<맋D$4H@T$9D$T\ DD$@\$DT$H0ËD$8D$ T$$D$(D$,0$D$ D$}D$L$ D$(L$,D$4$^ D$D$D$(D$ D$D$ؕd ԕd Еd T$@L$DD$H0` ` e ;avW$D$($D$,D$D$D$ D$D$D$D$L$ D$0L$4$Be ;av' D$@L$ $ЋD$L$L$ D$$ e D$;A$I$L$D$L$ $Z jjD$(L$ @\$l$$LD$ L$T$\$D$DL$HD$(D$ɉ띉$L$HL$L$LL$L$PL$ D$nŸ 8p-9tqv6u` 9uMt&EM]\$$D$T$HT$T$LT$ T$PT$D$L$J묅ɉHX@D$$D$ D$HD$D$LD$ D$PD$L$\$Ÿ?v6: U\-9B 9tf#UPFD$$D$%ËD$G E$|$W D$G E$|$W D$G E$|$W D$G E$|$W D$G E$|$}W 1e D$;AD$\D$`D$dD$h $J e i$B$KD$$L$D$ $WD$K$HL$$ $$T$$\$$l$ D$L$T$$L$D$^D$D$XL$ L$TT$T$<$kDŽ$DŽ$DŽ$DŽ$5m$$$$$Ճ  z1F$L$\$D$PD$ D$LD$D$8D$$$ЋD$(PD$XL$Tl$d L$\D$`L$\tQӃ ʀ111=d ]111OĐÉL$tD$xl$|D$lD$p 9$D$tD$a^D$ L$L$lD$p$$ kL$D$L$lL$ D$D$H? $D$l$(D$ #D$T$L$XL$T$SD$ L$tsd t d e uKd L$TD$XL$Tt-QӃ uʀ$$$d111ߍ=d 111ʺ5z \$D$DD$|$D$h$D$lD$D$pD$D$tD$ T$D$|D$ $D$$$D$(JD$0L$4T$,$$$dÉк`_\$T$DT$ |$$T$h$T$lT$T$pT$T$tT$ D$D$L$D$|D$($D$,$D$0 D$8L$D$ L$$$$$ L$D$$ L$ D$D$$$$$0$$\$x>D$L$ od td e : d $$$ PӃ uʀT$XL$tD$p$L$T$v,D$$L$ L$`$$$\$l$hl$A,D$ L$@L $ЋD$`@$ $D$ GD$S$$$L$T$hT$\$p\$ \$t\$\$X\$D$ L$T$t$$$ĤË$+m mtуuÉD$\L$|T$x$$$$DŽ$DŽ$0$$D$D$(D$,L$(\$,$?D$D$D$(D$ D$D$ۖ0$D$s ze ;aO0L$@T$4J e D$DB 9D$D$8$D$ͻ1jrt볃MD$,L$0\$4D$8ËD$G E$|$ le ;aD$$wzt4D$$D$ D$L$荾D$L$T$ T$(L$,D$0t.D$ ƒtD$(D$,D$0ËD$ ЋD$ ƒȋD$D$(D$ D$,L$06k!e ;aHL$PT$LJ e CD$TBD$X$L$\L$T$`T$D$L$T$ tZD$0D$4T$0L$4D$LH@$L$D$0D$D$ D$4D$L$HÉL$$T$ D$X$D$\D$D$`D$\D$L$ T$PtRtID$8D$<D$@D$DT$8T$TT$7D$L$ @@hd ld T$\$ $D$ t-D$ $D$$D$D$D$D$L$T$ VD$ $L$$L$T$T$xD$ L$$L$6D$L$ @@pd td T$\$ $D$ rD$0D$8PD$$$ZL$D$ $T$$D$PD$TD$XD$\r\$PL$TD$XT$\$\$\$D$L$ $L$D$PD$$$L$4D$8$T$ D$|$9AD$|$PT$(D$@Y\$4 L$$$T$D$;L$$$d   d e D$4d L$DD$HL$DQӃ uʀӃm\$0D$^$A|$Ge u Ru u uQTd Pd Ƅ$$$hÉ\$$T$XL$TyT$4\$dC ZZu6QZZf.!f.ˇÇ!!͉u Qˍ^$|$Ge u  Qu\$dC ^^$|$Ge u 1QtT$4\$d+wpu99ŇÇ!u ܍^$|$Ge u Pu 덃u |uID$@ȋL$@cu\$d+<^$|$Ge u 6P&u\$d+u\$d+u\$d;kD$`$L$dL$T$0T$kD$ D$L$X $L$TL$L$$L$kD$ L$8Ç݋T$4\$dt$T$4 uy\$dZ u Zf.Ç!Au ^$b|$Ge u sͻ#sͻNu \$d넍^$|$Ge u sͻsͻNqT$4 $\$d+1 wvu19ŇÇ9!Tu1߃ u1Ӎ^$h|$Ge u CCM u1눃 uA D$8ȋL$8o u1au\$d+1@ u\$d+1-^$|$Ge u C@CCM0 u \$d+1 u\$d+{ u\$d+1D$`$L$dL$T$0T$kD$D$ L$ L$PT$X$T$TT$T$$T$?D$L$ T$ 9t1T$4\$dt$D$P$L$T$sD$ Ƅ$$$hÍhw11hw11=\d 5Xd 1hw11hw11vu11cdd `d Ƅ$$$hƄ$$$hÍhw11hw11l=\d 5Xd 1Yhw11Chw11-u11D$(G E$|$@ D$4G E$|$% D$(G E$|$  D$4G E$|$ D$(G E$|$Խ D$4G E$|$蹽 D$(G E$|$螽 D$4G E$|$能 D$(G E$|$h D$4G E$|$M D$(G E$|$2 D$(G E$|$ D$4G E$|$ D$4G E$|$ 0$`D$Ǽ 2e ;a0D$$D$(D$,D$@D$$D$DD$(D$HD$,D$4$D$8D$D$ u1넃 u (Hs u1eu E^$|$Ge u  oF u u u+Su\$<+`^$r|$Ge u ~ En u\$<+ u\$<+u\$<3kSJÅ҇Ç! ڄT$( 1T$<wuu!99!9 ‰vu ׍^$O|$Ge u Du 눃u wu@hul$<U@ ul$<U&^$|$Ge u CLCD< ul$^$z|$Ge u Aul$<Uul$t<\D$LHc c -c l$\$T$ T$P$DD$LHc  c -c l$\$T$ T$P$,c L$LQ0c -(c l$D$\$ D$P$D$\L$4)ȉD$8!ȋl$TD$<$t$X)Ήt$\$AD$ D$0L$L$,$AD$t\D$4L$,$9\$\9D$LP\$<\$L$\$8\$ \$P$ҋL$4T$,D .D$@D$D&$L$0L$D$ L$L$@D$DD$L$L$PL$ͺT$D$ \$@\$D$D$v<<>3\"%9w7T$LRl$\)݉ۇ!L$)؉D$t$ D$P$҃Hk d ] V O H q\e ;aD$ $L$$L$ XT$$D$  $D$D$$L$ L$L$$L$"D$ L$T$$\$\$D$L$ T$D$tJH X@9w\$)ȉ!ЉD$)ˉ\$l$ D$L$D$(L$,ù귺D$ D$(D$$D$, >e ;av8D$'"uD$Ã't`D$Ãt݃\te ;avGD$$D$D$D$ D$D$ L$$L$+D$L$ D$$L$(re ;avGD$$D$D$D$ D$/D$ L$$L$ D$L$ D$$L$(e ;a0D$(D$,L$8T$4Z*509m+[ÇޖQ1 BًT$49D$‰\$$ll$ s׋-d td -e 5d T$(t$,T$(jD$|$ ù$t$l$迭D$ L$T$t=T$\$89l$$E-e u l$ M%|$ F.T$\$8111덉=d .D$@111h$L$D$'뫋|$1'e ;a,D$4$L$8L$D$ L$T$\$l$D$4D$$D$8D$(D$D$ 0$D$$D$詧D$L$ D$L$ `$D$'D$D$D$ D$vD$L$D$<D$@L$D,ËL$0 $l$D$\$ D$L$T$D$QtuD$4@ @0Ãup=invaugAf=liu]AdtRۃ։L$$D$ $D$T$D$ oHD$ D$L$$D$L$$V$D$D$D$8D$ D$$D$L$D$d@ L$L$$T$T$ \$ \$,|$018$l$D$0D$ZD$$L$ T$,D$0$D$$L$ T$,\$0tu\$4i9'T$,l$ D$$5e $T$L$D$ l$T$D$L$h\$(ȋL$ 똉T$hL$lD$p`1D$hD$lD$p`e ;a  L$Q tTT$Qe u5T$QT$ Qe uD$AL$$ ÍyD$yD$č ܱ$D$D$e $uuD$e $uMD$H e $uT$J$L$Q @T$z$NL$y @T$z -몋|$ e ;aMD$D$H H  $POD$H L$$ WL$zuFD$H I$ $L$L$蜗D$H I $L$L$袛D$D$4Ð*Í ܱ$診D$D$ {e $utD$ ce $uLD$ H Je $uD$ H$L$A T$ z$L$y ۋT$ z 뫋|$ (e ;avLD$@ t2D$$D$D$D$ D$ D$D$$D$$e ;axD$|H H  $hL`$JD$|H |$I e  e vd cWHXhp@D$t$$L$$D$$D$ l$\$|$ D$$D$(.D$|H T$4T$@\$0\$8l$,l$< $LD$8|$H1  $L$$D$ 0-L$ HL$HD$e ;a'D$L$$$D$L$$D$,$L$0D$4D$80$\$,\$nD$L$ D$4L$8$D$]D$4D$D$ D$o=D$L$$$D$L$$D$$$L$(D$\L$`D$TL$XD$LL$P|$d1?0$L$$L$AnD$L$ D$dL$h0$L$\L$nD$L$ D$lL$p0$L$TL$mD$L$ D$tL$x0$D$LD$mD$L$ D$|$$D$D$dD$D$ D$ND$D$&lËD$0D$\L$$L$`D$dD$h0$\$\\$TD$L$ D$dL$h$D$D$dD$D$ D$#D$L$T$p$D$L$蘻e ;a@ $I{D$D$8–uNT$ 9y @L$$t$0\L9^L9R\$$l9? aT$ 9$l$$ @t$0\l9 \$49T t$$9D9}59\$4\9}9CD$T$ t$0߉GD$09D$(D$D$(9sgLmT9sXD$P8ËD$<$D$@D$襭D$ D$@L$L$L$ T$L$ e u D$ÍD$若e ;av4L$T$ e u D$ ÍD$ 輼5e ;av,L$e u D$ÍD$te ;av4L$ T$ e u D$ Í D$蕤e ;av,L$e u D$ÍD$ԻMe ;av,L$e u D$ Í D$脻e ;av,L$e u D$$Í$D$4譣e ;av4L$ T$ e u D$ÍD$ܺUe ;av4L$ T$, e u D$(Í(D$茺e ;aD$$GD$$D$D$3D$${ND$$D$D$3D$ e uPL$T$D$1&\$ $L$bD$ XD$L$T$9|փÍD$趹ȋL$)$e ;av7D$$ud 0 L$D$kD$ L$D$L$ ҡe ;av7D$$|ud 0 L$D$D$ L$D$L$ 股e ;avmD$uJt,$D$D$D$ D$D$L$ L$$D$(ËD$D$$D$ D$(ÉT$$L$(we ;avED$ u,t$D$D$ÍMD$ÉL$蔠e ;av2 D$$T$D$$ЋD$L$L$D$ Ge ;avED$ u,t$D$D$ÍMD$ÉL$e ;avXD$$D$D$  $_D$$D$D$ T$D$D$ qe ;a(D$,L$T$ $_D$D$ T$, e |$$$SD$L$,e uiD$D$ tJHX @9wa$)؉!ЉD$)ىL$l$ D$L$D$0L$4(Í귺|$$D$յε^ =e ;avED$ u,t$D$D$ÍMD$ÉL$ԝe ;av.D$t ^ 9~ ^ D$ÉD$苝e ;av.D$t ^ 9~ ^ D$ÉD$;e ;av.D$t ^ 9~ ^ D$ÉD$e ;av_ D$ u<t$D$L$L$D$ Í}D$D$ ÉT$L$ je ;av_ D$u<t$D$L$L$D$ Í2D$D$| ÉT$L$ e ;av_ D$,(u<t$D$L$L$D$ ÍkD$D$H ÉT$L$ je ;av@D$$D$D$D$D$O2D$ t@0D$ D$  e ;avQD$t=D$$D$D$D$W2D$ t@0D$ D$ D$ 蘚e ;a`D$hD$p$O$1ZD$D$\L$p $M?D$D$LL$\T$h\$dl$l11D$@ΉD$@t$(L$X|$$Hl$l\$TK3Ml$4ۇl$0u.f--\$dL$ T$ht$H1JT$,?1필 t1필tL$(l$Xt$4@oT$(9ND$8D$XD$PD$8T$(\$PT e "D$L$贳D$ t$_$ ы$/$D$$D$L$T$ $$$Ę  =ue ;avUD$PDt3$D$ D$D$$D$D$(D$ ЋD$L$L$,D$0D$,D$0te ;a/@D$D$D$L$L$4D$8D$<D$,D$0 5L$,L$4L$0$D$,D$D$L$)D$L$PT$H\$,l$Xt$T11|$$1|$ OB\$,T$(T$HT$(9}n9ue uBǁL$$T$ G\$,L$$T$ L$PT$H9 D$01D$(D$0룁ω1言؉믋T$ rl$$97\$De u l$Xt$T놉|$DÉb؉݉|$(L$< @Y $D$T$l$ t$&=D$L$l$qL$qrxD$+q/Ye ;a(D$,$+D$D$L$, $D$D$ L$L$·$D$L$ H e uL$HD$@`@\@l@L$, $wD$D$D$ D$$ CL$L$L$ L$L$$$D$D$!D$D$0(ÍxD$psXe ;aD$ $ D$ $QD$ T$RQulD$D$ DL$D$$ D$$D$D$XD$ $D$$D$D$8D$ D$$ËL$$D$ y$D$D$ L$L$·$UD$L$ H e L$H@`@\@l@ e L$ t3Zde u Bhzhln $e L$uT$ 룋T$ /nL$ nrxD$ n/Ve ;a$D$($ D$($D$L$(uRD$D$D$ DT$L$D$ $D$D$OD$(D$,$ÉD$T$$D$L$(뎉$D$D$ L$L$·$gD$L$ H e L$H@`@\@l@ e L$(t3Zde u Bhzh~l $e L$uT$(룋T$(AlL$(0lrxD$l/Te ;avD$ $D$D$NTe ;a6D$tD$É$SD$D$ L$L$·$D$L$ H e L$H@`@\@l@ e L$t3Zde u BhKzhj $,e L$uT$룋T$jL$jrxD${j/Re ;a& $D$ e T$BB BP$D$D$ L$L$·$CD$L$ H e {L$H@`@\@l@ e <L$ Xd-e Ph $=D$D$L$L$·$D$L$H e L$H@`@\@l@ e uwL$ Xde u%PhǁǁǁÍxhh1hhh͋L$ h낍xD$yhCxhhhL$ ThxD$Ahw+h Pe ;av-D$ $D$@0tD$1LPe ;av-D$ $D$@0tD$1Oe ;av-D$ $OD$@0tD$1Oe ;av-D$ $D$@0tD$1\Oe ;av(D$ $?D$$D$D$Oe ;av(D$ $D$$sD$D$Ne ;av(D$ $D$$#D$D$qNe ;av(D$ $D$$D$D$!Ne ;av]D$$D$$D$D$L$L$D$ tD$ ËD$$D$D$D$D$D$ Me ;aD$$+D$uB1tD$ ËD$$D$$D$D$D$D$FD$ ċD$$D$$D$D$L$L$D$ LXe ;a8D$<QQ+Q T$ $D$<$D$L$<P $xD$$D$@D$D$DD$D$HD$ (D$<T$\$i q)t$D$ )ƋI~t \$LT$P89T$$\$$)!D$D$D$T$ LSD$L$D$(L$,D$0D$40$D$(D$&D$ L$L$0D$4D$<$D$0D$D$D$ T$$\$D $' e L$uD$<T$<blD$LD$P8 J e ;avD$D$Je ;ave D$$_D$$D$D$L$ $/D$$#D$$gD$L$L$$ 4Je ;abD$ u`$3D$$D$$qd D$D$D$@ED$D$ D$$D$D$ËL$$D$ 눉$D$D$ L$L$·$= D$L$ H e u{L$H@`@\@l@ e uCL$ Xde uPhBxh``L$ O`붍xD$?`wH~e ;aD$(D$,D$ $D$$D$sD$L$ T$u`T$$ PUD$u8D$$0 D$D$D$GD$ L$D$(L$,QÐGÉL$(D$,5G7e ;a$ $D$D$  $T$(T$D$($OD$D$  $T$ T$D$$D$ D$L$L$L$(L$ D$ $D$,D$D$0D$[D$L$D$4L$8$G-e ;a8D$D$D$L$L$(D$,D$0D$40$D$(D$%D$ L$L$0D$4D$<$D$@D$ID$D$ D$0D$D$D$G8>FIe ;a D$$$[D$teD$$$GD$D$L$L$11l$UL$ËD$9}#T$\$$D$L$9̉ȍCD$( D$( EXe ;a TD$,D$00D$, L$0L$X $T$\T$\$,\$D$ D$藯D$(D$DD$HD$LD$P `& $D$D$L$ D$DL$H`&$L$(L$aD$L$ D$LL$PD$X$L$\L$dѻT$D$ \$D\$D$D$cD$X$L$\L$D$D$ D$跮D$(@L$`9D$4D$8D$<D$@`&$AD$D$L$ D$4L$80D$<D$@D$X$L$\L$j(T$D$ T$4T$D$D$菩D$X$D$\D$D$D$ D$TZCe ;adD$LD$P0D$L ȤL$PL$h $T$lT$\$L\$D$ D$gD$TD$X0D$T ФL$XL$hL$T$lT$ \$T\$D$D$$  D\$D$(D$DD$H `& $D$D$L$ D$DL$HD$h$L$lL$(T$D$ \$D\$D$D$D$h$L$lL$T$tT$\$(\$ {D$<D$@0D$< ؤL$@T$h$\$l\$l$L$$JHL$(|$<1%L  $L$(L$L$Ie ;a(D$0$D$4D$D$8D$pD$ D$L$L$T$,$D$D$L$ D$D$ D$D$$0$D$ D$9D$L$ $L$E Ye ;avZ D$D$$ID$D$$ WL$ǃuD$@D$r Ðh e ;avR D$$]ID$D$$ WL$OuD$L$A Ð e ;avi D$D$D$$HD$D$$ WL$ςuD$H @D$L$s Ði {e ;avq D$$]HD$D$$ WL$Ou4L$T$J e uD$B ÍzD$ щ xse ;avID$$D$ D$D$$D$ltd L$ T$$D$L$T$ e ;avYD$ $D$$D$D$(D$D$,D$ D$0D$itd L$T$$D$L$T$ ye ;avID$$D$ D$D$$D$ltd L$ T$$D$L$T$  e ;avUD$$D$ D$D$$D$jtd L$ T$$D$L$T$ $e ;aveD$ $D$$D$D$(D$D$,D$ D$0D$gtd L$T$$D$L$T$ $$e ;avUD$$D$ D$D$$D$ktd L$ T$$D$L$T$ $-e ;a,D$0$D$4D$D$8D$D$CJЉʅ09vD$ D$ ÉD$ p o %Pe ;avTD$HHtÉ$L$L$L$ L$4D$ L$T$BHe uJLƍzL< e ;aL$Q$T$t$O@D$L$T$ ÃuchD$Hu1j\$ L$4T$0$L$\$?D$uD$HL$4T$0\$ 뾋D$$;D$($L$,L$T$T$?D$D$HL$ʁ`L$$YKD$($L$,L$T$sD$ L$@l $ЋD$TD$tD$DL$@T$<1ۉ݉D$H`D$($D$,D$D$D$>D$L$T$ \$ËD$($L$,L$T$T$ID$L$ `$L$D$D$L$ T$D$HPD$($L$,L$T$T$ID$L$ $L$D$蒋D$L$ T$u D$HD$LD$PL$TD$XD$\D$`D$d8ÉL$LD$PD$TD$XD$\D$`D$d8€L$,ÃAD$($L$T$qD$ L$@( $ЋD$L$ $D$D$L$ T$\$($l$,l$t$t$T$ L$D$aT$L$,p^$|$Ge u ͻͻoD$LD$PD$TD$XD$(D$\D$,D$`T$d8ËT$$D$HT$T$ÀtMD$$^$c|$Ge u ͻͻƀt:Ç߃&:Ç߃݋D$<$T$@T$L$pD$ L$@` $ЋD$tDD$DuL$< $T$@T$D$L$T$\$ D$DD$DD$$G E$|$5s D$$G E$|$s cNe ;aL xD$dD$h$$$L$$T$D$ D$L$T$(\$$l$t$ nxT$H\$`t$\Ѓ1T$D1ɉL$4D$|$D$ D$|HL$D$D$\$L$`L$T$HT$ID$ L$49D$\$T$`T$\$H\$L$ AD$L$T$\$|$T$D$L$ #D$L$LD$|H #L$4APt'%xd xd $$xÉL$4D$\$T$`T$\$H\$?HD$ L$49D$DD$\$L$`L$T$HT$vmD$ L$@( $ЋD$L$$L$}D$ D$XL$L$@T$T$T\$4[D$\$T$`T$\$H\$L$ @D$L$T$$D$L$D$TD$ L$XL$T$@T$p\D$4X\$4D$\$L$`L$T$HT$IGD$ L$49uu D$DtDŽ$DŽ$xËD$\$L$`L$T$HT$flD$ L$$L$D$D$ xD$L$T$\$\$\$`\$\$H\$T$ D$L$[mD$\$T$`T$\$H\$L$ `L$47$D$ D$|$$xËD$|$D$D$D$ D$L$n$$xËD$\$L$`L$T$HT$s4D$ L$49}XD$\$L$`L$T$HT$ED$ L$49D$\$T$`T$\$H\$il$ _L$4\D$\$L$`L$T$HT$3D$ D$D$D$$Ɖω$1Չ$K $D$_D$L$ T$$L$D$VD$L$T$ 뫋xd xd $$ĀËxd xd $$ĀÉ4$l$D$6ND$ $L$$$ s$|$Ge  ֺ$O e u_$$G $H OO$ PL$|$z$$DŽ$DŽ$ĀÍO ω‹$$뒍ֺd4$l$D$EMD$ D$LL$$PL $ҋD$L$@P $ЋD$H  $H$tȋ$$,$(t|$,ÃtNjD$L$$D$ZD$L$ T$$($$,l$$t$T$ L$D$;$$`$,낍^$|$Ge u ͻͻrD$LHL$$ыD$L$$L$D$L$ @@xd xd \$T$ $D$ $($$,D$$D$wKD$$$L$ $ s$#|$Ge  ֺ$O e u_$$G $H OO$ PL$|$$$DŽ$DŽ$ĀÍO ω‹$$뒍ֺ d4$l$D$F-D$ t!$$$,$($$N,D$L$ T$ d   d e d $8$<$8tbQӃ uʀ$($$,\$$\$L$ D$T$=9DŽ$DŽ$Ā111몍=d m b$$ĀË$$$D$$D$3ID$$$L$ $ s$߁|$Ge  ֺ$O e u_$$G $H OO$ PL$|$w$$DŽ$DŽ$ĀÍO ω‹$$뒍ֺd$T$H$H $$.$H@ $K99l$Hm)ى!щL$)؉D$t$ $$ՋD$L$$$ĀË$G E$|$8K $G E$|$K $G E$|$J $G E$|$J 0$ВD$J ; < < e ;a8D$<HPcD$@$L$DL$D$@KJD$D$ BD$(ؒD$,D$( D$ L$ s$=D$D$$$ L$D$L$@L$ L$DL$'D$L$|$$O e ubL$O e u9D$ G D$<@ GGD$HD$LPD$P|$T8ÍO ω‹D$ 0'11)B$D$VD$L$ L$HD$LD$PD$T8ËD$@D$0D$DD$4@$D$0D$VD$ L$L$HD$LD$PD$T8 e $;A#$V$I$$8$<$$@$$$D$$D$DD$$L$ tI$DŽ$DŽ$DŽ$DŽ$$$8D$3VD$ L$$$$$$$f$D$G$D$D$ D$$D$L$$$L$D$DŽ$DŽ$Ë$$$$\$$l$nL$ ;D$L$T$\$l$(t$$|$ X!{$"$Gf D$DL$|$$$T$$T$BD$$L$ L$t$Z \$p- s,$l{|$D$DGe L$|L$tO e uR$G D$pHGG$$PD$|$DŽ$DŽ$ÍO ω‹$u럋D$|hvnu ܲt ֺ$,$$0$$4$$$D$$D$}AD$$L$ tI$DŽ$DŽ$DŽ$DŽ$$$,D$SD$L$ $$$$$$f$D$G$D$D$ D$!D$L$$$D$L$i]$L$H$$D$$L$(D$L$T$ \$b$1$$ $$$$$($$$D$$D$?D$$L$ tI$DŽ$DŽ$DŽ$DŽ$$$ D$QD$L$ $$$$$$f$D$G$D$D$ D$ D$L$$$Ëxd xd $$ËD$H@T$L$\$ $ $ЋD$L$$$Él$l$$$f"f$c$1-$$ $$<$t$l$(>D$ L$$t@$DŽ$DŽ$DŽ$DŽ$  $$L$OD$L$ $$$$$$f$D$G$D$D$ D$SD$L$$$D$L$DŽ$DŽ$ËfalsPet$$$$$<$t$T$%O ω‹$땉L$4T$@$ۍk Ӈ t$h  ؉D$tًt$4t$dt$4ىL$`l$4!|$` D$`!Ń ! L$tL$hۃ!t$`!t$d!! D$49‹\$@9݇Ç Օ$ $$L$L$lL$D$ \$*#j!$$L$D$D$L$T$ \$t$$D$L$辳T$0\$x$$$L$T$lT$D$ L$0d  d e urD$xd $$$tGQӃ uʀ$$$\$\$l\$L$ D$T$111ō=d D$xw뇋D$x111릋$$$D$D$lD$-D$ D$tL$$$Z \$p- s,$vf|$Ge ul ֺL$tO e u:$G D$pHGG$$PD$|$O ω‹$虽뷍ֺ芽돉T$\$$$L$\$,D$ L$@ $ЋD$$ $T$LT$D$W0D$ D$$$$D$D$lD$,D$$L$ L$t$Z \$p- s,$4eD$$$ L$D$$L$ L$LL$D$L$$Ge ufL$tO e u:$G D$pHGG$$PD$|$蔰{O ω‹$뷉듋D$\ ueWf.v  f f.v> f.$$$D$D$lD$X1̓tЍ^$c|$Ge u ka k_Q $$L$$T$D$L$T$ \$D$P$\$TL$l̓y/uO$T$D$\$ ܪD$L$L$ D$$$$D$D$lD$#$$$D$l$*D$$L$ L$t$Z \$p- s,$b|$Ge ul CںL$tO e u:$G D$pHGG$$PD$|$UÀ3t$D$8$ܲD$D$4É$L$\$D$L$  $L$D$=D$ L$@ $ЋD$L$uD$8$D$ID$04ÉD$$L$D$<$D$@D$D$DD$D$D$(L$ L$$F/D$L$ e u6L$(HL$H e uL$$H x D$$螆zxD$(莆뿉u)^$.|$Ge u ͻjͻ7]hXtD$,D$0D$,L$0 $D$,D$>D$ L$ $D$  D$ G E$|$ 8ne ;aD$,D$ $D$$D$D$(D$辡D$ tBD$$ PL$D$赧D$,uËD$$D$"D$$ 辺L$D$sD$,뼋D$$D$"׫X]m(e ;a4D$8HTT$DT$,T$@ $D$D$@\$ T$D$ eD$L$T$ \$Hu8\$8$L$D$T$ 该D$Hu4ËD$8$D$"D$$L$0T$(D$8$D$"D$$L$0T$(띃ul$@UI^$,|$Ge u N蕃Aul$@Uul$@Uul$@]UD$,G E$|$i k]e ;a4D$8HTT$DT$, T$@1ۉ $D$D$@T$ \$D$ eD$L$T$ \$Hu8\$8$D$L$T$ D$Hu4ËD$8$D$"TD$0L$$T$(D$8$D$"5D$0L$$T$(띃ul$@U1L ul$@U18^$a*|$Ge u CGCׁ: ul$@U1 ul$@U] ul$@U1D$,G E$|$ iVe ;a`D$t D$pZ f.f.D$hHTD$@T$@\$D  T$H\$LL$HWf.uwT$d@+f.e\$/ $D$D$@D$ \$D$T$HBD$(L$$T$ \$/euN|IY9\eu4Y9q\-uY9\\0u \\I\$xu8\$h$T$L$D$ cD$xu`ËD$h$D$"赦D$4T$PL$0D$h$D$"薦D$4L$0T$Pf. u0Zxc.c.ffT$df$D$gD$ D$dD$*@D$D$$L$D$D$ D$,L$8T$4k ^e D$;A$$$L$7D$D$$L$L$4T$ T$  $T$T$1D$ D$tC뵄5 ^ <>u9}29D$0$)!ݍ)\$t$|D$   D$0$ L$D$\|D$Lc Hc 9 D$D$0$詀D$ Hc Lc 9D$D$0$yt$$nD$8L$4T$tC뵄5 ^ <>u9};9D$4$T$@)!ʉT$)\$|$ 1wD$   D$4$ L$D$wD$Lc Hc 92D$D$4$0|D$ Hc Lc 9D$D$4$|t$(nD$VHÍI$D$ D$D$D$~S܍I$D$D$t$bS軴 8/e ;aD$L$9k4T$\ Dl$1F|$L$l$9}.<9sJk4l L 9}s2L9tD$D$9sk4D 9D$    8Ge $;A0$LOP$1AP$$$$$ PL$`1 P$O$$lL $$h$D1O$TO$T$PL $$LDŽ$ DŽ$$DŽ$(L$$T$4$$1|$h$`$Ƌ$4Չډˉ$$$$$$S$L$S  $$DL$$tL$D$ $$$$Cl$|9LÉ͋$$$$$Ћ$ $$$\$|$|$$$1ҋ$$1 $$DL$$tT$ D$ 1$$$$EӉ‰艄$$$$$t$xmd4$ՋD$$9$t@,$xL$$Ѝ$$Q$$t$$$I$$ $D$D$D$ D$L$u"-u$$$ $D$OD$D$xL$$T$ $\$$$T$D$ $$$$$l`&$BT$T$D$L$T$ $l$h9$$$9t$l$\$R$l$9 $$ $$$$h`$ՋD$$$$$$$\$x\$-Cںl$D$ OD$j1D$j$$$$$$$D$xD$D$D$ ND$$P5VO$$P$$T$$h$$l$$p$$t$$x$$|$D$j$獴$PN=$ $N$($$$ Y9_A$$k4<e $ ^N`$$L$$tT$D$ ~n$ $$Q97 k4t̍$N$($$$ Y9_A$$k4<e u&$M$$$II$|$$D$JǍ-I,$T$L$D$ \$T$L$D$$($ dI$|$$ D$J-I,$T$L$D$ \$mT$L$D$$($ dˋ$:$u$HP$$ыD$t$D$j$$$$`$$\$$l${D$ A$$$$`$$\$$l$D$ t"$$$ÉЉʉ$H`$$ыD$L$$$1G$$$$$$$$$ $$$$獴$EK$$-K$H$9u$$-e k4<u$J؉ы$$$I$|$$D$H$$뵍I$$l$D$T$ L$\$D$T$H$R$HP$$ыD$H w lt1`$HP$$ыD$$@($ $ЋD$L$<11$$D$l$$PP $ҋD$tI$D$l$@P $ЋD$$$$D$l@($ $ЋL$D$$륋$$$$$$ $($8$<$@DŽ$DŽ$ $$ $ t$$8D$D$ L$ $D$$D$z$($ 11$p$$$D$t$$$$,$$$$ 9}O#k4э$G$$9u$$$D$L$hD$ V$I$Q\$t9$k4< e $zG$؉Ӊꋬ$$ދ$ 9g$$$D$tk4$덼$G$$$$$T$p$I$|$$D$'D$T$p$4I$$l$L$\$ T$D$L$\$Q$$($ $]ȋ$9L9D$|1A$)$!э$wl T T9@T L L8.$|5 E1ɈL$k$$|E$$EL$k$Q\$t9x$$e k4| u$RE$ʉ$$I$|$$D$yB1$$볍I$$l$L$\$ T$Bl$D$\$P1$M\$t$$a$|$D׉$ $$$($,$0$4P|$$,D$D$ L$ $D$$$$ $($$$Ā踢 豣 誢 裢 蜢 蕢 &e ;aC0D$4Hd $L$L$8L$~XD$ L$T$t& t9BJT$=*!u.D$09wx)ȋ\$4)ˉ!ˋ|$,t$‰D$8ÀSu=tD$8D$8ÀktstD$8Å~ D$8D$8 #e ;avxD$L$9u_T$\$1E9}H4+9sL<*8؇ߖtVw߃ߖ8؇ߖuT$D$ÍVvD$D$D$X "le ;avRD$L$9u9T$\$1E9}"4+9s&<*ߖ8؇ߖtD$D$D$ޝ "e ;a0D$4H+H L$$s$|$e 9 pCG G e G|$,GD$4L$8\$&ЋL$ dЋL$ YD$ Oω15pC4; 4 0$D$         e ;aveD$ $D$ J[D$ $L$$L$L$(L$V1%D$D$ $L$,L$T$0T$VD$@L$49|Ӄe ;a0D$4H+H L$ s$+|$e c pCG G e (G|$,G111\$(C|$,ʉ؋\$<9qD$(T$$L$O\$8,D$w Ow <$D$ ыD$ u D$L$$떃 L$T$$T$$L$cD$[,tu:tA[uL$4 $D$YL$$L$4 $D$}YD$L$$L$4 $D$_YD$4$D$ NYD$L$$L$4 $D$0YD$4$L$DL$T$HT$\$L\$ l$Pl$t$$t$D$L$$]uqt(1ɉT$$L$\$4$D$XD$L$$OD$4$L$DL$\$H\$l$Ll$ t$Pt$JT$$T$D$L$T$$땀{}tD$4$L$L$PXD$L$$D$D$4$L$DL$T$HT$\$L\$ l$Pl$t$$Ft$$t$D$1ɋT$$T$$1ɋT$$ D$,$6D$ u\D$ u,D$4@@ @PD$,H@L$TD$X0ËL$4AP|`QY i)9Q؅|D9w@AD$TD$X0ÍOω1]0pCK0葕 0$D$W e ;a |$  e  pCG G e GG1 L$ A|$ L$9}LD$ O\$,w Ow <$D$ ыD$ uD$ H@D$$L$(É<$D$ uD$ H@D$$L$(D$$D$(ÍOω1/GpC.je ;avD$HD$L$ 7e ;a D$HH$D$ ыD$HHt D$ Í५$D$@ e u: L$QY PX 0Qe uA롍y-뗉Ǎ -D$ D$ D$ 4e ;a D$ w uRu=]uL$ $D$D$D$ ËL$ $D$QD$D$ D$ À u맀 u뛀 _e ;aw L$( w;"[-"u1|$$ e uCD$, ÍCt,-u1|$$ e uCD$, ÍC>,Qπw1|$$ e u`CD$, Í`C,D$$$L$ D$D$ aD$D$, À0u1|$$ e u\CD$, Í\C+[Z|$$ e lCG HW_9HO D$, Í-`&,$\$D$T$ L$#D$L$T$\$$Se u C߉É롍{+lC*wnwpfu1|$$ e uCD$, ÍC*nq|$$ e uCD$, ÍC~*tu1|$$ e uCD$, ÍCH*{|$$ e dCG HW_9HO D$, Í-`&,$\$D$T$ L$D$L$T$\$$Se u C߉É롍{)dC)wD$, À u  u  ie ;a D$ w uguR}u1L$Q Yj9skD $D$8D$D$ ËL$ $D$LD$D$ D$ À u뒀 u놀 { @e ;aL$ w uyud"u1|$ e uCD$ ÍC.(D$$L$D$D$ *D$D$ D$ À u뀀 u q fG2e ;a|$O Wu@ e u)CG<$D$D$D$D$ ÍC['\$ w:Qt+ e uCD$ ÍC'lub:u3D e upCD$ ÍpC&<$\$D$D$ 7D$D$ Íq,u3D e uhCD$ ÍhCi&}uXw u/ e uCGD$ ÍC-& e u CӍC &Ɖ<$\$ cD$D$ lD$D$ Ã,u+ e upCD$ ÍpC%]uXw u/ e uCGD$ ÍCm% e u CӍCL%Ɖ<$\$ƻD$D$ D$D$ É<$\$D$D$ D$D$ À u  u  J e ;avLD$ t t t u D$ ËL$ $D$D$D$  e ;aL$"u1|$ e uCD$ ÍC#\u1|$ e uCD$ ÍC# s.D$$L$kD$D$ D$D$ D$  -e ;aL$bwz/wi"u1|$ e uCD$ ÍC#/tʋD$$L$D$D$ k D$D$ À\tbtƀnw ftnt뵀rvtmuu|$ e uCD$ ÍC|" e ;avL$QЀ w1|$ e uCD$ ÍC"QvǍQvD$$L$D$D$ "k D$D$ Z ee ;avL$QЀ w1|$ e uCD$ ÍC!QvǍQvD$$L$D$D$ " D$D$  ee ;avL$QЀ w1|$ e uCD$ ÍC QvǍQvD$$L$D$D$ "+ D$D$  ee ;avL$QЀ w1|$ e uCD$ ÍC? QvǍQvD$$L$D$D$ " D$D$ zee ;aL$0u1|$ e u\CD$ Í\CQπw1|$ e u`CD$ Í`CeD$$L$sD$D$  D$D$ ;e ;av] L$QЀ w1|$ e u`CD$ Í`CD$$L$D$D$ ,e ;a L$.u1|$ e uxCD$ ÍxCNeu1|$ e uCD$ ÍCEtʋD$$L$AD$D$ pKe ;avoL$QЀ w1|$ e utCD$ ÍtCD$$L$gAD$D$ &D$D$ ue ;avs L$QЀ vWeu1|$ e uCD$ ÍCEtʋD$$L$#D$D$ D$ Fqe ;av_ L$+u1|$ e uCD$ ÍCr-tʋD$$L$D$D$ e ;avoL$QЀ w1|$ e u|CD$ Í|CD$$L$D$D$ KD$D$ :ue ;av8 D$HЀ w D$ ËL$ $D$D$D$ e ;avlL$ru1|$ e uCD$ ÍCD$$L$D$D$ ^D$D$ Mxe ;avlL$uu1|$ e uCD$ ÍCrD$$L$D$D$ D$D$ xe ;avlL$eu1|$ e uCD$ ÍCD$$L$~D$D$ >D$D$ -xe ;avlL$au1|$ e uCD$ ÍCRD$$L$ռD$D$ D$D$ xe ;avlL$lu1|$ e uCD$ ÍCD$$L$ռD$D$ D$D$  xe ;avlL$su1|$ e uCD$ ÍC2D$$L$ּD$D$ D$D$ }xe ;avlL$eu1|$ e uCD$ ÍCD$$L$ռD$D$ D$D$ xe ;avlL$uu1|$ e uCD$ ÍCD$$L$_D$D$ nD$D$ ]xe ;avlL$lu1|$ e uCD$ ÍCD$$L$@D$D$ D$D$ xe ;avlL$lu1|$ e uCD$ ÍCD$$L$@D$D$ ND$D$ =xe ;av D$ e ;a8|$< e CD$@$D$D$4L$L$,५$耽D$D$0$ L$D$L$4L$ L$,L$ L$D$L$DL$L$HL$ D$$L$(|$0O e uBL$J4ǀ D$@,dD$DD$HD$L8Ét$$`&$\$T$L$ l$wD$L$T$\$<e ut$$ʉʼn؉iE-$2D$L$T$ \$\$@T$DL$HD$L8À]"D$<t HhAHhY9LJQw2ǀ D$@0dD$DD$HD$L8Ãuǀlj$]D$ L$T$\$L$@D$D\$HT$L8À{D$<HhAHhk9>K4ǀ D$@4dD$DD$HD$L8Ét$$`&$T$\$L$ l$臽D$L$T$\$<e ut$$‰؉kW/$DD$L$T$\$ T$@\$DL$HD$L8À}4D$<t HhAHhY9LJQw2ǀ D$@8dD$DD$HD$L8Ãuǀlj$oD$L$T$\$ T$@\$DL$HD$L8D$@D$DT$HL$L8zd sc ld ec e ;aPD$TV$L$0T$DD$X$lD$THlL$@PhT$<ʉT$,l$l$8t$t$L@pD$4=५<$ϦD$D$H$ L$D$L$LL$ L$8L$ L$D$L$DL$L$0L$ WD$$L$(|$HO e T$<l$@\$4Ӆu.D$,G_ D$\D$`0D$d|$hP͍Qw$uѻ11*u+uعtuqt+e ;av7D$$/D$L$t 1D$À]t}1Re ;a 11Cjr 9}dl u(u؉ZhD$D$D$ Õ uϕ u Ç볅u$D$L$T$ZhrD$L$D$ Y` -e ;aD$$L$L$ T$D$ D$t9|YL$9wQP9wJ\$\$ D$$)щ!ʍ L$(D$,ËD$D$ D$D$$D$(D$,` Je ;a$D$,L$(щ؅L$D$ $D$ T$D$ D$|gL$9wP9wx)щ!ʋL$ʋl$49u\$T$ $L$0L$D$!D$ uT$ \$l$4hD$8$ËL$D$11D$8$D$8$_ e ;avi D$$qD$L$t$ 9u*Xu/L$e uY Íyω $D$l 0{e ;avTBD$J $I9D$D$$D$ D$D$$D$D$(D$ D$,D$D$-D$Ѓ%e ;av\BJT$9sD\T l$9s1Dl Dl$D$ $\$ D$D$ ] e ;a&,BP@\$09k4t | \$49T$D$k4 T 9t4D T l  L$l$ $D$`D$D$8,ÉL$(\$$l$ 4$D$|$D$ tnD$(L$ T \$$l 9uKLT8tL$8,É$D$D$D$D$D$0D$ D$4D$TD$D$8,D$8,ËL$(\$$l$ ([ _e ;ae vu_ e [-t裠N脀7Y$D$3BD$ L$ xd e xd $$AD$L$ @( $ЋD$L$xd e  xd @$ȒD$D$L$ xd e M xd $臞$蹭D$L$ @( $ЋD$L$xd e  xd  $9$kD$L$ @( $ЋD$L$xd e  xd  $D$ `@ e uO,od  $躝D$ `@@ e u0od e Í=0od !=,od 몍=xd g=xd =xd =xd [=xd 5Pe ;av] YuZD$$tDHP$L$T$tD$ L$T$\$l$D$(L$,T$0\$4l$8 ^ 늍|$$9;u#e ;av'D$D$D$D$ D$be ;avD$D$D$2e ;avD$D$ e ;avD$D$D$e ;av'D$D$D$ D$D$e ;av'D$D$D$D$D$Re ;av$D$D$D$D$ D$e ;av7D$D$D$ D$D$D$D$e ;av/D$D$D$D$D$D$_ze ;av/D$D$D$D$ D$D$*e ;av/D$D$D$ D$D$D$ e ;avD$D$e ;avD$D$D$D$ je ;avD$D$:e ;avD$D$D$D$ ?e ;avD$D$D$D$ _e ;av'D$D$D$D$D$wre ;avD$D$D$ D$:e ;av'D$D$D$ D$D$e ;av'D$D$D$D$D$e ;av/D$D$D$D$D$D$je ;avIBB$D$D$D$ D$D$$D$ D$(D$D$,D$D$-D$mpe ;avDB$D$D$D$ D$D$$D$ D$(D$D$,D$D$-D$ue ;avDB$D$D$D$ D$D$$D$ D$(D$D$,D$D$-D$ye ;avDB$D$D$D$ D$D$$D$ D$(D$D$,D$D$-D$NEe ;avDB$D$D$D$ D$D$$D$ D$(D$D$,D$D$-D$辅e ;avDB$D$D$D$ D$D$$D$ D$(D$D$,D$D$-D$.e ;avDB$D$D$D$ D$D$$D$ D$(D$D$,D$D$-D$%e ;av: D$$L$L$wD$L$ $D$`D$D$ _e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$D$ 1݉4$T$l$L$ D$\$qe ;av7 Yu4D$t$D$L$L$D$ yU r밍|$9;uĉ#e ;av: D$$L$L$D$L$ $D$D$D$ e ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$UD$ 1݉$L$l$:L$ D$\$vqe ;avJYuGD$t1H$L$D$L$D$D$ L$(D$,T 띍|$9;u#e ;avNYuKD$t5H$L$D$L$T$ \$\$ T$$L$(D$,S 뙍|$9;u#e ;av>Yu;D$t%H$L${D$L$ D$L$2S +멍|$9;u#e ;avBD$$L$L$D$L$ $D$D$HYD$ D$e ;avbD$HT$Z*09t*1Ʉt HZ9R @ 9!ȈD$1,$t$\$KL$ D$T$7e ;aD$$L$L$D$L$Q$D$D$L$Q$D$D$MXD$ L$Q$D$D$L$ $D$D$D$Ye ;aD$H\$k391ɄK P hs91ɄHPk9k9!ʄtjHSkp9t;1Ʉt1K$S X$@ 9t 1D$É$D$L$ D$ 1݉,$t$T$ L$ D$\$11렉4$L$T$7L$ D$\$H1A4$T$l$^ L$ D$\$Ge ;avBD$$L$L$D$ VD$ L$ $D$D$D$e ;avdD$T$9uMJX9u?HZ9u1H@ ZR 9t 1D$É$D$\$} D$ 111ee ;av=Yu:D$t$HP$L$T$DD$ D$O 몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$ԓD$D$(N 뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$tN 뢍|$9;u#e ;av/ Yu,D$@I$ыD$L$D$L$ 븍|$9;ủ#e ;av. Yu+D$@L$ $ЋD$L$L$D$ [빍|$9;u͉#e ;avBD$$L$L$D$ SD$ L$ $D$ D$D$e ;avdD$T$9uMJX9u?HZ9u1H@ ZR 9t 1D$É$D$\$}D$ 111ee ;avGYuDD$t.H$L$D$D$D$ D$ kD$D$$ L 렍|$9;u#e ;av*e vuI e e e ;a D$$L$L$c D$L$Q$D$L D$L$Q$D$5 D$L$Q$D$ D$L$Q $D$ D$L$Q($D$ D$L$0 $D$ D$D$ 3e ;aD$H\$k391Ʉ{H Pks 9E1Ʉ4HPks91ɄHSkp91ɄH$S$k p 9tt1ɄtjH,S,k(p(9t;1Ʉt1K4S0X4@09t 1D$É$D$L$D$ 1݉,$t$T$L$ D$\$1뤉,$t$T$L$ D$\$l1e,$t$T$|L$ D$\$)1",$T$t$SL$ D$\$1,$T$t$*L$ D$\$14$T$l$L$ D$\$Te ;av*e vu F e @e e ;av D$D$pe ;avLD$ Hs# 8c (֠$D$D$:D$L$ T$d d e u d e Í=d Ne ;av0Yu-D$ t$D$D$E 뷍|$ 9;uˉ#e ;av/Yu,D$ t$D$D$QE J븍|$ 9;ủ#e ;av7 Yu4D$t$D$L$L$D$ D 밍|$9;uĉ#e ;av/Yu,D$ t$BD$D$D 븍|$ 9;ủ#e ;avbD$ L$9u@L$T$11s4$<41 4$9}rÇHD$ D$ = e ;aD$L$(9u]L$IщL$ \$l$$11<3!חD$ |5!ϗD$ |$ L$ ϗ3F|$ 9}r@= 0$pD$L OZe ;ae4D$8HT$<$ыD$D$( 3 $T$DT$T$D$ L$T$\$D9D$,L$T$l$@9t$l$\$9D$8HT$<$ыD$ 3 $D$胓D$D$$L$ L$0T$T$  $MD$L$8 e uxL$L$0D$4Í0$D$jI 賾e ;av D$@D$}e ;ab8L$L$0D$4Í0$D$*E se ;av D$@D$=e ;aTL$XQD$lӃt1҅}D$`T$l9L)ډ)9 T$,Yq)L$p)!T$h9l$<9t4$L$D$D$XL$hT$d\$pl$\t$l|$,D$HD$@D$`(L$\Y ӃQ ڃY ӃQi ՃQ i ՃQ q  փ oQ  ]q փ GQ :y  ׃%Q A ЋL$HT$D33j3r3B L$ D$81D$D$8D$01D$ 1D$1D$1$D$$D$8~\$T$BT$|$D| T$_ 1=_ 1Е-_ T1ЋT$(ҋ1ЃT$ T$D|$H\$ l$t$$L$$L$ D$D$93L$$9\$_ 1É_ ,1_ 41t$Ж5_ 1ӍQ9q\$ D$,T$D\_ 1؉_ ,1l$_ ,1l$Е1ЍQ9D$\$(T$DD_ 1ËD$_ 1É_ ,1l$,Е1ӍQ9DD$ ^ l$l ŋD$% ŋ$% D$4D$% 4$4 ΁  L$D$ $  4 l ͋ $ %   ȋL$  D$$9ct$1p9H\$t\$1ލX9(\1h9D 1ȋL$TT$|$PGWGGWGvsWvd_ vWW vJ_ v=W v.G v!W vGvW@C < 5 . '                e ;a*D$@\$,t$ G03F|D$@\$8ʋ\$,l$8v$@9}|$4!l$4T$,!9rD$@X9p\$,(rpw0Dt$(T$D$L$h\$0ȋL$(뭉T$4L$8D$< Ajle ;avpD$}ËL$ Q9},5uDp9u8~0T„t $D$.É $D$1ڕ5ite ;aD$|fL$Q9|W~h9s`t9su1Ar>AA @A Íh9s!TBTQ| 9wA    hUe ;av)D$ }ËL$Q9}A $he ;avND$HP~r9s*|0t|9wPu@   ;he ;avD$D$ D$D$he ;aD$f.u4z2`$'D$$D$D$ D$ D$$D$D$jND$D$ @$D$D$?D$L$ $L$  TgOe ;avuD$ @L$u2HuHtH@D$ùv9rD$É$D$?D$ foe ;avD$L$AAL$ tfe ;av D$D$Nfe ;avLD$Ht D$ËHP@ D$$D$L$'D$+D$ D$ee ;av D$@D$ee ;av D$@D$|ee ;av/D$Ht@t D$D$D$*ee ;aQ0L$4Q6QT$$\$89)+iCiCiCqCksЋQ T$ϋI9l$l$9~vT$ t$,9t4$L$l$L$ T$8J L$J e u-D$,BD$4@BBuBD$$D$<0ÍzD$,{̉놉L$( ($T$BD$6T$l$t$ D$$L$(\$8|$4<됉1ce ;aD$T$!˃ ˄t#D$ HtH@ù!م Ȅt#D$ HtH@ùD$ @P$D$D$fb8e ;aO,L$4T$09YZYZYZiBupZjqȋI 99\$L$l$(9t,$t$|$轁L$T$0J L$J e u_D$(BD$4@BBtT$<,ËBL$8ȉD$ˉ\$$D$ .D$0D$<,ÍzD$(6y뚉Mt$$L$  ($L$AD$|4l$ \$L$D$4T$0t$$|$ fae ;av D$@D$t$l$ \$D$e ;av- D$$L$L$D$HHD$ >e D$;A$HL$tP T$0)щL$X$~|$pN L$l)ω|$P|$0 |$t)݉l$\T$p|$ll$l )NL$h^$$} |$8ut$|}X@O9Ls9t9\$4D$x|$<-T$Tu$t$\9ևÇ݋\$XD$P9ÇÇ!9 חku)؋$L$ L$lL$L$hL$$D$D$D$sD$$D$LL$ L$DT$$k s{$CK [\$ L$D$4$l$|$T$D$DD$D$LD$ ϽD$(L$,T$$$C Ke SD$XL$\D$XL$\S T$lT$d‰T$`{K $l$|$D$ L$`)\$$,$L$L$l l$dt$Xl$\)݉l$D$ %ĈË$0SV)؋$L$ L$lL$L$hL$L$| $L$8L$L$x9spD~)J9sZT9rvD$D$É1܉1Dž~D$D$D$e ^ ,"e ;aD$L$ \$$+9dQkSi݈Xi8Еu9$L$\$~D$HuHu Hu@D$(É $\$iD$~D$$L$ L$L$$L$륋D$HH$L$$L$L$ L$zu!kuis8؇ޕuhku!f@ItKHD$(1u$L$rD$D$(St$\$RD$D$(ÀL$ \$$f@@D$D$ED$D$*@$D$D$[D$ L$ $D$' p*e ;aD$L$ \$$+9gQkSi݈Xi8Еt9$L$\$^D$HuHu Hu@D$(É $\$ID$~D$$L$ L$L$$L$륋D$HH$L$$L$L$ L$zu!kuis8؇ޕukku$f@ItKHD$(1u$L$OD$D$(St$\$D$D$(ÀL$ \$$f@@D$D$D$D$*@$D$D$8D$ L$ $D$ M(e ;aD$L$ \$$+9Qk8•ˆPQu StH@Iu Stcu StVu @D$(Kt@D$(É$L$\$'D$D$(ÉoL$ \$$df@D$D$9(D$D$$@$D$D$D$L$ $L$ű 'e ;aD$L$ \$$+9Qk8•ˆPQu StK@IuStgu.StYu @D$(Kt@D$(Äى$L$\$tD$D$(ÉlL$ \$$af@D$D$ZԽD$D$0@$D$D$趼D$L$ $L$肰 %e ;a D$H1ɋT$Zuf19|TFt)u$T$ D$D$ D$ É$D$D$D$ D$ D$ Àujt넀u1uPPIu1$e ;avQ D$$$D$(D$D$,D$D$ D$L$tD$0D$4 ÉD$0D$4 X$e D$;A$u@L$<@$$$\$輚D$L$T$ $CXCK S$L$D$$D$ $L$$T$D$n$D$(D$dL$,L$`T$4\$0l$$t$ |$$q i-e y$$$D$D$襏D$ L$T$\$l$+D$LT$P$~ VFL$T|$\\$hl$X$|$T$D$\T$ )Љ ͋L$)͋L$`y\$d011͋L$TL$LȉD$HʋL$PT$HՁƒ!Ӆ ˄\L$<$ Bj!˄t$@|$DL$;|$l1w: \$l$@L$診L$T$@l$;!݋\$DۇÇ tl1)Љ $D$؉D$D$ $ $L$D$$$D$d$D$X$D$h$ĄÉ $T$\$3D$ $ $L$D$띉$D$$$D$d$D$X$D$h$ĄÍ9$D$D$D$ D$貈D$L$DŽ$T$d$$$ĄÃ L$L΋T$P u ։ 11\$d11D$<fF$D$d$$$ĄDŽ$D$d$$$ĄDŽ$$$$ĄÍi7D$d)DŽ$DŽ$$$ĄÍ0$D$ 0$D$ة !e ;aj0D$<T$8!˅ ˄^ ^ L$D$D$4$|$1"7D$8D$T$4l$,$@\$DD$$D$D$D$8D$qD$L$T$\$$KS e uC\$0 Í{X|e ;av9J$}D$$D$D$D$D$qD$ D$pe ;a,L$4T$09tgZ jqȋI9o9~e\$t$l$(9t,$L$|$L$T$0JL$J e uD$(BD$4T$8,ÍzD$(@뗉t$ L$$ ($t$FD$\$t$l$ D$4L$$T$0|$ Qse ;avD$H P@D$T$ L$/e ;avWD$ $D$$D$D$(D$nD$ L$T$\$KS e uC\$,Í{9e ;a,L$4T$09tgZj qȋI9r9~ht$\$(l$9t$L$|$ L$T$0JL$J e uD$(BD$4T$8,ÍzD$(މ딉t$ L$$ ($t$FD$t$\$ l$D$4L$$T$0|$ N e ;a,L$4T$09tkZj qȋI99~xl$t$\$(9t$L$|$ L$T$0JL$J e u+D$(BD$4B~T$8,1zD$(yΉ넉t$ L$$ ($t$FD$¿l$t$\$ D$4L$$T$0|$ >e ;a% ($D$D$觔D$t$ l$L$d$$|$HD$8$랃|/D$pD$0D$p\$0z.$l$0ml$L ($D$D$"D$t$ |$L$d$$l$LD$0$둉1֋$u$0ى$D$T$L$ $l$$l$$l$$t$|$-D$ $$$$$0ىL$$$$Ƅ$DŽ$DŽ$DŽ$$$D$D$l$ Ƅ$DŽ$DŽ$DŽ$$$4NT$l$ ($T$JL$it$T$|$ $8$<$l$lTL$<;L$<2DŽ$ĤDŽ$ĤËD$<$Ĥø,pl$@t$T ($l$ML$ l$T$ \$$$t$T|$@ |$P ($t$NL$\$t$l$ $$$|$PAq0 j0 D$lD$p L$lD$pX$D$DD$lD$D$ D$D$L$L$dD$h0$D$dD$LD$ L$ $D$> e ;a(D$D$D$ D$$D$$D$4D$ c L$ D$ D$$D$D$ D$,$L$0L$L$L$L$4L$ D$,D$8([Ve ;adD$TD$XD$\D$`D$T$D$pD$D$~ D$ D$D$DD$HD$LD$PL$D $L$lL$D$D$ D$D$4D$8D$<D$@L$4 $D$L$L$L$pL$ D$D$ D$$D$(D$,D$0L$$ $D$D$?D$ D$$D$L$pL$D$$D$L$L$ D$$D$L$pL$sD$$D$ c L$D$$D$L$lL$D$$D$L$pL$)D$$D$L$ L$D$h$L$L$L$pL$D$hD$tdde D$;AjD$dD$hD$lD$pD$d$$L$c T$D$pL$lT$h$L$D$qD$ D$(L$d $L$D$:D$tD$xD$|DŽ$D$t$D$D$nD$t$D$ c L$D$t$$L$D$uD$DD$HD$LD$PƄ$DŽ$DŽ$DŽ$Ƅ$DŽ$DŽ$DŽ$D$TD$XD$\D$`D$D$L$dL$c T$D$D$D$D$D$D$$L$D$$T$ $$$L$L$dL$$T$ $$L$tL$L$dL$$L$ cD$(D$T$D$D$D$ $D$TD$$L$GD$,@D$,L$T $c T$8D$uL$,D$T$D$D$hD$ $D$TD$L$(T$,)IL$D$ D$$$D$L$TL$$T$ $$L$TL$L$D$ $$D$$L$fD$D$D$L$TL$D$ $D$DD$$L$/$$D$$L$D$ $$D$$L$D$,D$(L$`T$X$$9?9.L$$\$T$@9t$l$t$D$D$\D$$D$`D$@D$X$D$T1/$T$D9Q Yl$Lt$H9v9~l\$@l$T$ 9t$t$D$#L$$JL$ J e uD$@BD$D$ĤÍzD$@݉됉l$4t$< ($l$ED$%T$l$\$ D$4$t$LD$TT$X8)H P@D$ T$L$$D$D$c c c T$L$D$ J(D$,D$LD$TT$X8?H P@D$ T$L$$D$D$c c c T$L$D$ D$,D$du /$$D$L$D$hL$lD$pD$tD$xD$|&$$D$#D$L$ D$pL$t0$D$hD$#D$L$ D$xL$|@$$D$$D$s(D$ L$$L$gD$D$ D$pD$D$D$ĀÃsou $svx` 艊e ;aD$L$$T$09s\$,D$HL$DT$ ^(   8ve ;a^TD$h$9.T$t9"$9t$`9|$X|$Pt$,L$(<$L$t$3D$pL$tT$h$l$Pt$d|$,D$D1D$01D$8D$D4L$0AT$p\$tl$hꋜ$t$d|$,L$0D$8D$pL$tT$099R =959-L$@)ω|$<ۇ!T$L$\$|$<|$t$ t$ht$t$lt$D$D$L$0T$(9D$4D$P\$L$$\$l$ 7 0 ) "          ܺ ջ κ Ǻ  >e ;avOD$t7L$1B9s3t!i1| ^ ЉD$D$Q z>e ;au n g [e $;A $$9 $$9  $$$u~ۇN$$$ F$$$$ |ԉ$|$x ($D$D$D$L$T$  $$$$D$D$T$ L$D$$\$D$ L$$T$$T$X$D$D$$\$ $\$$\$L$D$T$ $D$$$\$($l$,D$DL$@T$<$9 D$X9v ݋$9^ D$X\$H$9t4$T$L$2D$X$T$Hˉʼn$$l$P$$5 (4$$|$|$D$L$T$ S D$tL$p$$1+$ $D$D$T$ L$pL$\$$l$$t$$\$ $L$$$T$($L$,L$xىL$xL$0T$4L$@T$<\$8$$$$$$ $\$T$$L$ $L$$L$$L$$L$$L$ $L$$$T$($\$,l$xl$0T$4aL$@T$<\$8$$$$$\$x$$$$$$$T$L$D$ ,$\$|$t$ $D$$D$$D$$$L$($T$,\$x\$0L$4{D$8L$C\$$D$L$T$ D$L$4D$$L$ T$1111%D$dxL$X$\$`l$H$D$\L$H$D$`|$d4$l$\$D$ D$D$$\$$l$$t$ T$$L$(D$,QD$8L$4T$0$L$D$T$ L$D$$D$L$HL$T$`T$ D$(L$$T$, $D$T$L$ D$T$D$D$$L$ L$XT$$T$\$L$T$$\$ l$Hl$t$`t$踇D$D$dD$HL$T9i‹$9~XL$TD$l$$9t$l$T$g $$D$l$D$T$ČÉ뤍 ( $D$HL$\$ D$L$T$Hr$$D$H$D$`$ČË\$hhD$x1D$hD$x?1kЋ$$$$1$$$1p{ { e ;av2L$t#1ʻC9vL$\$ ^} e ;av*D$L$~ tT$ ?e D$;A $$H$$D$L$ T$e$M0& 1$T$\t$XD$/l$T,$D$D$@L$L$0T$T$$t$\$D$pD$XD$8L$h1ɉL$41ɉL$<1ɉ$$$T$`T$XD$pL$hT$`5l$Tt$0$$L$/D$8߉֋D$@L$0T$T$$4\$/.t$\sЖ ؖ9h$t$<t$4F9$$\$1DŽ$DŽ$ `& $D$VD$ L$$$$D$$D$D$ D$\D$L$$$0$$D$D$ L$ $D$ e ;avH D$$$D$(D$D$,D$D$ D$0D$2D$L$T$D$4L$8T$< e ;ai|$H<9$$\rl$T* ^  L$l$,V$HT$l\$T*L$^,ȍQ$L$`3$L$L$D$ D$tL$L$|$`wP@9ruE$9i$ L$PGD$t|$\|$h|$\$9|$9$ ! !>D$`X5P@9l$tT($D$l)ȉ !؋L$ll$T$0t$h!ˋt$XD$`D$ht)T$0!>Ot$`FP@9r5$D$`tDH9 D8-9D$@)ȉ!$)͉$$|Éȉۇ!i1|5^ \5,$GD$D$dL$L$L$$$\$D$ i D$D$pL$L$4T$T$8 ($$\$kl$D$L$T$ $9D$DL$HT$x$9t$l$\$D$x$D$DD$D$HD$D$tD$ L$k 7k 0k )k "k k k k 0$pD$y we D$;A$j$Q$$$$$1D$T1$1D$X$5^ ~z9x4t99^t 9S9&T$l L$|\,tl$$\$(t$,$$l$Ll$t$Pt$$|$ |$T|$|$X|$\$l$t$ :D$8$L$4$T$0\$Dl$@t$<|$|$|$)$9jL$t$)ϋ$)ʉT$|!ʋ$ʋL$l4\$Xl$T$4$l$\$T$ |$T$|T$$T$$|$$|$ D$$L$($|$,D$t$$\$X$t$T|$lЋ$$$T$l$$$\$t$$`^ 9*|$L$l$P_l$D$`$|$`$5^ ,.|T$xLT$T$L$$L$ T$LT$\$P\$=rD$|"D$xH$‹$I$$T$x2|$`V$1D$`$'5^ 1M$$$ YU0l$|T5A$$$L$h\$|$$L$h9T$|~'D$\Z̋l$\Ѝ)9r$$މЅD$p4$|$l$t$ |$l$$D$D$(L$$$T$ $\$$$$$$1D$h$$D$pD$|$T$|G$D0؅~ X9rÉT$K$D$KDQT$dD$\$1$$$$$|$|$L$d9T$|~8#D$\1> \$|{-P@T9aދ$$D$|D$p4$|$l$t$ |$l$$D$`D$(L$$$T$ $\$$$$$$1D$d$$D$pD$|$T$|Cj$$$$!d d f d e d c 0$xD$r c c c e ;a1HD$X111ҋ\$\un111|$L<$|$P|$|$T|$D$ T$L$t$l$\$ D$$D$(D$,苻D$0L$4T$8D$`L$dT$hHÉD$DL$@T$< ($D$D$D$L$ T$v^|$\9Ӊʼn΋D$DL$@T$e ;aD$$T$ t D$(ËZ jrt>u @&4$l$\$D$ Y覲D$D$L$ QYi $\$l$D$ RyD$T$R9u D$(ø9t%I$,Rj9tθ.,j9t؉,R9t*9tk(,ҍj9t,dk9[MϺ,ҍ9? =k9*B)9 } 9 k+9]ALk/9!5k59D$ HP X $\$T$L$$AL$ D$D$u 1D$(ËD$ HP @$L$T$dD$ D$(ÍOٺˉ !ډ ! ! ì( ( ˆT$(Í0$D$wi e D$;A$D$D$$D$ $L$$T$c -c 5c t$l$\$ 5bD$,$L$($T$$$$L$D$$D$ $$D$D$$L$ $T$$\$D$HD$$D$|L$ L$xT$$$D$D$$\$ $l$$t$= c 5c -c l$t$|$ BaD$,L$(T$$$/D$`L$\$$ $D$D$ $L$L$hL$L$D${D$L$ L$l$13$'D$h$$$D$l$$D$\Hg$\Ir<5^ ى$11111ۉ\$T1ۉ$1l$P1ۉ$1ۉ\$p1ۉ\$t11I$GD$T$L$P$l$p\$tD$\$$$t$X|$d$9p$I9$5c t$Hc 9]T$H9J|$L$$9t,$D$T$D$L$$D$dL$X$$$\$P\$\$T\$T$ L$D$$\$l$xl$t$|t$ $|$$$|$($|$,ήD$0$L$4L$PT$8T$T$L$T$c -c 5c t$ l$\$`D$u#D$TL$P$\$tl$p$?$$L$PL$T$TT$$\$ $l$$t$Z`D$tL$P$\$Tl$tt$p$&$@L$P$\$Tl$tt$p$l$t$9p$t$p$$L$\$T$ L$\$D$L$T$ $$\$p\$\$t\$D$ L$T$$D$$$L$($T$,ND$0$L$4L$pT$8T$t\$<$l$@l$Pt$Dt$T$l$t$$|$ $|$$|$_D$tX$$L$PL$T$TT$c -c 5c \$ l$t$^D$Ƅ$ËD$TL$P$\$tl$p$)Ƅ$É$ ($t$NL$Ϊl$ t$|$$$$$U,$t$|$$L$ T$D$\$`\$$l$芩D$(L$$T$ $L$D$T$ L$D$ c c c T$L$D$ XL$(T$$D$,Ƅ$1$1R R 7e $T;A],$4uƄ$<,Ë$0 $D$$8T$c -c 5c t$ l$\$\D$t$0$Ƅ$DŽ$ DŽ$$DŽ$(Ƅ$DŽ$$DŽ$($$ DŽ$$DŽ$(J$褕D$$4H$8P e /$0X$111l$|'h$Ή׉\$|$4$8$0'c$|$xl$LU$$$D$D$;D$L(t$T$x\$|l$$D$xD$D$|D$$0D$ $4L$$8T$D$ L$T$$L$D$T$ L$D$+{D$$L$ L$|T$T$x$T$L$$0\$ $4l$$8t$ZD$tD$L$T$x\$|Ƅ$<,Ë$4u#$0L$L9$<,1$D$D$$0D$ $4L$$8T$c -c 5c t$l$\$ TD$($L$$$T$,$ $D$T$aD$ $$ $$T$$\$L$ T$\$D$著D$ D$HL$$$D$D$$0T$ $4\$$8l$5 c =c -c |$l$t$ VD$,$L$($T$$$\$L 111$$$  ($D$D$D$L$T$ * D$\$\$L 111\$P|$HG $T $$$l $ ^ ЋT$\$|$P1҉T$p1ۉ\$h1$T$\$|$Pb$$HT$pL$hT$\ދ$$$$$$$$$T$\L$X$$l$d|$`$l$H91$$D$xD$D$|D$\$ L$T$t$|$D$dD$ gD$,L$(T$$$L$D$T$ L$D$$0D$$4L$$8T$ hQD$(L$$T$, $D$T$L$ D$T$$ D$$L$$T$ SD$$$L$(L$xT$,T$|$$\$h\$\$p\$$\$ \$X\$\$\\$D$L$T$ $0\$$$4l$($8t$,蝁D$0$L$4L$hT$8T$p\$<$l$@l$Xt$Dt$\$<$|$x|$|$||$$|$ \$`\$l$dl$uD$L$T$ $L$T$D$ L$T$$D$$L$$T$ OD$$$L$(L$xT$,T$|$$\$h\$\$p\$$\$ \$`\$\$d\$D$L$T$ $0\$$$4l$($8t$,bD$0L$4T$8\$D$hH PX$T$L$ PSL$ T$\T$D$ D$ D$,L$$T$ \$l$0t$hVN e ~ ^|$`D$PPS$D$\D$D$PD$ L$T$D$HT$LL$\AYi q99!9 „Ld d d 9tD$tD$xdÉ$L$d D$D$ tЋD$hHL$PT$HщՋT$LڅÅɇÇ! ӄ1)ʈ\$?A111$D$D$c  c 5c t$ \$D$l$T$L$ D$$D$(D$,iD$8L$4T$0\$?tW\$hKC e u7S$D$>tD$hHD$tD$xdËD$h1{蝬\$hk s{|$ t$l$<$t$l$T$L$D$ &,D$,L$(T$$\$hKC e uSCd|$`,T$D ($D$D$xgD$L$T$ \$DՉgL$HT$L7D$tD$xdÅ9s~Yi 11D$tD$xdD$tD$xdÉxD$tD$xdËD$lWD$tD$xd  ~ w p 虓4e ;a@D$DHT$H$D$L$ L$D$D@L$H $D$PD$TD$X D$4D$\D$D$0$L$4L$TT$8T$X\$Yu;D$t%@ $D$ D$L$ D$L$" r멍|$9;u#e ;av8 Yu5D$t$AD$L$L$D$  q믍|$9;uÉ#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8:q똍|$ 9;u#e ;avGYuDD$t.@ $D$KD$ L$T$L$D$ T$$ p렍|$9;u#e ;av?YuYu;D$t%@ $D${D$L$ D$L$" o멍|$9;u#e ;av/ Yu,D$@I $ыD$L$D$L$ n븍|$9;ủ#e ;av0 Yu-D$@I$$ыD$L$D$L$ Yn뷍|$9;uˉ#e ;avNYuKD$ @L$$T$(T$T$,T$T$0T$ $ЋD$L$T$T$4D$8L$<m뙍|$ 9;u#e ;av>Yu;D$@L$ $ЋD$L$T$ \$\$ D$$T$(L$,km멍|$9;u#e ;avYuD$@L$ $Ѓmɍ|$9;u݉#e ;avW YuTD$$@L$(T$,T$T$0T$ $ЋD$L$T$\$l$ l$4D$8L$jnd L$e uHnd @ÍxzZx nZ늍xbZ.xSZGZqxB2Z=nd %ZBe ;a:`$ID$@ e  GHnd J$D$$vD$D$D$ i=nd e L$J$D$$D$D$D$ hnd e T$&PJ$rD$$D$D$D$ |hnd L$e HJ$!D$$D$D$D$ +hnd L$e umH J$D$$4D$D$D$ gnd L$e uHnd @ ÍxXx X늍xX.xWWqxGW=nd W;@e ;av3e $AD$賉nd L$ D$?e ;av3e $AD$cnd L$ D$?e ;av3e $AD$nd L$ D$F?e ;a`$D$@ e D 8Hd J$D$$XD$D$DD$ e=d D$ e J$sD$$WD$D$DD$ }ed L$e ~HJ$"D$$8D$D$8D$ ,ed L$e HJ$D$$pD$D$8D$ dd L$e H J$D$$D$D$8D$ dd L$e ueHd @d @ D$d $&d @D$d $&d @D$Ħd $&ÍxuT뒍x iT6xZTxKTvATx8,T=d TߋZv:ZA} r\$ l$<ȉ|$),T$)T$ rT؋l$u t$ދj2t$zT\$l$um ݋Z*l$߉zI|%Q\+sI@@@DL$ Z\$l$|$,Љl$}<$m <$l$l$]\$\$ڃ}Zsrlu}raX@)ڋXhDXP@ Q PDX@ QP ځQ@A@ 9 2 [.e ;aD$1,\у}QsX\rMHʁH) щ  P ˃)ʉP فXX| -Pe $\;A}$$1E|$lE|$LE|$,E$E$ $$,T$$\$c$ $L$$,T$$\$ *$ $L$$T$$ $L$$,T$$\$ L$l $$T$$\$L$l $L$$T$L$l $L$$T$$ $L$T$lT$$\$ eL$l $$T$$\$S1$D$(D$l$D$$L$0D$(@|׍D$l$D$$L$$T$ D$L$L$lL$$T$1$D$$D$L$D$$L$D$$@ |׍D$l$L$LL$D$$T$ D$L$L$lL$$T$r1$D$ D$L$D$$L$OD$ @|׍D$L$D$L$lL$$T$ D$,$L$LL$$T$1$D$D$,$D$$L$D$@/|׍D$L$D$L$,L$$T$ D$,$L$LL$$T$1$D$D$,$D$$L$qD$@|׍D$l$L$,L$D$$L$ 41$D$D$l$D$$L$!D$@|׍$$D$L$lL$$L$ $$D$$L$$$D$$,L$$L$ 1'D$$$D$$L$D$@a|ԋ$($$D$D$LD$$D$ =$)\e ;a D$L$9t$L$D$ 3HD$1,\у}Q\rHʁH) P 1\)\у}+ՁډQr,\у}Qm\r_HʁH) P 1\)\у}+ՁډQr Y,!ك}r!щ!ʉ!щ!ʉ!X X ݉  ݉ X   ߉  ߉ Ӈ! !͉)ʁ)H )P)P)P)P W P I B ; 4 - V&ae $;A!|$D1>|$$>$>$y>$m>$a>$dU>$DI>$$=>$1>|$d(>$>$ $%L$L$$ $L$L$T$D$$\$$l$L$$ $$ T$$\$r$ $$ T$\$$\$$l$ 5$ $$T$\$D\$$l$ $ $$ T$\$$\$$l$ $ $$T$L$$\$ $ $$T$\$D\$$l$ $ $$T$L$$\$ \$d $$T$$T$$d $$d $yL$1$d㍬$D\@}rL$ $D$Z$D$D$$L$$$$$dL$$DT$$\$ $$$L$$L$$$$$D$L$ D$L$I1$,,B}r$$hD$d$$L$$DL$$L$ D$D$D$L$$L$D$$$$L$$ T$D$$$D$$$D$$L$j$$L$$L$L$DL$$$$$D$$dL$$L$ 1L$d\$D@}rD$D$$$L$D$D$D$;$$$L$$T$$$D$L$DL$ $$1$@}r$$D$$$L$$L$ #D$D$L$dL$$L$D$D$xD$D$D$$L$$L$ $$L$DL$$L$@$$!$$$L$L$L$$$$ D$D$D$$$$L$L$L$$$$D$D$D$$$$ L$L$L$g$$$D$D$D$EË$$$D$$D$$ D$ $D$$D$XËL$aD$L$TD$L$G    e $X;Av(|$P1J7|$0A7|$p87$,7|$#7$7L$P $$@T$$\$L$0 $$<T$$\$L$p $$8T$\$0\$$l$ aL$ $$8T$\$P\$1L$R@}rD$$$$$8L$L$PL$$$g$$D$L$L$$L$ $4$$<L$$@L$$4$ $4$D$$L$$4$D$L$0L$$4$$4$D$L$PL$$4$1L$p\$P@}rND$P$m$,$$L$$T$$,$D$L$PL$=$,$1L$p@}rD$p$D$$,L$D$p$D$0$D$$L$N1L$0@}rjD$0$$0$$L$L$pL$$L$ $0$D$L$0L$_$0$@(T M F ? hce ;av>D$ L$T$1,41!14C} r e D$;A|$|1M3|$\D3|$<;3$$$1@} rw$$18$T$L$\$ T$L$ND$|$L$\L$T$L$ T$$$  e ;avaD$T$ QJIˁH )щH فXʁHHى)HH)ىHH e ;aD$ L$T$11"|tl sB4<,t k r$t$| u Ye ;aD$ L$T$112|t)|5^ tl sP4<)4=^ <,t k r$t$'讆 视 ;e ;aX|$1 #L$`L$L$`L$T$d щL$T$hщL$ʁL$Zl|$`<lvlth6lTՁTAHLPI\$ hlXu u t`> щ ʁ tHm$D$T$ȉD$T$ȉD$TЉD$T1 T(T(ȍH/L"щL DPT щL HLLHLщLHLLjMLHGL !L L)щLL )L L )щL щL H L$V!щL$HTlTTDl TPgt$ TTTTT T uNt$ T T$t$!T$T )T T$l$ )T$T$l$ )T$P D$\11.ՁT}Hi s{l$ spi s\l(ՁQt( r-L$TщʁH $T$|XÍ\$    ށ ׁ Ё Ɂ  軁 贁 譁 要 蟁 蘁 葁 e $(;A< X$1$`$$A≄$ډ$A≄$΋Iȉ牔$$‰$ى$$щ$F ቄ$n׋V$剔$$‰$ٍ ;$Ջ$ڋ$щ$Fቄ$n$׋V $剔$$$‰$nʼn$ٍ ;$$݋$달$׋$ً$ω$$Fቄ$n$׋V$剔$$$‰$n$N $ȉ$$$׋$ڋ$ڋ$$ы$$$ʉ$$Fቄ$n$׋V$剔$$$‰$n$N$ȉ剔$$V $Ћ$剄$ȉ$ȋ$$׋$Ӌ$ڋ$$ы$$Ӌ$ڋ$$ʋ$$щ$Fቄ$n$׋V$剔$$$Љ$V$n$≔$$$Љ$V n$≔$$$Љ$$Ћ$Ӌ$ڋ$$ы$$ڋ$ڋ$$ʋ$ϋ$ً$щ$ F ቄ$n$׋V$剔$$$Љ$V$n$≔$$$Љ$V n$≔$$$Љ$V$$$Љ$$Ћ$Ӌ$ڋ$$ы$$ڋ$ڋ$$ʋ$$$$ы$‹$ʉ$NF ቄ$n$׋V$剔$$$Љ$V $n$≔$$$Љ$Vn$≔$$$Љ$$Ћ$Ӌ$ڋ$$ы$$ڋ$ڋ$$ʋ$$$ʉ$NF ቄ$n $׋V$剔$$$Љ$V$n$≔$$$Љ$V$Ћ$剔$$$Љ$ $Ћ$Ӌ$ڋ$$ы$$ڋ$ڋ$$ʉϋ$ً$ʉ$$N F ቄ$n$׋V$剔$$$Љ$Vn$≔$$$Љ$($Ћ$Ӌ$ڋ$$ы$$$ʉ$,NF ቄ$n׋V$剔$$$Љ$V$$$Љ$0$݋$달$Ћ$ً$‹$ʉ$4NF ቄ$n׋V$剔$$$Љ$8$닜$달$ى$<NF ቄ$n牔$$$Љ$@ߋ$달$ˉ$DNF ቄ$Hщ$LF $P$T$\ $|$$XRe $;A$1m$$≄$$Ciދlj؉lj$ Ӊ$F≔$$Yn㉔$$$ŋIʼn$$$׋$Ջ$׉$$F ≔$Ynlj㉔$$NjQn≔$$NjI lj$׋$Ӌ$$ڋ$݋$߉$ $F≔$$Y$n ㉔$$$ʼn$Q^≔$$ʼn$Q ^$؉≔$$ʼn$Iʼn$$$$׋$$ʋ$鋔$$ꋔ$ʋ$ˋ$ً$$ʋ$׉$($F≔$Ynlj㉔$$lj$Qn ≔$$lj$Q n≔$$NjQn≔$$lj$Ilj$,׋$Ӌ$$ڋ$$ˋ$ы$$ڋ$ʋ$͋$ы$ω$0$F≔$$Y$n㉔$$$ʼn$Q^≔$$艄$Q $^ $≔$$$‰$Yn㉔$$ʼn$Q$^$≔$$艄$I.ቄ$$ȉ$4Ћ$$ϋ$$鋌$ы$$ꋔ$ʋ$$͋$鋬$$ʋ$$ً$ы$$Ӌ$ڋ$$ʋ$Љ$8$F≔$Ynlj㉔$$Qn≔$$$艄$Q n≔$$$艄$Qn ≔$$$艄$Qn≔$$$艄$Qn≔$$$艄$Iቄ$$ȉ$<$Ћ$Ӌ$ϋ$ʋ$ً$$ڋ$ʋ$$ً$ы$$ڋ$ʋ$鋌$ы$ȉ$@$F ≔$$Yn㉔$$$艄$iV剔$$$艄$Q $n$≔$$$Љ$Qn≔$$$艄$Q$n $≔$$$Љ$Qn≔$$$艄$Q$n$≔$$$Љ$I ቄ$$ȉ$D$Ћ$ϋ$ʋ$ˋ$$ы$ً$$Ӌ$ڋ$$ʋ$$ً$ы$$Ӌ$ڋ$$ʋ$$ً$ы$$Ӌ$ڋ$$ʋ$Љ$H$QF ≔$Ynlj㉔$$Q n≔$$$艄$Qn≔$$$艄$Qn≔$$$艄$Qn ≔$$$艄$Qn≔$$$艄$I Vቄ$$ȉ$L$Ћ$Ӌ$ϋ$ʋ$ً$$ڋ$ʋ$$ً$ы$$ڋ$ʋ$鋌$ы$ȉ$P$QF ≔$$Y n㉔$$$艄$iV剔$$$艄$Q$n$≔$$$Љ$Qn≔$$$艄$Q$n $≔$$$Љ$I Vቄ$$ȉ$T$Ћ$ϋ$ʋ$ˋ$$ы$ً$$Ӌ$ڋ$$ʋ$$ً$ы$$Ӌ$ڋ$$ʋ$Љ$X$Q F ≔$Ynlj㉔$$Qn≔$$$艄$Qn≔$$$艄$Qn≔$$$艄$I V ቄ$$ȉ$\$Ћ$Ӌ$ϋ$ʋ$ً$$ڋ$ʋ$鋌$ы$ȉ$`$QF ≔$$Yn㉔$$$艄$iV剔$$$艄$Qn$≔$$$Љ$I Vቄ$$ȉ$d$Ћ$ϋ$ʋ$ˋ$$ы$ً$Ջ$ڋ$$ʋ$Љ$h$QF ≔$Ynlj㉔$$Qn≔$$$艄$I Vቄ$$ȉ$l$Ћ$Ӌ$ꋔ$ڋ$Љ$p$QF ≔$$Yn㉄$$艄$I nቄ$$ȉ$t/$Ћ$Ջ$Ӌ$؉$x$QF Y nlj$|ꉔ$I F ቄ$$$ $|$$onČ"e $8;AH|$L1Y|$(P$D$8|$p/$$#$$ L$L $$PT$L$L $$PT$L$"$t$LL$L $L$L$L $L$L$L $L$$T$$t$L=L$L $L$GL$L $L$7L$L $L$'L$L $L$L$L $L$$T$l|$pt$L1D$$D$L$D$D$$@|D$L$D$L$pL$%$$t$L1D$ D$L$D$D$ @|D$L$D$$$L$$t$L>1D$D$L$D$@D$@ |⍼$t$L D$L$D$$PL${1D$D$L$D$D$@=|D$($$L$$L$51D$D$($D$D$@|D$($D$$$L$1D$D$($D$pD$@|D$($D$L$pL$1D$ D$($D$6D$ @|D$($D$$L$D$($D$D$($D$D$($D$$L$FD$($D$D$($D$D$($D$$PL$ $L$D$(D$D$LD$H e ;avvD$ 11llm+ӁTڄ s<[ډӁt Q r$\$a^ Z^ ne ;aD$ 11)\Ӊށ\. sJډӁ+t Y r$T$] ] Re ;aD$ 11)\Ӊށ\. sJډӁ+t Y r$T$n\ \ Re D$;AQ|$x1\|$TS$G$;|$02|$ )L$x $$T$L$T $$T$$ $$T$\$T\$"L$0 $$T$\$x\$L$ $$T$T$xT$$ $T$0T$\$ \$$ $L$0 $$T$$T$L$0 $L$L$0 $L$T$TT$$ $L$0L$T$xT$$ $$ $$T$$ $L$$T$$ $L$$T$L$0 $$T$$T$vL$0 $$T$L$L$ $T$TT$'L$ $ $ $L$0L$L$ L$e $;A4|$01|$ $|$x$t$P$,$$|$Tv$jL$0 $$T$,$ $$T$T$~L$x $$T$T$0T$_L$ $$T$T$0T$@$ $$T$T$ T$$t $T$xT$$T$$P $$tT$T$$P $L$[$, $$tT$$P\$$ $$T$$T$1$ $L$L$jL$T $$T$$PT$H$ $$L$$tT$#$ $$T$$ $$T$$,T$$ $L$T$TT$y$ $L$T$TT$^$ $T$TT$$T$<$ $$T$$\$g$ $$T$$,T$B$ $L$$T$$ $L$$L$Ę:e $X;A@(|$x1y|$Tp|$0g|$ ^$PR$,F$:$.$"$$ $$t$$L$x $$@T$L$0 $$LT$$ $$8T$T$0T$$ $$@T$$L\$$ $L$+$ $L$T$xT$0$ $L$T$0T$L$ $$LT$T$0T$F$P $$<T$T$ T$$$ $$DT$T$xT$L$T $$@T$T$xT$$, $$HT$T$TT$$ $$T$$T$L$ $$T$T$~$ $L$$ $$T$$\$F$ $$,T$$PT$$ $L$L$ $ $$T$$T$$4 $$L$$T$$t $$T$6$, $$tT$$T$1$, $L$$T$$, $L$$T$$ $$T$$,T$$0 $$T$$\$$ $$PT$$T$$0 $L$$T$h$0 $L$$L$J(e ;av8D$L$T$ 1,41!1,C } rHR qe ;a@D$1A } rL$1B }  rT$(\$l$$t$ t$ 3! Ή4GMۇl$ u͋L$ }  w1,t$3! Ɖ4GMۇl$uŋD$ } sAw8T$zT$(s$|$1׉<$$ ׉ ׃W1kP P P P e ;akD$1A } r@L$ 1B }  rT$1C }  r\$l$EklL ! щ FL$ T$ } r1 EklT$! ‰FD$T$ }  rm1 E klDH! ȉFD$L$ }  r4w|$s"1މ4$$ މ ރ^1[tO mO fO _O XO QO zue D$;A$1$$|$h|$D$1@ }  r}$1B } rR$1C }  r'$1l$$$$$L$ۉ!ڍ@B` ډT$t$ t$l$$$L$hL$T$DT$$\$ $l$$t$$|$$T$i$$$L$T$,T$$$$L$T$,T$$$ ^ L$T$,T$$$$L$T$,ҋl$$MMl$ !T$0T$$$L$hL$T$0T$~$$L$DL$T$0T$_D$4x D$(t$ ӇދL$,!΋L$8$$$$l$8D$($ |$4)ol$<  t$,w_lT$<ѕ蕉 4薉    ,蕃 ՋT$({jE s]l$8u11|$(1%t$@ $D$T$L$ D$T$$$$$l$8t$@뫁sL lK eK ^K WK PK IK BK ke ;aT|$01|$ L$0 $T$hT$L$ $T$0T$[L$X $L$`L$L$ L$L$0 $L$T$ T$L$\ $L$dL$L$0L${TMe ;avw`|$81|$L$8 $T$T$\$d\$\$h\$ \$l\$L$8 $L$L$\T$$L$T$\T$pL$t`me $;A0$1F$:$.$"|$d|$@$󫍼$$$$$5^ g$D$D$8 $L$D$$D$ $D$$D$$L$\D$<kl  < `t$<$$$L$8kl`L$$\$l$L$ <D$HD$D$tFHT$Zj~\$,m sBle\$, s!DM(Ä s&C C C C :e ;a)(J$D$D$D$D$D$ D$$L$,Q T$D$$ (@(9S@,%^@0,@4+@8,Ł@<-ɼ@g j@;ʄ@ g@+@rn<@6_@:O@ т@$RQ@(l>+@,h@0kA@4ك@8y!~@<[{޺e ;a83$D$D$艍D$ L$L$ T$\$<i995P4 sL$ t$$l$T$, D$L$T$\$D$? T$@ È\$A T$B\$CQ Y$\$DD$E\$FD$G ՕD$H È\$I T$J\$KQ(Y,\$LD$M\$ND$O ՕD$P È\$Q ՕD$R\$SA0Q4T$T\$UT$V\$W ؈D$X T$Y ؈D$ZT$[A8I<L$\T$]L$^T$_ ЈD$` ˈ\$a ЈD$bL$c|$pt$$phø)кuF|B=w;T$l$L$D$D$ b0$hD$*   +e D$;A$1B p $_|$$5@6$ $$ $$T$$T$$T$ $ $t$|$DC$t$D3Ĉ72e $;A $ 1󫋔$Z*r ؋ZًZߋZ\$HZ\$DZ\$@Z$\$Ӊ$I׋T$ʋ$HPČ)݋IуPD$l$t1D$ $$$lL$|$$dT$x$$\\$t$$t$TD$p$$Ll$d$$Dt$h$$<|$\$$4l$`$$,L$X$$d$l$\$t$L$D$<$$ $T$$$ ދ$$ 1Ƌ$$ 1ދ$$!؋$!1ŋ$$!1D$$ډ$T$Љ$G|$ I$$$$$$ $ 1ʋ$ 1ы$$!Ћ$!1Nj$$!1D$Ë$$݋t$ˋ$$$$$$׉$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$$\$ P1$$$ Nj$$ 1$ $ 1щ$$$!Ӈ݋$!1Ή$$ $$ 1$$ 1Ћ$$!Ӈߋ$!1$|c -xc |$ 9D($Ջ@ȃP$$\$P$ىL$LL$|$L$H$|$tL$@L$lȉD$8$L$dȉD$0$L$\ȉD$(D$T‰T$$$ꋔ$$ꉔ$$݋$ދ\$|$닜$$달$$|$x$T$l׋T$p$$$T$d׋$|$h$ϋL$`$$Nj$|$X$$ǀ$ۇ$$ǀ$$$D$(D$\$L$0L$d$T$8T$ll$x$$\$h$\$@\$tL$L$l$P$$t$`$$t$Ht$|$$|$pT$$$$$\$X$|@T$T$$$$$$|1D$$|$+CKs D$|C{D$tCD$xCD$lC D$pC$D$dC(D$hC,D$\C0D$`C4S8D$XC<Č      e ;av4e vu e  e 襒e ;avE$D$D$D$ D$ D$$D$]D$L$D$(L$,De ;avE$ڻD$D$D$ D$ D$$D$D$L$D$(L$,e ;afD$L$ T$\$D$BL$PT$C1111D$HhȋL$Pt$hT$Ct$hl$H$9#$$t$$L$\$ tD$ L$(T$$\$l$t$|$L$hc CL$B\9ID$lD$pMD$lD$p$D$lD$ D$ L$DŽ$DŽ$DŽ$$$ĜË$9qu|$C8×u \$P9ED$tD$xD$tD$x$D$tD$$ D$ L$DŽ$DŽ$DŽ$$$ĜÃNwL$hu L$hyL$huDŽ$DŽ$DŽ$$$ĜÉ|$X$$$D$l$l$ D$D$TL$L$dT$T$`$1D$D$\11t$X|$h\$LC͉Ɖ׋D$\T$`ً\$TD$H9L$Ll$D$D$dD$\$L$ :D$L$T$$L$D$$D$ $L$$T$\$D\$|$\$讌D$8L$4T$<RL$`$L$d$L$T$$$ĜÉ$D$d$$$$ĜD$|DŽ$ KD$|DŽ$$D$|D$D$ L$DŽ$DŽ$DŽ$$$Ĝ\nGe $8;A(1H$蒆$8$<$@$0c$L$$PL$$TT$|$ D$ L$$d$\9$L$$PD$$TD$$h܊0D$$t'11ɋ$d$$$HDŽ$0DŽ$4ӹ$0DŽ$4$$0D$D$ L$댉$,D$P$PP $ҍD$ $(L$%$X$$\L$$`T$$d\$ D$ L$(T$$\$l$t$|$s%$$i2%$j%$$$$$\9}$9#$p9##$xd \$P9"wd 9trDŽ$DŽ$$DŽ$-$$D$D$L$ $$$$HÉ$$D$wd D$D$ d$L$$PD$$TD$D$ $$$$$$$HË$X$T$$`\$L$ D$ L$T$\$l$t$$|$(u!$$$\$Dl$LL$BT$HD$Tt$P4$$|$6D$L$ T$\$M 5 \$L l$D uu u$|T$p$i6ǸD$tl$t$hD$HT$T,9Og,9_,$`9P,$)։$ۇ!$$X<$ =xd L$P9xd 9wd 9xd 9awd 9rwd 9wd 9C$T߃Vum111҅t$$$HÉ$$$L$$PD$|$L$ $$$띀u 11DŽ$DŽ${$DŽ$$$D$D$ T$$$T1%DŽ$DŽ${$DŽ$$$D$D$ T$$$T1R$L$$PL$|$ED$ L$@| $ЋD$$ $D$HD$$D$D$L$T$ t#$$$$HÉ$$$L$$PD$$TD$T$y$$듋$ $D$HD$$D$wD$L$a$$$L$$PD$$TD$$$K$L$$PD$|$D$ L$ $ЋD$L$DŽ$DŽ$$HYT$D$ D$ L$kD$L$$$$$D$aD$ L$$$$$HÃL$p n2DŽ$DŽ$`&$L$tD$ L$$$;H$D$&$D$D$ D$D$L$DŽ$DŽ$$$$$D$HD$ L$11ۅt#$$$$HÉ$$$$L$$PD$$TD$T$ \$*$$$뒋$  $D$$D$\T$ D$L$\$[$  $D$$D$9D$L$\$T$ ($  $D$$D$fD$L$\$T$ txt@"$$ L$D$$D$ hj\$T$11$  $D$$D$ D$L$\$T$ x$$ L$D$$D$ i\$T$11AoT$$ 1 D$hXL$P\$hAd$$ЋD$L$h9D$PP,L$$$ҍ$$  $ tDŽ$DŽ$Q$DŽ$!$$D$D$ L$$$$$HËD$PHd$$ыD$^D$$L$$11ۋ$$$ |$lGÉ͉։$$$T$l\$dD$PHd$<$ыD$L$l9D$PP,L$$$ҍ$$ }D$luN$$xd 9u6$L$ xd D$AD$ tD$d$$$:$L$$PL$$TT$\$l\$ 蔴D$$L$$T$$$$,$\$h\$D$ wD$L$ $D$&$ $$}$$$D$$D$$ D$ L$HL$$T$\$d\$$$ |"D$4L$ g4e ;axd L$9Axd 9wd 9xd 9Bwd 9wd 9APT$$ЋD$w^t>vD$D$ D$$D$%D$D$ D$$D$%D$D$ D$$D$%Ãt@t uD$D$ D$$D$%D$D$ D$$D$%ËD$H(T$$ыD$L$@P $ЋD$D$@`L$ $ЋD$L$|wP95)Љ!t<1tD$D$ D$$D$%D$D$ D$$D$%É$WD$\$}pD$ 1D$D$ D$$D$%É $D$D$wd T$|D$ u L$뗍ya>XÀD$`T$dL$hV$D$`D$D$L$ $$DŽ$DŽ$Ĕ1G\$$T$  ($T$BD$Yu;D$t%@ $D$+LD$L$ D$L$` 멍|$9;u#e ;av>Yu;D$t%@ $D$LD$L$ D$L$B` ;멍|$9;u#e ;avTYuQD$ t;HX@ $\$L$D$ D$$D$D$(D$D$,D$u_ 듍|$ 9;u#e ;avDYuAD$t+H P@$D$T$L$ ݼD$D$L_ E룍|$9;u#e ;av@Yu=D$t'$D$D$D$D$D$ D$ 艬^ 맍|$9;u#e ;av0Yu-D$ t$D$D$^ y뷍|$ 9;uˉ#e ;avMYuJD$t4HP$T$L$D$ D$ D$$D$D$(D$^ 뚍|$9;u#e ;av=Yu:D$t$HP$L$T$脫D$ D$] 몍|$9;u#e ;av+D$$D$D$D$cD$ D$.e ;av,D$D$D$$D$D$ D$e ;avFYuCD$t-H$L$D$D$D$ D$ D$$D$裮z\ s롍|$9;u#e ;av6 Yu3D$t@ $D$軭D$D$ \ 뱍|$9;uʼn#e ;avMYuJD$t4HP$T$L$D$ D$ D$$D$D$(D$L[ 뚍|$9;u#e ;av=Yu:D$t$HP$L$T$脪D$ D$3[ ,몍|$9;u#e ;avMYuJD$t4HP$T$L$D$ D$ D$$D$D$(D$Z 뚍|$9;u#e ;av=Yu:D$t$HP$L$T$ԸD$ D$CZ <몍|$9;u#e ;avFYuCD$t-H$L$D$D$D$ D$ D$$D$蓨Y 롍|$9;u#e ;av6 Yu3D$tH$L$ D$D$ jY c뱍|$9;uʼn#e ;av+D$$D$D$D$ _D$ D$e ;av,D$D$D$$D$ D$ D$e ;avYD$$L$L$D$^D$ L$Q$D$(D$L$ $D$D$D$@e ;aD$T$9uxJX9ujJ Zhp 9t;1Ʉt1JX@R9t 1D$É$L$D$m D$ 1݉$L$t$R L$ D$T$11Qe ;av81L$ D$ T$‰$L$ L$D$ @|ۉL$1e ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$oD$ uD$ D$ ze ;av81L$ D$ T$‰$L$<L$D$ @|ۉL$Ae ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$D$ uD$ D$ ze ;aTe $AD$|$$1D$D$ fD$,nd D$$fD$Dnd D$.D;JJ$D$$D$D$e L$ uT nd m$D$v#D$L$ 0wd e u 4wd e Í=4wd =nd ze ;avBD$$L$L$D$L$ $D$D$HD$ D$e ;avcD$HT$(r9t+1Ʉt!JX9uJ @ 9D$11,$L$t$Z L$ D$T$薿e ;avOYuLD$ @IT$$T$T$(T$T$,T$ T$0T$$ыD$L$D$4L$8*똍|$ 9;u#e ;av?YuYu;D$@L$T$(T$T$,T$ $ЋD$L$ L$0D$4+멍|$9;u#e ;av7Yu4D$@L$T$$T$T$(T$ $D$ D$,»밍|$9;uĉ#e ;av&Yu#D$ @L$ $ЋD$D$s|$ 9;uՉ#e ;avFYuCD$@ L$ T$,T$T$0T$T$4T$ $ЋD$L$L$8D$<롍|$9;u#e ;avV YuSD$$@$L$(T$4T$T$8T$T$Yu;D$@L$T$,T$T$0T$ $ЋD$L$ L$4D$8멍|$9;u#e ;av7Yu4D$@L$T$(T$T$,T$ $D$ D$0貵밍|$9;uĉ#e ;av&Yu#D$ @L$ $ЋD$D$ c|$ 9;uՉ#e ;avFYuCD$@ L$ T$0T$T$4T$T$8T$ $ЋD$L$L$6dÉ$9D$L$D$ u D$hnd D$l$L$pL$\$t\$*D$ u D$hsD$pD$xD$|DŽ$5dËD$hE\e ;a(D$,@L$4L$L$8L$L$J$@mD$D$0$D$D$D$ L$0 $T$HT$D$D$0HPZLr-^ L مDQT )˅L$(3$T$T$jD$D$ L$ L$4T$T$$ D$ L$4T$$\$@$l$Dl$L$D$ T$T D$L$T$ D$8L$,D$4L$( !M!\$0$D$T$l$$l$ fD$0$T$HT$RD$VD$0D$LD$,D$PD$8D$TD$h1111l$8L$\4zROTr-^ *эT iL 9ED$(t$\$ L$$3$L$L$4mD$L$ T$T$0A\$l$$ 1FT$0)ݍU9} 9rOT$()ׅ890T$09$))!Ս)l$ 9D$,t$4L$<|$89t$|$l$D$$L$49T$09)ȉ)!ыT$<ыl$h9D$d9t $D$l$躸D$@D$DD$HD$LD$@$D$e ;avCD$H $L$腂D$D$ D$$L$ L$臝D$D$$se ;aXD$\HXJ$2D$L$\QY [ L$$nd D$\e L$ D$\HPL$ $T$J$R2D$L$\QY KL$$nd D$e L$ vD$\HPL$ $T$薒J$1D$L$\QY zKT$$L$Le L$ D$\H D$HD$LD$PD$THP BD$D$H$\$vD$ D$4L$\Q $T$T$>DD$L$T$ \$\K(C,e LS$#D$4$D$L$8L$D$ @L$\ˋKS 9 d S(k$p9Il$DD$ L$8J$0D$$D$8D$ nd L$MD$ @L$(T$D|e l$ lD$\Hl$,$L$ݐJ$/0D$L$49tuD$,QYh p99l$T$t$@9t4$\$|$~L$D$,HL$H e L$@HL$4e \$(l$D|tt$N|$ GGe *D$  $D$D$ 0x53Ty ץ $T$0T$D$M|$ GGe D$ $zD$D$ Px5Sx ץ $T$0T$D$^M|$ GGe .D$$ D$D$ ץ $T$0T$D$M|$ GGe D$$(L$L$y5*$xץ$D$0D$D$ L|$ GGe 9D$D$0nd $D$ie L$ nd $D$die L$ nd $D$"覼D$ L$ pwd e ktwd 4$D$%nD$ L$ hwd e #lwd 4$D$%6D$ L$ `wd e dwd $D$4D$ L$ Pwd e Twd z$D$ƻD$ L$ Hwd e uRLwd $D$蒻D$ L$ Xwd e u\wd e 4Í=\wd .p=Lwd !p맍=Twd pc=dwd p=lwd o=twd o=nd oA=nd oD$o=nd D$0oD$o2D$oD$yoLD$ koD$$]oPD$(OoD$,AoTWre ;avD$D$D$7We ;a(D$HD$DHP H H T$$xP@ $    L$$ ȉD$D$L$ T$PT$0\$,1;jT$l$ $D$|$t$ gD$ hL$D$T$0\$,}3}ۇ9t$ Vit$$|$L$0T$4\$4949l$( ։4$D$^ D$D$ 0D$0D$<L$T$ с ݁  ց  ډ   ́ щ    ց  ދL$(8  y Je ;avQD$ $BD$L$$cT$D$D$ L$APD$L$D$$L$((Je ;aD$t6  $D$D$L$ D$$D$(D$,L$0Í`$ D$D$$L$L$L$L$L$ L$ aD$$D$D$(D$,D$0gIBe ;av D$@Ie ;a$D$<L$0T$,\$89uCl$(E,$D$D$T$ L$L$4L$\$D$D$@D$ r$Ík9wV9„u 렉10$ȐD$# 0$D$  0$D$ 8He ;a$D$<L$0T$,\$89uCl$(E,$D$D$T$ L$L$4L$\$D$D$@D$ $Ík9wV9„u 렉10$D$# 0$ؐD$  0$АD$ 8Ge ;aD$t6  $D$D$ L$D$$D$(L$,D$0Í }$D$D$$L$L$D$T$ T$ D$ $L$QT$D$T$ Z\$ rD$ $L$L$L$L$L$ L$ ?aD$$D$D$(D$,D$0Fe ;av D$Ee ;a(D$@D$4D$0L$<9=AQ A A D$$yAI$    D$$ L$D$L$ T$,18\s\$t$ $D$l$|$ D$ XL$D$T$,}*l$ |*,*sr1?l$ ڀ+[l$\$$L$|$t$ vۃr 1;3[t$\$ $D$|$l$ D$ XL$D$T$,}1l$ **sr $D$D$L$ \$0 SKS ˆS ͕C ˆSK(ÍQ9wC9u"1   0$D$ 0$D$ 0$D${ Be ;a(D$@D$4D$0L$<9EAQ A A D$$yAI$    D$$ L$D$L$ T$,1?l$ k\$l$ $D$t$|$ D$ XL$D$T$,}3sۇރ~6ۃr1;ڈ3[t$\$$L$|$l$ D$ XD$L$T$,}1,l$ **sr 1;l$ ڋ+[l$\$ $D$t$|$ D$ XL$D$T$,}/sۇރ4~6ۃr $D$rD$L$ \$0 SKS ˆS ͕C ˆSK(ÍQ9wC9u"1ϻ Ȼ  0$D$ 0$D$m 0$D$S ?e ;av9e vu躾 e 蜭ge @?e ;av7 Yu4D$t$rD$L$L$D$  >밍|$9;uĉ#e ;a D$$H(P,I\$(\$\$,\$l$0l$ $ыD$$H T$T$(\$\$l$l$0p$I4$ыD$$H P$I X hpl$\$t$ $ыD$,L$9T$$Z j$[ t$0)Ɖt$ۇ!Ƌ|$(t$)L$L$L$ ,$ӋD$$H @$IT$(T$T$,T$T$0T$ $ыD$L$T$D$4L$8T$< r =e ;avID$ H(@,I T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$80=e ;av D$D$D$L$D$$L$(X8e ;aD$ H~$D$1 A}rD$L$T$ 11+<|$t$<<|$C‰}sj4t\؉׃t19rMD$(D$,D$0Í 0 $D$]D$ L$D$(L$,D$0   77e ;av*D$ $D$TD$ fǀ6e ;aD$0toL$$9L$ T$,9u2\$l$ $T$D$\$ D$Í\9wL9u믉1Í0$(D$ 0$ D$ 6.e ;av*e vu* e ]e 5̋|$t$l$D$\$|$ t1TLLTɊL2ɈFGL$ uϋL$L$e ;av+D$$D$D$D$蟽D$ D$5e ;av,D$D$D$$D$rD$ D$4e ;av7 Yu4D$t$D$L$L$D$ i b4밍|$9;uĉ#e ;av< d d v$ e u ,AB Íz ,AKԯ 3e ;ad3$D$D$`D$L$L$8T$ Y9R9J-D, l$huD$LD$LD$MD$ND$Oq9]9\$L\]D$@\$@D$A\$BD$CY 99t$@tuD$HD$HD$ID$JD$Kq9A=95\$H\ ] D$D\$DD$E\$FD$GY99t$DtuD$PD$PD$QD$RD$Sq9%9\$P\]}Tb@Y|$Xl99A99T$\D$&e ;aWx$1>L$|QXT$Y\\$ |$8^>D$8?8Ç݃8)Ճ@D$|$L$8L$l$D$ @D$ L$ L$8D$9L$:D$; ЈD$< ˈ\$= ЈD$>L$?D$|$L$8L$D$D$ @D$|HT|$$1c=L$|T$$\$%T$&\$'QT$(\$)T$*\$+QT$,\$-T$.\$/Q T$0\$1T$2\$3IL$4T$5L$6T$7$t$$Axýx)ՃuH|D@w?D$|$L$8L$l$D$ @_0$XD$胮 蜠 蕠 #e D$;A|$<$ @D$<$t$|$(@$HL$$$9wg$9T$ $؉$D$(D$D$B$$D$$$D$ $ĠÍ3$$\$D$T$ L$2T$\$$L$$cu "e ;al|$t1:D$$D$(L$pQXY\ ډT$ l$1Y{ȇۇ߉w !ىt$ ! ΃ ! D$Ct$ |$L$prQTT$Z\$1o|$1\$@sx)ՕD$Ӈ!Ç߃@T\$! T!8r,oȕgl,$t$! Շ݈\yt$oD$AD$h $D$D$@D$ @|$,1u9|$Tt$pK>D$1 D /M}mT$T!Ã|,Y!ƃ|$ \$,Dq!ǃDq|$ !ǃr_L$pT$1C@sC8s@4T)1kȕl,$@D1뷉 $D$hD$D$@D$ @s|$@t$pD=D$1\ /l$! ؈D /N}}T$@\$T,*! QseT$,\l$! ݕDYs<\l$! ݕDYj|$tt$,ω<$1!15yZt$X~ω|$1!12yZt$X~ω|$1!11yZt$X~ ω|$ 1!13yZt$X~ω|$1!10yZt$X~ω|$1!15yZt$X~ω|$1!12yZt$X~ω|$1!11yZt$X~ ω|$ 1!13yZt$X~$ω|$$1!10yZt$X~(ω|$(1!15yZt$X~,ω|$,1!12yZt$X~0ω|$01!11yZt$X~4ω|$41!13yZt$X~8ω|$81!10yZt$X~<ω|$<1!15yZ<$3|$43|$ 3|$lj<$1!12yZ|$3|$83|$$3|$ lj|$1!11yZ|$3|$<3|$(3|$lj|$1!13yZ|$ 3<$3|$,3|$lj|$ 1!10yZ|$3|$3|$03|$lj|$115n|$3|$3|$43|$lj|$112n|$3|$ 3|$83|$ lj|$111n|$3|$3|$<3|$$lj|$113n|$ 3|$3<$3|$(lj|$ 110n|$$3|$3|$3|$,lj|$$115n|$(3|$3|$3|$0lj|$(112n|$,3|$ 3|$ 3|$4lj|$,111n|$03|$$3|$3|$8lj|$0113n|$43|$(3|$3|$<lj|$4110n|$83|$,3|$3<$lj|$8115n|$<3|$03|$3|$lj|$<112n<$3|$43|$ 3|$lj<$111n|$3|$83|$$3|$ lj|$113n|$3|$<3|$(3|$lj|$110n|$ 3<$3|$,3|$lj|$ 115n|$3|$3|$03|$lj|$112n|$3|$3|$43|$lj|$111n|$3|$ 3|$83|$ lj|$113n|$3|$3|$<3|$$lj|$110n|$ 3|$3<$3|$(lj|$  !։! 5ܼ|$$3|$3|$3|$,lj|$$ !Ή! 2ܼ|$(3|$3|$3|$0lj|$( !މ! 1ܼ|$,3|$ 3|$ 3|$4lj|$, !Ɖ! 3ܼ|$03|$$3|$3|$8lj|$0 !! 0ܼ|$43|$(3|$3|$<lj|$4 !։! 5ܼ|$83|$,3|$3<$lj|$8 !Ή! 2ܼ|$<3|$03|$3|$lj|$< !މ! 1ܼ<$3|$43|$ 3|$lj<$ !Ɖ! 3ܼ|$3|$83|$$3|$ lj|$ !! 0ܼ|$3|$<3|$(3|$lj|$ !։! 5ܼ|$ 3<$3|$,3|$lj|$  !Ή! 2ܼ|$3|$3|$03|$lj|$ !މ! 1ܼ|$3|$3|$43|$lj|$ !Ɖ! 3ܼ|$3|$ 3|$83|$ lj|$ !! 0ܼ|$3|$3|$<3|$$lj|$ !։! 5ܼ|$ 3|$3<$3|$(lj|$  !Ή! 2ܼ|$$3|$3|$3|$,lj|$$ !މ! 1ܼ|$(3|$3|$3|$0lj|$( !Ɖ! 3ܼ|$,3|$ 3|$ 3|$4lj|$, !! 0ܼ|$03|$$3|$3|$8lj|$0115bʋ|$43|$(3|$3|$<lj|$4112bʋ|$83|$,3|$3<$lj|$8111bʋ|$<3|$03|$3|$lj|$<113bʋ<$3|$43|$ 3|$lj<$110bʋ|$3|$83|$$3|$ lj|$115bʋ|$3|$<3|$(3|$lj|$112bʋ|$ 3<$3|$,3|$lj|$ 111bʋ|$3|$3|$03|$lj|$113bʋ|$3|$3|$43|$lj|$110bʋ|$3|$ 3|$83|$ lj|$115bʋ|$3|$3|$<3|$$lj|$112bʋ|$ 3|$3<$3|$(lj|$ 111bʋ|$$3|$3|$3|$,lj|$$113bʋ|$(3|$3|$3|$0lj|$(110bʋ|$,3|$ 3|$ 3|$4lj|$,115bʋ|$03|$$3|$3|$8lj|$0112bʋ|$43|$(3|$3|$<lj|$4111bʋ|$83|$,3|$3<$lj|$8113bʋ|$<3|$03|$3|$lj|$<110bD$@\$DL$HT$Ll$Pt$X@;t$T|$`_OW o\e ;avw d d v_ e u> 0AJ d d v4 e u 4ABÍz4Ag&z0AW&蠊 虊 me ;ax3$D$D$liD$D$0L$ T$\$|klh99|5H4l$4D$hD$hD$iD$jD$kE9!9t$h4)sD$PD$PD$QD$RD$Su99D$PD CD$`D$`D$aD$bD$cE 9n9ft$`t s D$TD$TD$UD$VD$Wu9l9 D$TD CD$XD$XD$YD$ZD$[E99t$Xt sD$LD$LD$MD$ND$Ou9P^9VD$LD CD$dD$dD$eD$fD$gE99t$dt sD$\D$\D$]D$^D$_u 949D$\D C {`@z|$l\= 9b9ZL$pT$HT $D$|$*D$lL$4D`L$|+A`T$H9YdIh\$ L$L$p $D$T$D$L$T$$$$DŽ$DŽ$xÉD$t\$03$L$t$T$ \$ T$L$D$t\$0l$4|$l t$ 3$L$D$T$ t$L$T$\$|l$4t$ D$(3$L$t$T$ D$L$T$D$(\$|l$4t$<3$L$D$T$ t$UL$T$\$|l$4t$ 7 0 ) "     ~ (e ;a,D$$D$(D$@D$$L$%D$&L$'D$< L$( ӈ\$) ȈD$*T$+D$4HT$89w+\$0|[9wWl$(t$$4l\$DL$HT$L,ÉL$ 3$\$0\$D$T$ L$\$T$D$4L$ ~ e ;aD$HltM؞@|6@p0@ 9Y@1 @Xh@d@O@`@d@hg j@g@rn<@ :O@RQ@h@ك@[cNe ;av7  p$ D$D$$ D$D$D$ e ;av;  p$D$D$@l$D$D$D$ e ;avD$@lt D$D$ ke ;av D$@@e ;a$D$(HdT$0ʋhhPd݉hhH`X @iۇ݉ۇ!L 9dՉ\$ T$t$,9t $t$T$D$(H`T$щH`@L$09E)ыl$4)Չۇ!l$,@ ̓9t$4l$L$T$$T$L$t$ QD$L$9)\$4)!ڃD$Ѕ~1T$(Z @}?L$9t$D$L$=D$L$(A`D$0D$8D$<D$@$ù@뺉뤉$L$ L$D$@D$ @D$(@`T$ՉӋt$4ًT$,{ { z z e D$;A|$L$XD$L$t$|$,$$HL$($9wg$Y9QT$$$؉$D$,D$D$$$D$($D$$$Í3$$\$D$T$ L$\$T$$L$(c$H L$($9wg$9T$$$؉$D$,D$D$ %$$D$($D$$$Í3$$\$D$T$ L$T$\$$L$(cy y *e D$;A$1j$QhT$ Yd\$|$DDD$D?8Ç݃'8)݃um@d$$L$DL$l$D$ @?D$T$  ЉD$DT$ED$FT$G ʈT$H È\$I ʈT$JD$K$$L$DL$D$D$ @$H`|$$1=$T$$\$%T$&\$'QT$(\$)T$*\$+QT$,\$-T$.\$/Q T$0\$1T$2\$3QT$4\$5T$6\$7QT$8\$9T$:\$;QT$<\$=T$>\$?Qlt$t$$ĄËAD$@L$AD$BL$CŽx)݃uK|G@wB$$L$DL$l$D$ @$0$`D$ v u "e ;av4e vu:x e ,41e e $X;A*($0$4<$ 9)$$,E]_MOU W EG]_MOUWȉE_ËGØ/BOW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _FȉE_ËG ÑD7qO W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_FȉE_ËGOW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_F ȉE _ËGå۵OW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_FȉE_ Ë[V9 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_ FȉE_ËGYOW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_FȉE_ËGä?OW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_FȉEËG^OW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$GF ȉE _ËGØ؋OW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _F$ȉE$_ËG [O W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_F(ȉE(_ËGþ1$OW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_F,ȉE,_ËG} UOW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_F0ȉE0_ Ët]r 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_ F4ȉE4_ËGހOW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_F8ȉE8_ËGçܛOW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_F<ȉE<ËGtOW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$GE8 ]1ȉ1E$11]؉E@_ËGiOW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _E< ]1ȉ1E(11]؉ED_ËG ÆGO W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_E@ ] 1ȉ1E,11]؉EH_ËGƝOW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_ED ]1ȉ1E011] ؉EL_ËG̡ $OW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_EH ]1ȉ1E411]؉EP_ Ëo,- 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_ EL ]1ȉ1E811]؉ET_ËGêtJOW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_EP ]1ȉ1E<11]؉EX_ËGܩ\OW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_ET ] 1ȉ1E@11]؉E\ËGڈvOW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$GEX ]$1ȉ1ED11] ؉E`_ËGRQ>OW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _E\ ](1ȉ1EH11]$؉Ed_ËG m1O W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_E` ],1ȉ1EL11](؉Eh_ËG'OW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_Ed ]01ȉ1EP11],؉El_ËGYOW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_Eh ]41ȉ1ET11]0؉Ep_ Ë Ƌ 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_ El ]81ȉ1EX11]4؉Et_ËGGՋOW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_Ep ]<1ȉ1E\11]8؉Ex_ËGQcOW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_Et ]@1ȉ1E`11]<؉E|ËGg))OW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$GEx ]D1ȉ1Ed11]@؉_ËGÅ 'OW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _E| ]H1ȉ1Eh11]D؉_ËG 8!.O W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_ ]L1ȉ1El11]H؉_ËGm,MOW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_ ]P1ȉ1Ep11]L؉_ËG 8SOW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_ ]T1ȉ1Et11]P؉_ ËTs e 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_  ]X1ȉ1Ex11]T؉_ËGû jvOW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_ ]\1ȉ1E|11]X؉_ËG.OW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_ ]`1ȉ111]\؉ËGÅ,rOW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$G ]d1ȉ111]`؉_ËGá迢OW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _ ]h1ȉ111]d؉_ËG KfO W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_ ]l1ȉ111]h؉_ËGpK‹OW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_ ]p1ȉ111]l؉_ËGãQlNjOW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_ ]t1ȉ111]p؉_ Ëы 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_  ]x1ȉ111]t؉_ËG$֋OW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_ ]|1ȉ111]x؉_ËGÅ5OW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_ 1ȉ111]|؉ËGpjOW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$G 1ȉ111؉_ËGOW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _ 1ȉ111؉_ËG l7O W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_ 1ȉ111؉_ËGLwH'OW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_ 1ȉ111؉_ËGõ4OW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_ 1ȉ111؉_ Ëó 9 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_  1ȉ111؉_ËGJNOW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_ 1ȉ111؉_ËGOʜ[OW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_ 1ȉ111؉ËGo.hOW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$G 1ȉ111؉_ËGtOW 1ȋO#O1‹G#G1؉$$_#_ #O11ˋO#11Ë$$G _ 1ȉ111؉_ËG ocxO W 1ȋO #O1‹G #G1؉$$G_W# O#O11ˋW#O11Ë$$G_ 1ȉ111؉_ËGxȄOW 1ȋO#O 1‹G#G1؉$$GW#_ O#11ˋWO#O11Ë$$G_ 1ȉ111؉_ËGnjOW 1ȋO#O1‹G#G 1؉$$G_W#_ O#O11ˋWO#O11Ë$$_ 1ȉ111؉_ Ë 1ȋ#O1‹#G1؉$$G_W#_ O#O11ˋWO#O11Ë$$G_  1ȉ111؉_ËGlPOW 1ȋO#1‹G#G1؉$$G _W #_ O #O11ˋW O#O 11Ë$$G_ 1ȉ111؉_ËGOW 1ȋO#O1‹G#1؉$$G_W#_ O#O11ˋWO #O11Ë$$G_ 1ȉ111؉ËGxqƋOW 1ȋO#O1‹G#G1؉$$G_ W#_ O#O 11ˋWO#O11Ë$$G$,EE]__]MOOMU W W U EGGE]__]MOOMUWWU@;$ j(e ;av+D$$D$D$D$mVD$ D$Ne ;av,D$D$D$$D$m D$ D$e ;a$D$($L$,L$T$0T$D$ 6 D$D$,T$09L$ L$( $D$T$lD$ D$.D$L$T$\$ l$,9wjD$4T$8L$2D$L$%$$5$$c c c 2$kJЉD$AD$t$ $$ՋD$L$t$$Ë$@L$D$D$8$ɺD$ D$D$L$D$L$$蔾$@L$ T$\$L$T$\$ $ $ЋD$L$$$É$$Íx$kx$2xH$$$Ë$HL$ " $/ T$D$ 轾D$HD$L$$$$L$/ T$D$ D$L$uL$0T$,$$$1!1$$É$$0 0 e ;av>e vu:3 e  0gH-Te 軳e ;avBD$$L$L$D$D;D$ L$D $D$(D$D$We ;avsD$$L$L$D$@D$ tGD$H@T$Z@9u1HHZD@DRH9t 1D$É$L$T$D$ 11Ʋqe ;av< d d v$ e u  ABÍz AD. me ;av5D$#Eg@@ܺ@ vT2@P@T@Xe ;al3$D$D$\ɄD$ L$L$(T$Y9t9l-\,l$puD$LD$LD$MD$ND$Oq99 \$L\]D$D\$DD$E\$FD$GY 99t$DtuD$HD$HD$ID$JD$Kq9c_9W\$H\ ] D$P\$PD$Q\$RD$SY99t$Ptu}P@|$Tl99S9T$@D$dT$t$|$D$TL$(DTL$p+APyT$@9mYTIX- 5t$\l$`L$\D$]L$^D$_ ݕD$` L$a \$bL$cH9wI\$d9l$\t$`,t\$tL$xT$|DŽ$DŽ$lÉD$* 7* 0* )* "* * * * 6!e ;a$D$0}J$l|$G)e u?ypD$8|$<$Í?yFL$,md5u\PQY Y Y ӋT$(\$4kۇt)x1|)D) D) D) BC 0l$0}|0l0 l0 0 BC,t$0~|t t  B BKl$0@t$\$L$ l$9t$L$l$D$L$9)T$)!ЃL$ T\ \ \ \\$\\$ \L$(QT  l$ t$    AX)ЉAPD$8D$<$É@$`j|$G#e upD$8|$<$Í& ' & % % % e ;avW $iD$#Eg@@ܺ@ vT2@P@T@X `L$ D$袩e ;av D$耩e ;av D$@Pe ;a$D$(HTT$0ʋhXPT݉hXHPX@iۇ݉ۇ!L9dՉ\$ T$t$,9t $t$T$)D$(HPT$щHP@L$09E)ыl$4)Չۇ!l$,@ ̓9t$4l$L$T$$T$L$t$ qD$L$9)\$4)!ڃD$Ѕ~1T$(Z@}?L$9t$D$L$MD$L$(APD$0D$8D$<D$@$ù@뺉뤉$L$ L$D$@D$ @D$(@PT$ՉӋt$4ًT$,$ $ $ $ ,e D$;A|$8$D$8$t$|$(?$HL$$$9wg$9T$ $؉$D$(D$D$$$D$$$D$ $ĘÍ3$$\$D$T$ L$zT$\$$L$$c" e D$;ADŽ$DŽ$DŽ$DŽ$$QTT$YX\$ |$H1D$H?8Ç݃8)Ճ@$$L$HL$l$D$ @D$ T$ ‰T$$\$1Hqωًl$$ !߃ ! ! Շ݈\H@l$t$$r$$L$HL$D$D$ @Z$FPD$(D$,D$0D$4|$81 T+C}TL$8l(Uht$(T0Pst݈\0ݍhrV$t$(PĈýx)Ճug|c@w^$$L$HL$l$D$ @gsm f _ X 0$D$. 7  0  YTe D$;ADŽ$DŽ$DŽ$DŽ$|$,1bD$,#EgD$0D$4ܺD$8vT2D$|DŽ$DŽ$L$, $$T$$T$$T$ NL$, $t$|$ݿ$t$ͿĈYe ;av$$=e e ;av>e vu:! e ,r xe 軡̃l$t$ T$$<E]MU 9|$$\$L$T$ >1͍8xj!1Ջ~1ݍ:V!1͋~ 1ō9p $!1݋~ 1Ս;ν!1ŋ~1͍8|!1Ջ~1ݍ:*ƇG!1͋~ 1ō9F0!1݋~1Ս;F!1ŋ~ 1͍8ؘi!1Ջ~$1ݍ:D!1͋~( 1ō9[!1݋~,1Ս;\!1ŋ~01͍8"k!1Ջ~41ݍ:q!1͋~8 1ō9Cy!1݋~<1Ս;!I!1ŋ>ˋ~Ս8b%!߉ՇӇ! ~؍:@@!lj͇Ӈ! ~, 9QZ^&!׉݇Ӈ! >э;Ƕ!ωŇӇ! ~ˍ8]/։!߉ՇӇ! ~(؍:SD!lj͇Ӈ! ~< 9؉!׉݇Ӈ! ~э;!ωŇӇ! ~$ˍ8!!߉ՇӇ! ~8؍:7É!lj͇Ӈ! ~  9 !׉݇Ӈ! ~ э;ZE!ωŇӇ! ~4ˍ8㩉!߉ՇӇ! ~؍:!lj͇Ӈ! ~ 9og!׉݇Ӈ! ~0э;L*!ωŇӇ! >ˋ~͍8B9~ 11؍:q~,11 9"am~811э; 8~11ˍ8D꾤~11؍:K~11 9`K~(11э;p~411ˍ8~(>11؍:'~ 11 90ԋ~11э;~$11ˍ89ً~011؍:~<11 9|~11э;eVċ>11ˋ>1Ս8D") 1~1؍:*C 1~8 19# 1~1э;9 1~01ˍ8Y[e 1~ 1؍: 1~( 19} 1~1э;] 1~ 1ˍ8O~o 1~<1؍:, 1~ 19C 1~41э;N 1~1ˍ8~S 1~,1؍:5: 1~ 19* 1~$1э;ӆ 1>1$\$L$T$ @;t$l$E]MU e D$;A$$111B9_ލX)9eT$D[Nj\\$8~ĉD$X1D$@D$X`$t$T9L$H|5=n|$Pl$T# tUq9 \|됍&$T$L$D$ t$mT$D$L$p\$,l$T|$PȋL$H벍q9<@&$T$L$D$ t$mmT$D$L$p\$,l$T|$PȋL$HK9Çދ\$,B"?#uÇ&<wՃwŃ_>\Ht$"$L$L$l޺T$D$ ׏|$Ge ,&"$L$L$s޺T$D$ 莏|$Ge z"$L$L$z޺T$D$ E|$Ge u~{̺"$D$D$ >L$D$ |$G e uD$nd e Í胕=nd D$tٍ{̺gzzW%&G7>7s$'d)h!m}He ;avEYuBD$t,HP$L$T$D$ L$D$L$   }뢍|$9;u#e D$;AvKYuE$t,$L$|$$Ą |똍$9;u#e D$;AvYYuS$t:蕘$$T$|$$$Ĉ {늍$9;u#e ;a($D$D$D$D$D$ D$$L$ $L$0L$D$*D$ D$ J $D;D$$D$,D$D$D$D$0D$ 蠥D$D$4(/{Je ;a#dD$TD$XD$\D$`D$h$L$lL$>D$pHQYj\r=^ d1Ʌ4,wd (wd DŽ$DŽ$$$dËQ1Ʌ~HQ1Ʌ~HQ1Ʌ~u\$ 1111HD$(L$$T$D\$h$l$ll$T$L$ D$D$L$ D$HL$0D$T$L$DL$T$$T$\$(\$ D$\1~D$pHL$L$T $D$cD$pHL$L$T $QD$D$@ J $8D$L$pQ\$ $T$D$TD$VD$D$s u΀$D$L$\$ l$t$FƄ$t111Ѝ=d ŋ$k苬$닋$111111=d $k$111&D$|D$H$L$LT$HC($ЋD$L$d 9$L$d D$wD$ $D$@$L$DT$@CP$ЋD$O$D$8$L$D$t!D$($D$,D$3D$D$4$D$0L$,D$4$D$4$NOe ;a$D$D$D$ |$(W"IӃT$0tɃW_/9111ۅ|$,_We uitZL$4tOW9}1D$8$Å)‰W)Oe !؅u!eD$8$ɉ e댋|$,놅a)ˉ_)ʉW5e !u ډˉ2ƉdD$u D$8$Éȃw_oq9|مD$L$KщL$NL$\$ L$ $L$L$D$D$ t]T$rH\$K t'L$T9rA|$(>D$8$D$8$D$8$D$8$D$8$D$8$ 0$`D$   L`e ;avV|$OWl$9} 1D$ Å|+)O)W e !Ս+u!cj Ke ;avj|$O_}!11ɅtvFL$D$ D$ IOKOe  u b Kze ;av{|$OW}011Ʌt"vWvOA ‹D$fD$ D$ ÃWOe  u aE nJie ;a|$OW}=11Ʌt/vdv\Y ӃvKA ؋L$D$ D$ ÃWOe  u Ka IXe ;a|$O_}K11Ʌt=vrvjY ӃvYQ ڃvKA ЋL$D$ D$ Ã_Oe  u ` HJe ;a|$OWl$ 9}811Ʌt*11r< 9}9rCD$D$D$Å|4)W)Oe ! u_( ! JHUe ;a|$O_l$911Ʌ11j4 9||rOW/9}5111҅t%|$ WGe uD$É1_D$)ډW)ىO5e !ٍ)u Љ^D$D$Å|0)O)_ e !u 1^ ,Ge ;av,D$$D$D$D$D$ D$Fe ;av,D$$D$D$D$_D$ D$Fe ;av,D$$D$D$D$D$ D$=Fe ;a|$O_l$ 9}5111҅t%|$GWe uD$ÉY]D$Å|3)O)_5e !u ˉщ]e EYe ;a|$O_l$9}J11Ʌt99~1D$ T$9t$L$D$dD$ L$9D$$ÉD$$)_)Oe ! u^\DRe ;avD$D$De ;ae vu e _tci  $D$VD$L$ @( $ЋD$L$d e uH d $D$4Se L$u ,vd e Í=,vd H[=d 9[C e ;av>Yu;D$t%HP$L$T$D$ D$R KC멍|$9;u#e ;avGYuDD$t.HP$L$T$D$D$ [D$D$  B렍|$9;u#e D$;A$ $L$D$ D$ D$l$Q$T$D$} D$ D$h$Q ௷$T$T$D$D$DL$L$@T$ T$d $|$e L$lL$hO|$PL$@O L$DO e L$dO$$1Z  $T$$T$%$$$$PT$$D$LY\$( L$X-`&,$T$T$D$L$T$ \$$9D$8L$4T$\l$L9t$l$\$_`D$PL$  $T$XT$T$(T$ wQ|$D$4GD$8Ge u D$\D$\Xu$Q|$p1X  $T$T$pT$ D$p$nD$pL$tT$T@D$,Y\$ L$H-`&,$\$\$D$L$ T$\$ 9D$0L$`T$e ;avP 6$t!D$D$D$D$ D$L$$T$L$D$ I>e ;a D$$HT$(Z$j(\$l$ $L$GD$HL$D$T$(\$$1!t$nt$|$(D$$L$ȉ\$$9}24{ [9s7l$$T$nD$tD$, D$, D$, 9 b=e ;a,D$4]L$0 $D$D$<L$0QY \$ is9؍SQ |e T$4TB$J(R,D$L$T$ $DD$L$T$0RT$$D$L$ ,MD$PXj9ZXD$ ,ÉD$(`&$L$T$\$ l$D$L$T$|$(We u ʉzS\$l$t$ $`CD$L$T$0\$$L$D$ xLD$HXi9YXD$ T$4D$$`&$T$L$\$ l$D$L$T$|$$We u‰R‹D$4RЋT$4[௷$l$\$T$ t$}D$L$T$\$0Se uCˉŋD$ L$0{TR,Í0$D$f :Ze ;a"0D$D$LpD$P|$T<Í>sAD$LL$PT$TD$,tL$T량\$`l$8,$\$MD$tD$,׋L$`D$8o\$L$T$L$D$ ) c D$< c L$dC>$D$ ?D$ L$0D$xD$|L$xD$|D$xD$lL$<1ҋ\$,l$Tt$HVÉ͋D$lL$<9\$,T$Hl$T ЋY\$@ L$h $\$7,D$ L$T$\$t>D$,tL$T뛉T$\\$4$T$1D$tD$,׋L$\D$4kD$(L$P11l$DUL$PËD$(9T$D\$'ы@[$ӋD$L$$T$hT$\$@\$-l$ D$D$L$'D$L$ $L$(D$L$ T$\$t D$'_\$L$D$L$T$ ^D$tո4u L$TD$,D$L$DŽ$DŽ$ĈËD$LH ~$$DŽ$DŽ$ĈÅtDŽ$$$ĈËD$dL$ÃuB$yD$D$RD$(D$ D$,D$wD$L$D$0L$4ÍyD$0D$47Ã1u D$0D$45ÍRD$0D$4AÃtK $D$D$VD$(D$ D$,D$D$L$D$0L$4$zD$D$SD$(D$ D$,D$D$L$D$0L$4ÍhD$0D$4GaD$HD$D$ D$lD$L$D$`D$dL$hP̀ ƀ e ;aD$P\$ 9uk $T$1E4$9}=px 9se4/9s]<*! )!8ȗtD$D$D$ D$D$D$ D$D$D$ ~ &Ae ;aTD$d}D$X$L$\L$D$L$ T$L$$T$,D$`.\$dKػl$dD$`\$$l$lD$ L$T$T$$9\$t9D$(L$0\$,1t$ nt$(|$$D$,L$0\$,9}R4>v9l$ @L$D$ <$t$D$uD$hD$lD$pTD$hD$lD$pTD$hD$lD$pTËD$`D$4D$dD$8D$<D$@0$D$4D$D$L$ D$$D$XD$D$D$L$ T$X9D$L$<\$T9t $\$T$vD$LWHT$H\$Il$29J4t$@u t1FT$H9} uT$H밉L$ l$@t$<|$D$41D$D$4BT$HD$D$LT$9t݉\$(D$,1D$$D$, Ct$<\$$\$(\$$9}At9t$uރ t uԋL$ l$@t$<\$(|L$ l$@t$<\$(g9sKD$(tXL$ l$@CD$`DËT$HD$`DD$`DÉjNW GW p e ;aPc c ~nT$T1 l$ ˉL$ |$0U|$t$0HL$9t#K9|ʉ$D$L$D$XL$\PËD$L$L$XD$\PËT$TYe ;avF D$~|$D$L$L$D$ Í @c HD$L$ Se $(;AX$`1$\,c 0c -(c ލY-$L$D$,L$0D$,D$0$L$D$,L$0Z$L$D$,L$0$L$D$,L$0ZUe ;a,D$xD$|p$$lÍs>he ;a Dr$uD$D$8L$H $L$LL$L$PL$ L$ D$xD$L$ T$$XD$8HtHtLD$<D$@pD$$T$\$l$ L$IoD$L$T$\$xe uމˉ‹D$P늍L$xȍK9HK [T$DTT$HTe |uT$tT1D$t跱`'$l$\$T$ L$nD$L$T$\$xe uˉŋD$xgW$Y|$G0e u.*ڽDŽ$Xp$\$`PÍ*ڽDŽ$X$\$`PÍ$)YD$$$$$$T$L$ L$ D$\D$L$$T$ uT$QYL$xe uD$l͋$|$p1!ۍ$qX|$G0e u.ZڽDŽ$Xp$\$`PÍZڽïDŽ$X$\$`PÍ@p$WD$$$$$$T$L$ L$ D$U[D$$L$ T$m$H`'$L$L$jD$L$T$ \$xe $Q ~c1o D$xÉȉi֋Qϋ $9 @Tle ,u+$H9|D$ll$x$|$p1‹$JЉǍ7I$V|$G4e u.DŽ$Xp$\$`PÍ֭DŽ$X$\$`PÉ$L$D$hD$hc lc pc D$ L$T$ D$ul$x$|$pD$l o$UD$$$$$$T$L$ L$ D$YD$ L$$T$s $I~GL$h10ȉٍ$]$X$J$htH\$h9|1 $D$d$`$\$X$L$D$\c Xc `c L$ D$T$ D$$$p$t$xD$L$T$ D$xkt$|$9?ST2e مu9D$d$ωÉ謫߉t$`$0$L$\$T$ l$ohD$L$T$\$xe ut$`$ˉD$xZ6ۋ$X$`$\$T$L$Pc Hc Lc L$ T$D$Q D$u D$x$$x$t$pT$L$D$ 貚D$xjt$|$94JL1 e Ӆu:녉׉É`qt$`$0$\$T$L$ l$ gD$L$T$\$xe ut$`$ʉËD$xeۍ$7R|$G5e u.z DŽ$Xp$\$`PÍz 艩DŽ$X$\$`PÍ$L$$D$:D$lT$p$l$xp$T$\$L$ l$fD$L$T$\$xe u$|$pˉ‹D$l˨ۉ$$$|$t$蕫$$D$$D$q$T$P|$G'e u.bDŽ$Xp$\$`PÍbDŽ$X$\$`PDŽ$X$\$`PÍ}\ϧDŽ$X$\$`PÍ}T‰螧@{<菧W0׉ʼn|5O$ωʼneOωʼnLO ωʼn3t!De  ^  臏e ;a4$9OD$D$(L$8 $L$$L$@L$D$WD$ `c \c -Xc $$$11$D$@D$L$D$ uO4e $x;At $$gC$$D$$D$&D$L$T$  $$B $ЋD$L$$$1$ $T$D$D$ t$$gL$D$T$@$$E$ $$$D$D$XD$ $L$$T$$$$m$ 1#$$$Ћ$΋$$$Ģ$|$豢$$$Ƣ$1՝$$֋$(tU  ʉс€׉$,׃ $0$$?$$DŽ$(DŽ$4$$$)$$$$9 ɉ$T-e ׍$|誡$A9$ 訠D$|$$$$$8$,t$1胜$<$8tU  ىˁ׉$@À׃ $D$8?$8DŽ$<DŽ$H$$8٠$L$@Ơ$כ$P$LtU  ىˁ׉$TÀ׃ $X$L?$LDŽ$PDŽ$\$$L-$$5 $4$Ÿ$$d$$h$l$p$ҟ$$迟$$$$$$$ $$$AG$$D$D$ L$ $D$ҚD$L$ T$\$l$T$$$$$費D$$L$$P $\$$\$$\$ $ҋ$@D$D$D$ $ $ЋD$$L$$T$$$[$-,$$l$D$ L$L$D$$D$$D$$D$ $D$$D$$$$ЋD$$L$ T$0\$,l$(t6DŽ$TDŽ$XDŽ$\$`$dÉ$$<1x$<$$J$$$$$$$  $$<L$L$ T$$L$袘L$T$\$l$ ЋT$$T$X$\$`$dDŽ$TDŽ$XDŽ$\$`$dÍ$`詗 |c xc c $`$d$hDŽ$DŽ$DŽ$$ $$$  $$L$qL$ T$$L$}L$T$ \$l$t$$p$t$x$$Q$9MQ$k<e u$`d$|$$`D$h-,$D$L$\$ T$ERD$L$T$$$vDŽ$TDŽ$XDŽ$\$`$dÉ$ $T$$|D$̗1$$$DŽ$TDŽ$XDŽ$\$`$$dÍ$<|$G>e uDfEDŽ$TDŽ$XDŽ$\p$`$dÍfEa |ee ;a$`L$(9uxD$,PX@ -0t$09uCl$4um $T$\$D$ t$l$rD$L$ T$T$8D$/D$@N e u5 5t p$ e u BĬÍz薆Ǎ5t臆‰<$$D$D$ L$tR$tĬÉ e uB$$؍z'$$뻋$HP XL$\$ T$$ $$T$\$l\$vD$L$$ e zB$J$$L$ `ѥ $$T$^D$ HP\$$ks;\$`999l$\$)l$X4vۇ!,7l$T$l$Xl$ - ,$D$T$L$D$`$GD$\Ge u$ĬË$臄t$\T$@L$D$ $|$t$l$ \$DAl$|$$L$DT$@\$`t$\$H L$PPT$L@$௷$jl$l$h?D$D$4L$ L$tT$T$8௷$L$D$T$ $\$\$L\$l$Pl$D$LL$49(e \$t<$$$uD$$t$\$L$ D$8D$D$lD$D$$D$DL$ L$@T$T$x\$,l$($.-e ui^$D$`ѥ$$D$U`|$ D$@GL$DOe uT$x‹D$xq‹D$x譂ЋT$x⋼$藂늋$艂5e $u$$T$H L$TPT$H@D$|௷$jl$l$=D$D$D$L$T$$We u|$0͉ƋD$px拄$FĬЀ`&$)e L$u#$$$$$~   Ph[e ;atJZ jRt$xtDŽ$DŽ$tÉL$H$D$|D$$D$$D$ oD$HHPit$|$9+QPT2 ˋe u9뀉rt$(|$80$\$L$T$ l$LhD$D$xL$L$$$L$D$L$ D$x$L$$L$~D$9D$$'L$x.Pʉ$\$TD$L$\Q\$`9m$lt$$u-e <ȅu?L$x$l$Pt$L$$\$`T$\$T$T\$XD$x6w븍0$$l$L$\$ T$3D$L$\$QL$\]D$x$D$$$DŽ$DŽ$0$$D$D$L$ $$Ub$D$'$D$D$ D$D$L$DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$l$p$t0ÉÉL$xD$x$D$$$DŽ$DŽ$0$$D$D$L$ $$?$D$=$D$D$ D$D$L$DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$l$p$t0Ë@ $ЋD$L$$T$D$ D$ L$bD$D$|L$L$4$|$D$4Ge D$|DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$lp$p$t0ËD$|qsS$$$$ T$L$D$ ?cD$D$HL$$ $D$D$ L$$$L$HL$T$D$ DD$HD$H3$.Pʉ$\$OD$L$dQ\$h9s$lt$Hu<ȋ e uB$$l$Pt$L$\$h$T$d$T$T\$X{$r뵍0$$l$L$\$ T$.D$L$\$QL$dW$$D$H$DŽ$DŽ$0$$D$D$L$ $$`ý$D$.$D$D$ D$D$L$DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$l$p$t0ÉÉ$$$L$HL${FD$$$D$H$DŽ$DŽ$0$$D$6D$L$ $$`ý$D$.$D$D$ D$_D$L$DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$l$p$t0ËI$ыD$L$$T$D$ D$ L$]D$$L$L$,$G|$D$,Ge $DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$lp$p$t0Ë$nP$D$D$$ $XӃl$D$L$DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$l$p$t0$$$$ T$L$D$ YD$D$(L$L$t $D$D$L$ D$( L$t.Pʉ$\$ED$L$TQ\$X9Q$lt$(u<ȋ e u#L$tl$Pt$L$$D$t$iԍ0$$l$L$\$ T$%D$L$\$QL$TyD$t$D$($DŽ$DŽ$0$$D$D$L$ $$ $D$+$D$D$ D$׸D$L$DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$l$p$t0ÉʉL$t@ $ЋD$L$$T$D$ D$ L$UD$$L$L$0$|$D$0Ge $DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$lp$p$t0Ë$fP|b$D$'D$D$ D$жD$L$DŽ$@DŽ$DDŽ$HDŽ$LDŽ$PDŽ$TDŽ$XDŽ$\DŽ$`DŽ$dDŽ$hDŽ$l$p$t0É$@$D$H$L$P$T$$XD$d$\D$h$`$$dD$\$hD$`$lDŽ$pDŽ$t0 Me ;ae vu e BG( )TO*ih薋}'ba f#^9 r*e.Sֹt*$D$#VD$ L$ wd e wd r$D$D$L$ $L$}mD$D$ 4D$e O$D$2׮D$L$ wd e uT wd $D$6裮D$L$ wd e u wd e Í=wd =c=wd .c룍=wd !cKe ;av7 Yu4D$t$pD$L$L$D$ I BK밍|$9;uĉ#e ;av7 Yu4D$t$RpD$L$L$D$  J밍|$9;uĉ#e ;avBD$$L$L$D$D$ L$ $D$xD$D$wJe ;avVD$T$9u?JX9u1H @Z R9t 1D$É$D$\$D$ 11Je ;avLYuID$t3HX@ $L$\$D$ /D$L$D$ L$$ I뛍|$9;u#e ;av1Yu.D$ tgz$L$D$L$? 8I붍|$ 9;uʉ#e ;avBD$$L$L$D$oD$ L$ $D$ȉD$D$He ;avHD$T$9u1H@ZR9t 1D$É$D$\$qD$ 1aHe ;avEYuBD$t,P@ $T$D$/D$ L$D$L$  G뢍|$9;u#e ;av7 Yu4D$t$"xD$L$L$D$  G밍|$9;uĉ#e ;av>Yu;D$t%@ $D$4D$L$ D$L$2 +G멍|$9;u#e ;av1Yu.D$ t跆$L$D$L$ F붍|$ 9;uʉ#e ;avaD$$L$L$D$D$ L$Q$D$(D$L$ $D$D$D$ D$8Fe ;avcD$T$9uLHXjr9t1Ʉt@ J 9D$14$l$L$~L$ D$T$1Ee ;avLYuID$t3PX@ $T$\$D$ 0D$L$D$ L$$T ME뛍|$9;u#e ;avJD$$L$L$D$D$ L$ $D$D$`D$ D$De ;av&D$T$8uJ@9D$ 1De ;av: D$$L$L$GD$L$ $D$0D$D$ /De ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$ŁD$ 1݉4$T$l$誁L$ D$\$Cqe $;A/ $Qp y0Zۃ@ !ڍT0$9W ؋$ 9 $9 $$1$$>$|1$.E$$$$$ $9} tr> Qp)ډQp 1Z9 )މۇ!ދ$)ڋ$9 $ )݉ۇ!달$C $ $$$Ճ?T$|)Չ$?~>$S09l )!)@ 9t$D$|$0a$HPXhp $x$nd 33x$$1 nd 3щ$X1$$$12-by3x($1 2-by뉜$T1$$$1$te k3X,$ى$1 1te kΉ$P1$$1ً$$ 9 $$$$$$1$$F$$4$11 1$É$1$$ $ 닄$11 뉜$$1$‰$1$$,11 Љ$01$1$$$(ȋ$1$1 1111 t$,1T$1l$ $$$Ջ$11 Չl$$1\$1T$$0ʋ$1$1 ʉT$(1\$ 1L$$ȋ$1$1 11$D$,$4$L$ $ $$T$$$ $|\$$$tl$$$$$|$$t$lD$($,$dl$$$\L$ $t$$$$$($$ 8$$$$FN~ V$LV$HV$DV$$@V($<V,$8$BV $ꋬ$ 苬$鋬$l$`$\$t$$L\$x$$H\$p$$D\$l$$߉|$T$$@l$d$$<l$X$$8$$9L$\l$h)߉$ۇ!ߋ$$ϋ$9n0E@$@GA$4expa$39}$ nd 33y}$,2-by3y}$(te k3y } 3QU3AED$\3AED$`3AED$t3A E D$x3A$E$D$p3A(E(D$l3A,E,D$T3A0E0D$d3A4E4D$X3A8E8D$h3AD$ t9D$H@ T$ZR 9t 1D$É$L$\$ID$ 1$e ;av&D$1A } r{ e ;avD$$D$e ;av6D$L$T$ 1,4,C } r*{ Se ;av6D$L$T$ 1,4),C } rz e ;av+D$L$1 B } rz e ;avBD$ ؋L$T$1,41!1,,1,C }  r.z We D$;A$AQ Q Љ   к≔$$9$)\$qY$ Y$ \$0$$  qy$ y $ |$|$,t$0T$| ډT$xT$t|$0)߉|$0Y q t$p q t$l މt$(T$p|$l  Q y|$p y|$l ׉|$ |$$T$(\$h \$d\$`|$()|$(qt$\QY\$X Y\$T Ӊ\$\$T$\T$P T$LډT$H\$\)\$ qQT$\ QT$D T$\$\|$D  Yy|$\ IL$D ى $L$\$t$@ ։t$<Ήt$8L$)щL$\\]$달$$Ձ ËT$0)݉l$4\$t߁Ћ$$ T$ l$|t$xL$, ڋ\$(Ӊ\$()щL$,T$`Ձt$p|$l t$  |$h\$dL$$ ֋T$ T$ )L$$\$H݁t$X|$T t$ |$PT$LL$ ދT$T$)L$\$8݁t$\|$D 4$ |$@T$ FL$D9D$HD$4$VD$D$8L$\ $L$`L$L$dL$ @L$ D$YD$$L$ .D$8Q1҅J$U|$G6e upD$h|$l<Í@P1҅~D$D$4$D$PD$D$TD$D$XD$ L$D$e$U|$Ge uȼpD$h|$l<Íȼ肬t h^t L$hD$l<Í$T|$G.e upD$h|$l<ÍL$D9D$HD$,D$0D$0D$,$D$LD$D$PD$D$TD$ D$XD$D$\D$D$`D$D$dD$D$,D$ D$(L$$L$hD$l<Í$S|$G*e uKpD$h|$l<ÍK"$?S|$G e u޼pD$h|$l<Í޼襪e ;av5D$$D$ D$D$$D$ZD$ `ѭL$8D$<Ēe ;aD$ $D$$D$D$(D$[KD$ L$T$8t?$L$D$,D$D$0D$ D$4D$D$L$tIL$G r$$$HN G pe ;agdD$hL$xT$|1t1ΈLC9},s r&H PI\$l\$\$p\$\$t\$ D$D$ D$ $\$$\$ $\$$$\$($\$,$\$0$ыD$T$L$\$,E=d Éց |$85(袇D$8*e 1z1s1l1$1 ie ;a,D$D$ D$$D$(D$8D$D$T$($)ʉT$,D$0D$4D$8D$<$$$ЋD$HD$dL$@$T$DT$`$k$$4*t$m$HP$90)!)\$`9ً$9t$l$\$wL$`$J`L$dJd e J$B\$HX(jzq$t$|$$$`$|$l$$L$ T$\$I$T$D$l$|l$ T$D$l$$ы$PQH}X$$1Ƅ$Ƅ$ĸÉD$TY$$D$$L$"D$ L$T$D$p$$Y$h$ՋD$$ $$ЉD$Y$$)ȋ$Z*ry9VT$\$Q$$D$\D$X$9)ۇ!`9Xq0$y$y(q$q0y4$>vq89t7fq8A:A;AfNe ;aD$HT$9D$$D$D$ L$Q$\$)ډT$D$HPl$9wot$ >v))!9~:9t<$L$T$mD$HT$|+9w'PD$ D$ D$$ɉD$ D$$  Me ;avE$;ƺD$D$D$ L$$D$ L$}SD$L$D$0L$4dMe D$;A$$$09D$$ttT$PtL$HP\$T$`$/D$L$ L$D$D$H$D$ D$L$D$HH$u rz zrJ ϋ$Q"t A f9b |$(H \$ AT$D$`$>D$ L$D$L$D$H$L$(L$0L$ D$L$~$L$L $T$HT$T$0T$D$ L$e +$tD$DL$L $D$D$L$ T$XD$DH PX(9G)ʉ!ʉ4*)ˁ@t$@L$f[$džtLgTL$L e P@B4$D$ $ D$@ e uM &J p$e u$$ÍZaމǍ&JKa몍x;a.a>L$ ȱ$n D$@ e  F pH e T$ҍ_ څP$L$L0$e ueD$Dt e u*P$$ÍxJ`=`č0`딍x$"`XǍF`4$D$ :D$LL$ T$$e u .‰_L$Ld d e u Éw_4$D$ D$LL$ T$$e uD$D‰!_4$D$ PD$LL$ T$$e uD$DD‰^$8tV4$D$ D$LL$ T$$e uD$D‰g^uLu|+~V4$D$ oD$LL$ T$$e uD$Dc‰]D$L$:D$L$tmp9S $ $D$ D$LL$ T$$e uD$D‰e]D$L$Հ$8tNt?N$t2|$D$@D$\$|$ ~L$L$D$Db4$D$d+ D$LD$L$ $e u$$͉\؀r$8u* e uxL$L1x[\4$D$ D$LL$ T$$e uD$D‰\$$$D$ D$LD$ L$e $uET$Dje u$$Íx[ދT$DzƉf[Y[맋L$D\$Le $ubA,$T$] D$L$ $e u$$͉Z؍yZZ됋|$P‰Zd 9D$4L$ M$L$D$D$L$T$ uS$T$ e uD$4$$ÍD$4ZڋB $D$tD$4T$ 뿉D$W$pe u$$ÍRމǍ>WR뢀/$$V'D$&$$D$P$  $D$@9 e uU $*$pe u$$Í&RމǍ$*R뢋$$D$P?$  $HD$@" e uU K$pe u$$ÍQމǍKqQ뢉 $DD$D$ 蚶 蓵 茵 腵 9Ie ;a: D$(L$$Ɓ $D$T$D$ D$D$L$T$( ȱ$D$@ e u g4 pH e T$(ҍ_ څuDP$L$$ 0e uT$,D$0 ÍPx$ P믉Ǎg4OuD$,L$0 ÀdL$$ƁK8e ;aD$ D$$D$ L$ $}D$D$$WD$qu/D$$D$D$(D$L$ D$ L$$Ð7Ze ;a (D$,H$t D$8@(L$0uꋈ…!څ ʄ,(f1ɋT$4Mڋ$ =_\$$l$ T$L$`$l$\$D$tnD$L$)ȋL$,Ӄ!˅ ˄u=@~@D$8(D$8@(Í $D$ D$L$$L$MD$L$T$ tB $ЋD$L$)T`$D$ D$D$$D$D$L$ T$tKI$ыD$HЋL$!AL$)B $ЋL$D$,D$8@(Í0$ؑD$! j5e ;as,D$0T$8\$$9)9!l$ t$($D$4D$T$`TD$$L$0D$ e u&D$(D$8D$@D$DD$H,ÍD$( LӉL$ 3$t$L$l$ \$t$l$D$0L$ T$8\$$9PI,\$4\$\$8\$\$<\$ $ыD$L$0Ћl$t$߉D$@t$Dl$H,詰 3me ;aD$ (pm,\$T$L$ 4$ՋD$L$ ‹l$t$ljǁǁe u!ǁƁT$$l$(t$,Í1oJD$$D$(D$,2e ;a@D$XD$\D$`D$D L$< $D$D$8L$$RD$ ? tRu$"D$ ? $D$L$PQ fˆP ?nq$D$L$PQ fˆP >>wHt&$D$ p? $uD$ P?t&C\$JD$ ? $-D$ >$D$PD$<D$@D$DD$H`&$L$ L$褾D$L$ D$T$븋|$o0량$腤D$L$T$J e uBv|$;0hD$ D$$ÉT$ L$$ԟÐʟÍ0$D$ We ;al|$t10L$pQT$ $]L$ L$$ WL$艗O|$1O0L$p $L$L$L$pQdY`\$$T$(T$A fD$T$D$A,D$D$ A.fD$APQLYH\$,T$0D$4A\QTYXT$8\$e ;avD$D$D$ D$HL$ $[D$ D$$WD$谕u#D$H4P8@0D$L$T$ MÐCee ;aD$(D$,D$HL$ $"[D$D$$WD$bD$H$tD$D$HXtBHH@L.$D$ D$D$$D$4D$L$ L$(D$,^Í$|$G/e u `νpD$(|$,Í`ν<,ۍ$|$G)e u jpD$(|$,˛Íj+ۍ$<|$G3e u pD$(|$,{Í+ېdۏ e ;av&D$ $JBD$D$e ;a:hD$lH@u HLH4P011Cl59}d4ڋvt~$+|$Ge u"eD$ppD$t|$xhÍe*فfufL$ 3$D$ D$ D$ D$\L$L$D$\$$H $\D$\$D$PƀL$?%$$b D$L$$$3/D$L$D$P$$L$D$ D$ +D$L$iD$P@pH}$$L$D$ D$ 0D$L$D$P$D$ L$$HP\$Pk p xL|$LXH@Dy|$Hy|$DIL$XzJRL$ |$$T$(f,$t$D$\$ D$LD$D$XD$D$DD$D$HD$e L$,u?D$PHlL$?H, $D$3DŽ$DŽ$ĔËT$PzlY붉$$ĔÉ$$ĔÉ$$ĔÉ$$ĔÉ$$ĔË$$ D$L$B$$D$L$D$PH}$$L$D$ D$ .D$L$D$P$&D$L$ D$P@p$ $,D$L$uTD$P$$L$D$ D$ (D$L$$$ĔÉ$$ĔÉ$$ĔÉ$$ĔÉ$$ĔÉ$$ĔÍ{01l T$PZ$ku [ $$|$D$`D$$$ĔÉ$$ĔÉ$$ĔÉD$T\$@D$P$D$ $@ `׭ $D$D$@D$D$TD$ ?D$L$$$ĔË$}Ɖo9ˉ1$$ĔÉ$$Ĕe ;a$$D$(PY$R tf۽t fuf911ۄt f $D$FD$D$ D$(@@ fD$2$2D$ L$L$D$ ^$D$4D$D$D$ D$hD$L$L$,D$0$fQ @"D$,D$0$f9v ڻ5 ae ;aD$HPY0i,I(R(fT$ $l$\$軀e L$D$H uY$D$($豿|$G.e u½pD$|$ ͽ fH.D$D$ ËT$z q^ e $;A$h$$, $4D$L$ T$\$ ѭ9щ$($@$uju`$,$D$ jѭ$$(D$$D$$@D$ 蛔D$L$$$É$g$H$< $m$,H(HLPH QY $(um Euml$ t$D$ $\$T$;D$$,$D$L$ T$\$ ҭ9$HI8,$$*n$<$$H HPX$,M4]8 e U0,$HD$L$ T$\$$$$H I$,u f4$1֋D$L$׭$9,$$$$Zj2 $<$t$l$\$ $H$,Z$$u}jHBLED$\$t$|$ $D$$$ыD$L$' $,$D$L$ T$\$ `ҭ9 Љ$$ 115֭9 H $L$_3$D$D$fD$ L$T$$<$D$T$L$ tD$_ $@$,Q$$kqHyLL$ T$l$$ $ЋD$$L$ T$\$l$t$l $$$ty$FN>?$<$|$L$D$ $HX$,$D$T$\$ L$D$L$$t Q&$HP$,k p yYI$BJRD$ T$$L$(f,$t$$D$$D$ $D$\$|$$D$xD$4L$0T$,$KHCL-e kSDk$,~$u]mT$L$D$<$l$\$t$ D$ L$uX$<$A4A8e u$A0DŽ$DŽ$Íy01f׉$$$,$D$P$@$ $ЋD$L$$T$D$!L$ D$~D$D$|L$$$=|$D$|Ge u$$p$$Ë$׍{Dʼn$h1n$hb$,Q fˆ$t$Zj 5C4$l$\$̗L$T$ \$$$B $Ћ$HT$\$$$u$} m$A|$Ix$,@ fD$ $T$l$|$ t$L$$D$$D$[D$0L$,T$$\$&l$($ttf$v\$^$$$<$HLPH@DD$D$1^e ;a8L$DŽ$DŽ$ĨÉH3$L$L$qD$ L$T$!|$d_T$PXZÍiw W9~PD$\L$L9t$t$T$L$L|$dOT$PWe u D$\D$\k묉D$X\$lD$h$D$ 茟ԭ$D$dD$D$XD$D$lD$ mD$L$$$ĨÉӺo$$ĨÉ$$ĨS S @e ;a,D$0HIHL$$ $&D$ L$T$\$խ9uщT$ $|_D$0H $$D$ HP@ |$WO e L$$Q fW T$0Z f_ZLjHBDo_e uzGYPiLAHo _$e uNGATYXI\_,O0 e uG(zPD$4D$8,ÍO(gzP]ԍ_O륍_?v36L$(\$D$$$D$ Uխ$D$ D$D$D$D$(D$ kD$L$L$4D$8,ÉѺD$4L$8,D$4D$8,*e D$;A|$tm$L$lbT$O $D$T$OT$D$ D$D$L$$QR+$1$qt$p$u$QHYLIDL$4T$8\$<獴$KL$HT$D\$@$$$$$$~D$p$l$\$L$ $$$\$l$D$T$D$ L$D$L$uU$$$9~8$9t$D$L$DŽ$DŽ$Éĉ$$Ë$ 3 $D$D$D$L$T$ n$TZYӍh$$9~FD$TL$\T$d9t$t$|$&D$T$L$\$T$d$붍3$JL$L$SD$L$T$ $ZXӍi$$9~FD$XL$PT$h9t$|$t$w\$P$L$X$l$h$붍|$t1=L$lQ$$kr0Z4R8T$`M0U,m4T$ L$l$4$\$L$`L$[L$T$ D$$$\$l e D$t$PI$H $ND$t$2ID$ L$T$\$l$D$T$L$ D$ID$L$u $B$$Í1j$$bL [L TL ML vQe D$;A$$QY111 E΋$9}" +u@u ԉЉD$xP$R >D$/D$. q$趏D$xH$T$YI $\$Xl$.t$/1c$s T$lD$L$FNj8z4R0$|$l$\$ L$D$+ D$D$L@L$P9|D$<@L$T9$ $l$.$|$/\$Xt$x$D$<Ћ$$HL$HXR,L$<t BLpD$/t-ZLu%_,w(&T$l\$PD$\1D$LD$@@L$X9$0\$.$t$/l$.щNjD$x$$|$@$= e /׍$!JƋpL$T$D$d1D$։΋L$,CCACCACCuL$XT$H$l$DKG`W\T$D$D$t$D$DH$ы\$Hkt$|$ 9~V9t $|$t$]L$XT$H9l$D)͉ۇ!͉$.)ʋ$)릉 ݉ӉӋ$T$ ډ1511$$$                x q j c \ U N G @ 9 2 + $                       0$D$P* 號e ;adL$p*m|$hOT$tWe A\$lks fw G jo-e CGk& u'9A'8o jىo$-e C')T$t!T$@)GmL$pl$@4+L+ fO(L+O*G+G0G4L$tY,l$l5e o,G,l$`G8G@GD5e o<G<l$\GHG`5e o\vG\]pH4T t$lp9l$X)T$0)!Ս+ʼnˉх\$ti fl$"Qi ՍST$09l$,t$p\$DL$lL$"fEfuG89_D$xdf6fuڅL$lL D$t؍]9\$@T$*|$G1e u+Ƅ$p$$ĤÍ蓁ЋD$l$D$(1$)|$G8e u+#Ƅ$p$$ĤÍ#'Ћ$PZ,\$4R(T$` $El$ t$L$$T$4\$`Ƅ$DŽ$DŽ$ĤÉD$,T$\H$ыD$t%HFgEu 9u$@JD$l$D$P0D$,@L$\ $ЋD$L$DŽ$DŽ$$$$D$)$D$D$ D$D$L$Ƅ$$$ĤÉL$XT$0B $ЋD$tGH/u F9u$@/FgEu 9u$@ D$l$D$P/D$0@L$X $ЋD$L$DŽ$DŽ$$$O$D$&$D$D$ D$D$L$Ƅ$$$ĤÍy<~'L$tT$@D$l$D$P.Ƅ$D$@$D$t$ĤË${d~{,u~WJ$Y4y0I8|$ \$L$$t$l$訜D$ L$T$t $$kU`5e u.M\l$le u뾍}믍}\}ɍz`}VT$lMD$l$D$(-$&|$G<e u+ <Ƅ$p$$ĤÍ <Z}ЉD$tL$@D$l$D$P-Ƅ$D$@$D$t$ĤË@wd Dwd y|D$l$D$(%-$7%|$G5e u+< Ƅ$p$$ĤÍ< |1AL$ll$|D$D$L$D9}NfD$H1D$DD$Hr1$z4|$D$F`,DŽ$DŽ$$@@ fD$2$D$ L$$$T$D$B$D$D$ D$"D$L$Ƅ$$$Ĥf9v Ѻ,$0D$lH$Q$L$ $ ыD$L$ T$uD$l$kD$dDŽ$DŽ$DŽ$ %$$L$l$$$T$e uD$dL$lA$yL$ly$D$dzdL$hT$YTiPqLt$@l$D\$HY\iXq`l$L\$Pt$T$\$<\$_L$T$ \$l$t$L$0T$4\$8u|D$$$hD$`$ID$$$MD$L$T$ \$ $D$D$L$ T$D$L$t D$dL$h\D$dD$h\Él$dt$h\D$dD$h\?e D$;A($L$hbT$O $D$T$OT$D$ D$D$L$|$p1W$qt$l$|[$QPYLiT\$4T$8l$<獴$R[PL$@T$H\$DL$|$$L$tT$pl$x{D$l$T$L$l$ %HD$tL$pT$x\$h$D$L$D$ T$$D$L$ug$@ L$hfA.$L$|$9~8$9t$L$D$\DŽ$DŽ$ļÉĉ$$ļË$ 3 $D$D$ D$L$T$ 5$ZXӍi$|$|9~=D$\L$PT$`9t$|$t$3\D$PD$tT$\T$xL$`L$p뿍3$KL$L$iD$L$T$ $ZXӍit$|$9~=D$XL$TT$d9t$t$|$[L$TL$tl$Xl$xT$dT$p뿉$$ļ襷 螷 藷 萷 ;e D$;A$$$Y\$i`5e $AX௷$\$\$.D$D$dL$ $T$T$h$p$1$ ʼnΉ$t$TEMU$L$D$WD$ L$T$\$Tl$d94L$X5e $LDL$XK$9q$q$؋^D4$t$$W$$$$  $D$hH$щ$|$e 8$$_|$t$13R$Q$RH$$$VL$t$ ม $`L$c$DŽ$DŽ$L$dQT$p1.D$l$$$T$D$l@L$dT$p9|΋$ $|$$VHD$@L$DT$H\$8l$<W$iXA\-e -YTY$S(vT$d7$kT[Ptys/5 F9uLQLT$hQPe u.AH$$ DŽ$DŽ$ÍyHOˁFgEu 59t $D$+DŽ$DŽ$$HT@P$$g$D$G$D$D$ D$褟D$L$DŽ$DŽ$ $$ÉCDŽ$DŽ$ DŽ$DŽ$ËA\YXiTl$ \$D$$$$D$$D$ЋD$L$u $9$L$\$$D$*DŽ$DŽ$ D$\$$$ÍyTNL$`$$$D$*#D$`@$ $ЋD$L$$T$D$,L$ D$"e u.DDŽ$p$$ÍD@9fT$6\$5l$L$1:$QqI$$$$QqI$$$$$T$@$t$D$$fL$$l$$L$ D$D$L$(T$\$l$$t$ hT$T$t$X$D$LD$讻D$ L$T$5$Zl$HmT$\$$T$ T$TT$T$XT$L$D$$$ՋD$$L$ T$0\$,C$ЋD$L$$NT$D$&L$ D$&D$D$8L$$$|$D$8Ge u/$DŽ$p$$Ë$7̉D$<$`$\D$$$f3$D$@ T$$HP Xl$@9v)!<)달$mfAl$6f #l$6D Nl$<AэS9~F$9t $T$t$=$$DŽ$DŽ$É붉vȋL$@{ B51_Dwd @wd @$wD$L$LH 0DŽ$$$À!DŽ$$$Í$|$G=e u.\?DŽ$p$$Í\?T4͉x$:4DŽ$$$ËDwd @wd 6f $D$ L$T$$X($T$\$L$l$\$ D$L$ T$($\$$l$t$|$$rj -e uZzu,T$\$$T$D$L$ !L$T$DŽ$$$$É$j3$닋Dwd -@wd $@|$G/e u.νDŽ$p$$Íν2͍$|$G)e u.DŽ$p$$Í42E$$9}4j{PCTD$d1D$`D$d$Ӊʉ4 - &       %e ;a|$QY u?|wd xwd DŽ$DŽ$DŽ$$$|j9u$kfP!|$,11  $VL$L$x|$L11$QY IA؍J T$,9t$D$L$8$H@ }oT$L9t$D$L$o8D$x$L$LL$L$,L$c{D$x$DŽ$ DŽ$ DŽ$DŽ$|ù 늹 Vxwd |wd DŽ$DŽ$DŽ$$$|f,$_D$ L$T$$Xh @L$tT$($L$HD$CD$ t$D$L$T$(Z$$u }ml$ |$t$D$L$D$t$ӋD$D$lL$(IT$t$ыD$@ 3 $D$D$RD$D$ L$ L$pT$T$$\$l$^@D$L$T$ )9l$$)Շۇ!Ջ|$p)9~K9t ,$D$w6D$p$D$ $D$$$DŽ$DŽ$|É뱋xwd |wd DŽ$DŽ$DŽ$$$|D = 0$D$  E e D$;AM$QY S[ ڋ$fSiqI Y߃97fT$8t$HL$dVT$L)މt$@ۇ!)݃\$D\$8f ;x\$LXe PfT$d2t2 t$@ۇL$`|$@l$$$D$8H$$k [$\$l$|$ t$T$$$ыD$D$|L$8Q$$ҋD$@ 3 $D$D$D$D$0L$ $T$T$4\$|$4D$L$T$0)9^l$4)Շۇ!Ջ$)9~Y9t ,$D$ +D$8$$D$$D$$D$ L$D$T$0\$4$DŽ$DŽ$DŽ$DŽ$$$ĠËDwd @wd -$|$G&e uO5ODŽ$DŽ$DŽ$DŽ$p$$ĠÍ5O!7 0 ) 0$D$ 8 se ;a@D$h$D$PD$D$TD$D$XD$ D$D$ L$L$8P \$\\$l$`l$t$dt$ $ҋD$ HD$D$D$ T$8$ыD$L$T$1wD$ HT$8$ыD$ H T$$ $T$X$P\$t1t$,$T$X\$Tt$,\$tl$(t$,$D$L$3D$ L$T$\$D$`$P$X$Th0 t(p ]ύN9 )Ήt$4ۇ!l$4 1ɄL$(ipT$,9BD$8D$tD$TD$8T$,T$T\3e ʅut$4D$p0$\$t\$L$T$ l$诡D$L$T$iL$($Tt$4$PD$TD$pr$$ BJ$L$D$_=D$L$T$ T$PD$`HP@ $T$L$j D$L$T$\$ $$ D$PHP@TQi/5 F9 9 D$XT$\HZ\$ $D$$|$G*e u^ u|$h$ 1J$ 5`$\$  p$L$h$@Íu띋D$X@ L$\I L$$D$L$\$dDŽ$DŽ$@Í$|$G4e u^ *|$h$1f$5 $\$ p$L$h$@Í*#띺XFgEj9VF9> L$$D$$|$G*e u^ u|$h$1~$5$\$ p$L$h$@Íu;띍$苉|$G4e u^ *|$h$`1$`5$\$`o p$L$h$@Í*띺$|$G!e u^ |$h$P1X$P5$\$P p$L$h$@Í띾 Ƹ*L$L$1$5`h$\$U$L$L$@ÉL$H$01$05 $\$0$L$H$@É $s8D$l$L$ D$`$X$T$P14$,D$l$zD$ uD$`$P$X$TOD$`=D$(L$tQ $$D$,$DŽ$DŽ$@$$D$_D$ L$$$,$D$$D$D$ D$.D$L$L$ $1$5~$\$kD$ $$@É$*D$T$$D$ u D$(L$t$|$GIe u^ k|$h$1E$5$\$ p$L$h$@Ík띋L$tT$I|$G-e u^ |$h$1$5`@$\$- p$L$h$@Ík띋D$(L$tQ j9])!Ս+ r1҄$$D$,$D$xD$|@$$D$d]D$ L$L$xD$|Ց$D$uD$xD$D$ D$,D$L$L$$$1n$5 $\$D$$$$@Í$莃|$G|e u^ |$h$1$5$\$r p$L$h$@Í띉$,D$t$T$ D$(L$th1aL$t`$Ȃ|$G5e u^ q |$h$1-$5$\$ p$L$h$@Íq 3> ,? %? Ne ;aD$ $L$$L$T$(T$˓D$ L$uD$ $L$$L$T$(T$D$L$ T$tCQ_ u&F9uL$,D$0D$4D$8Áуu 9tҍ$V|$G6e u*D$,D$0pD$4|$8ÍыD$ $D$$D$D$(D$D$L$ tZ$Ԁ|$G e u*N޼D$,D$0pD$4|$8ÍN޼*эD$,L$0D$4D$8Í FL$,D$0D$4D$8_e ;aRЋD$ $$L$D$]D$ D$L$L$$D$L$ e uL$H `L$ D$$ÍxD$:!\e ;avB$D$hF߾e ;avB@$$D$%F蜾e ;avBJ@$D$ $E]e ;a8BD$4 3 $L$dT$X \$\$菑D$L$ T$\$X9݉D$(L$0T$,t$T9t $t$\$D$XL$(9)\$,)!؋\$0؋t$d9~pL$`9t$L$t$D$<$D$@D$D$DD$D$HD$ D$LD$D$PD$D$0D$D$(D$D$,D$ D$4D$$蔳8É댉݉.~: e ;axT$dB D$LJfL$2$ n%-jj$t $l/3$D$l$D$L$T$ \$dk4)t$4{99T$PD$8 $|$l$QD$dHL$HT$4\$Dht$89|$P9|$Pt$8$l$L$$$%T$H\$4T\$89l$P|$DL=D= L$49Z9 l$P\$8 * $D$t$rD$4L$8T$PD$4L$8T$P3$$\$\$譎D$D$t$Dt(耴D$8L$y|$(9;u#e ;avYYuVD$ t@D$$$D$(D$D$,D$D$0D$ D$4D$vD$L$D$8L$<% 谣뎍|$ 9;u#e ;a\Yt$`D$dD$D$hD$D$lD$D$pD$ D$tD$$D$xD$(D$|D$,$D$0$D$4$D$8$D$<$D$@$D$D$D$H$D$LtD$PL$TT$X$$$\$ 裢|$`9;#e ;av1Yu.t$t賿D$D$ ?$ 8붍|$9;uʉ#e ;av1Yu.D$ t$L$D$L$# ء붍|$ 9;uʉ#e ;av*Yu'D$t$D$ # 뽍|$9;uщ#e ;av*Yu'D$t$D$ 6# /뽍|$9;uщ#e ;aPYD$T@ $D$D$XD$D$\D$ D$`D$D$dD$D$hD$D$lD$D$pD$ D$tD$$D$xD$(D$|D$,$D$0$D$4$D$8$D$<$D$@D$DL$HT$L$$$P." '|$T9;#e ;av6 Yu3D$t@ $D$+D$D$ ! 賟뱍|$9;uʼn#e ;avBD$$L$L$D$ 'D$ L$ $D$D$D$Ge ;aveD$$L$L$D$ D$ t9D$H@ T$ZR 9t 1D$É$L$\$D$ 1Ğe ;av.n$D$D$D$D$ D${e ;av+D$ H߃^r 1D$É$}D$.e ;av?D$u D$ËL$ $D$lSD$ЧD$ D$ʝe D$;ADŽ$DŽ$DŽ$DŽ$$$$L$T$D$ D$_<$9-P9"D$|$D$$Ge u$$ϕ$T$~D$L$T$ $T$P"$$L$$T$T$HT$ 貎|$D$PGe u$($C$$TD$d$X$$\D$`$`$$dHDŽ$TDŽ$XDŽ$\$`$dH  0$pD$  0$hD$  0$`D$   |&e ;aA$D$($D$,D$D$D$ D$pD$L$L$ A$D$D$ L$tD$0D$4D$8$Ë=utf-uA8uՋD$ H@$L$D$ L$T$tD$0D$4D$8$ÉL$0D$4D$8$Ëus-arQsciicD$0D$4D$8$D$0D$4D$8$d{e ;avD$ $D$D${e ;aD$$L$L$lST$ɄD$ tWt/|uL$9wmT$T$D$ )!ЉD$$\$(D$D$ D$D$$D$D$(ËD$D$D$D$ D$$D$(  Iz4e ;at$D$\$HD$xT$(l$$|$#붉 $D$pD$L$ D$`L$dd $0D$L$`L$D$ L$09uID$|$p11D$8$t$l$\$ qD$L$D$XL$\d $0D$L$XL$}D$ L$09uID$|$p1109uID$|$p $D$'D$6 hZe D$;AmDŽ$DŽ$$$$L$D$L$ T$\$l$D$8L$ T$<$1필$$$$ $$T$nD$ D$,L$L$@$T$p$T$t$T$h$\$l-0,$t$pt$kD$ D$DL$L$40$\$h\$ED$ L$L$ D$Пd $D$4D$D$DD$D$@D$`L$,L$d$T$X$T$\0$\$`\$D$D$4L$ L$D0$\$X\$D$L$ D$ L$d $D$4D$D$DD$w e $i e D$$WD$YD$v#vD$hL$dd 9tD$dL$hu |tt>@9 $D$d D$軫D$ t11ƐFtÐKD$L$ T$'D$PD$TD$XT$\\$`DÅt tuT$Pt$Tl$XL$\D$`DÍ\$TD$L$0T$,Pe u\$e ;ae<111D$ L$8T$$\$@$D$L$T$ \$(.PI\$ kt$$97D$8lM e ؅uw߉ʼnYUaT$0L$(0$L$8L$\$t$ l$D$L$t$iL$(T$0\$ 놋D$8D$DD$ D$HD$$D$LT$P\$T<ÉHd 9uˉT$,\$4$\$d D$D$ tȍd ̍d 떋\$4T$,={e ;a|$$D$/111ۉL$hT$(\$,-࠲,$D$D$D$ D$T$$D$,D$ L$T$D$,L$(T$hg~h9t tl$49\$H$D$l$HD$L$ D$hL$(T$,ÉЉډD$,L$(T$h$$;D$L$T$ \$l$2D$`L$@T$4\$0l$X,$\$T$D$ :{D$L$0T$X T$HB\$Xl$0B9}4 tꖀ t9D$8L$\$D$4)Љ!؉D$)Չl$L$ BD$D$$L$L$L࠲$\$T\$l$\l$t$8t$ DD$H@X9T$d\$HL$Dlt$$u-e <…D$L࠲$L$TL$T$\T$T$8T$ +K|$D$HGD$DGe uFD$dD$(L$hT$,\$@u Éȉ.D$T$$D$`$|ËD$dQ뵋D$LuQ_D$ -0,$T$D$L$ \$>T$D$L$XD$ \$(L$$|$hOL$,IL$,L$P-e umD$L࠲$L$TL$T$\T$T$8T$ J|$GGe uD$h\$(CL$PT$,D$hPD$LP$(D$D$D$XD$ D$0D$>D$L$L$lD$p$$D$lD$D$ L$T$T$$$|ËT$T$$$|Å $$ D$L$T$\$tT$T$$$|$'D$D$$\$ T$=D$L$L$tD$x$$D$tD$D$ L$T$T$$$|À F2D$< 0 $D$w \$L$ T$D$<= 6 / ( ! J7Ee ;a,D$0 $D$A'D$0H+H$L$!'D$L$T$ 1(l$$])l$ )ʼnۇ!l$(ʼnʉ~ET$L$(D$ \$$ $T$D$D$ vD$| @L$9v D$$D$4,É\$4,D$4,' P6 e ;aAXD$`L$\1һ B-9,=^ 47tazvVuArZwT$$L$D$g>D$L$T$ $L$D$D$L$ L$dD$hXÍT$8$L$D$#>D$L$T$ $L$D$gD$L$ L$dD$hXÄaL$dD$hXÍ=^ 1&L$dD$hX° 軰 4e ;aOD$ L$1B9}X}E%-^ \u$L$D$D$$D$ ;D$L$D$(L$,Í-^ 11һ B-9}M,tar:zw ]9rt9‰ArZw 999߄׍"$xud T$L$D$ =D$@t L$(D$,$D$D$D$ D$D$$D$ ;D$L$L$(D$,D = f3e $(;AX|$ 5`]M1L$A'}]D$L T$IL$"$-xud l$T$L$ C|$D$Ge uD$뢋D$CJ뗁X2Pe ;a,D$D$ D$$D$(D$0L$ `& $D$ L$L$D$ D$0D$0$D$L$ D$$L$(Tݺ$D$D$D$D$ D$HD$L$L$4D$8,1*e ;avD$D$ D$D$1e ;aD$L$HЅ~ uLuH~T uuL$ D$À u uۀ Ӏ u뭀 u례 0Oe ;ae vu e ˆmMȬ質DIXL`5e $u xud e Í=xud G>0Ye ;avGYuDD$t.$D$D$D$ D$D$$D$ D$(D$ٱ /렍|$9;u#e ;av7 Yu4D$t$D$D$D$D$ y r/밍|$9;uĉ#e ;avGYuDD$t.$D$D$D$ D$D$L$ L$$D$(  /렍|$9;u#e ;avGYuDD$t.$D$D$D$ D$D$$D$ D$(D$虰 .렍|$9;u#e ;avBD$$L$L$D$϶D$ L$ $D$(oD$D$'.e ;avHD$T$9u1H@ZR9t 1D$É$D$\$kD$ 1-e ;av>Yu;D$t%H$L$D$L$ D$L$b [-멍|$9;u#e ;av81L$ D$ T$‰$L$mL$D$ @'|ۉL$,e ;avkD$L$1\$S\$l$؉'};Ѝ,ыum{9uT$$l$|$~jD$ uD$ D$ ^,ye ;a$D$(HЀ HHwD$,D$0D$4$D$D$ 3L$ _ ȉD$ Vn$D$(D$D$D$ D$蠓D$L$D$,L$0D$4$ÃɈD$,D$0D$4$ÈL$,D$0D$4$O+e ;aD$D$ $D$L$T$ uXL$D$@$D$L$T$ tD$$L$(T$,L$ L$$D$(D$,D$$D$(T$,Ëȍd ̍d D$$D$(L$,o**e ;av"D$HwD$à t tD$'*e ;a-dL$hT$l\$pl$t1 ݉ˋL$hl$t\$pT$lD$4qqY L$D = up MыT$hjrϋJ Mjnj5e ۇuJ L$pIhV|$DƉ@ހ t tsY^uD$HD$L3D$H _ ȉD$Ln$D$6D$HD$D$ D$D$L$T$4T$xD$|$dÍG؉$FD$L$AD$ L$T$tN\$hk s|(m t tD$4T$ll$t=D$4D$xL$|$dËL$hQYi QSQe uQ T$ll$tD$42|$DÉI?܋\$hs{$D$ "D$L$T$ \$l$t$hV^e CF N~|$@ e nN$L$\$Lc Pc Hc T$ D$L$zD$D$"L$hQY i$l$T$8c e D$;AD$8$D$D$$D$ $D$̝D$D$:D$ L$L$D$$D$ D$XL$L$(T$T$, M$xD$D$d$ e $H $AD$D$\ 3 $D$D$+D$ L$L$$T$|$h1)\$hT$lD$$D$ppD$tD$dD$xDŽ$DŽ$e Q|$\t$h-D$,|L$(QfXt$XCT$4l$0\$`$Ye |$L$\GL$,Oe D$XG T$4WO e ulGW(L$0O,e u?D$`G$T$(W4O8 e uG0$ĔÍO0X'W$׉ËD$`B'벍O2'뇍W ׉ËD$X'WD$\ '& $D$\D$L$hL$)x$&   6e ;aD$ H PuePI\$$\$\$(\$\$,\$ $ыD$L$T$\$ K-e uS D$0L$4T$8Í{ É(&D$0T$4L$8Ve ;ad"$D$4  $-e |$LD$4D$hG|$$<$bD$L$ PD$$H e x|$0@ $ :L$D$D$L$ tD$$D$lD$pD$tdÉ $ L$D$KD$ tŋD$$ $ :L$D$D$$HPP98ˉ\$,T$uki|`L$  $e |$u5L$  T$$J e uz1|$0j$!D$ \$ƍ $D$D$( 3 $D$D$D$ L$L$T$|$81$\$8T$sfT$$ uT$P! t t t-tދT$PD$4L$(ǀ   貀  e ;avA c c $L$0D$D$$D$ AbD$(D$, he ;a~`D$dH[H4P0u f--1D$dL$$D$ rD$D$,L$T$ T$ \$l$l$$5d 9L$d $D$T$l$ D$D$d$L$,L$T$ T$\$$\$ D$D$L$dQ?A QYD$ T$\$D$,$T$ T$\$$\$?D$tL$dD$,D$TD$ D$XD$$D$\D$4D$8$D$TD$D$L$ D$4L$8l$D$(D$4D$D$ D$iD$L$D$hD$lL$p`$D$,D$D$ D$D$$D$ D$L$D$$D$$D$D$(D$D$,D$ D$L$T$L$0D$4T$8Ig B됍|$ 9;u#e ;av7 Yu4D$t$D$L$D$L$ f 밍|$9;uĉ#e ;av'D$D$D$D$D$He ;av'D$D$D$D$ D$$JRe ;av/D$D$D$D$D$D$ I e ;avD$D$D$D$ Ke ;av: D$$L$L$W'D$L$ $D$@'D$D$ oe ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$-D$ 1݉$L$l$-L$ D$\$qe ;av81L$ D$ T$‰$L$\&L$D$ @|ۉL$e ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$,D$ uD$ D$ ze ;avrD$HPt7@|L9wH$T$D$L$ D$L$D$ L$$ËP@|9wL$ D$$5^ .^ Wre ;aDL$LT$H\$|$,1L$4T$,l$Ll$0/ED$8L$4t$@9u1/D$@@D$@9L4/u@䖀.u&x9uT/uT$H斀.@P9T$Ht.p9D$@9~XHD$@ HD$@\$D$@9~|$4\$8t9/u\$=\$,|$09kـ/tىt$(~-L$4D$8L$4|$@9*9/D$@@D$@D$4D$8L$4|$@99.D$@@D$@D$4t*D$8L$4|$@99.D$@@D$@L$@ED$@L$0|$,9}<.u@D$@ύ3$L$L$ D$L$T$ D$8L$8ؗu NL$@녍3$L$L$rD$L$T$ D$8L$P 7Q `e ;a D$4L$$L 9D < 9))Ӊ!ꉱL Y$\$(\$\$,\$\$0\$ D$T$D$|$BD$$@L$8D$< É111D$8D$< @P ie ;a%8D$<8 H L$D)ًl$H)݇ۇ!l$@단< @ 9xL$(9t,$\$L$AD$(L$ \$<1 Ul$<99ƋD < 99 ))׉|$ۇ!x~t$\$p4+4 9|}D$H$$$lËD$H99L$DD$"D$()Љ!؉$)։t$l$l$hl$ t$8t$|$,|$t$D$L$D9~iL$tT$@)ыl$49}E4|$$9l$dt5D$LD$#D$Ll$<|$#L$Ht$$ʉT$t\$@)ځ~ډl$d|$$t$"L$HD$D륋T$@\$tl$d|$$t$"L$HD$D놋D$H|$#5J .K 'J K J K ;&e ;aD$H $L$L$D$;<D$Ht \$$T$(É $D$D$D$D$D$ D$ 0D$@L$$D$(_e ;aD$ |zL$QY Y  ڋ\$vbi꽧5t$.h,$iս5G$,$9}o9sl 9rÃH H H Ae ;av\D$|ML$ 9wEL$9w6L$T$1C9},s48؇ݖt\$ ÉD$ 2H +I $I Me ;a(D$,H P(mxD < `9X$\$L$T$ D$L$T$,p e ut ǂH B,$S)(Ít ڋD < 9h,$D$\$L$ T$ID$,Hp e u t zt (ËT \ < D W9Ox,<$T$D$\$ l$L$t$D$$L$T$ \$,X \ -e T H )9~|D < 9S$D$L$|$ D$qHL$,Qp e ut ǁH (Ít o勫< D |K9wG[L$T$D$ $D$l$|$t$!={T ʼn(]F VF OF HF AF j%e ;a 4D$8H 8 )с} H(Kl 8 9}a< D j99)!\l l   iɽ5h 8 B8 8 9l 9}ۋD < r99)!\t t T iҽ5h 8 l444 8 \4GHuƀP ǀ` \ X T @8 H 9C)ʁ}X(=l 9D < q99)!\)t) t)  ) iɽ5h \4X08 44 8 \4` d ǀ` ǀd 8 }1L$$x0+4 9|/\$ pt{u9~ p9dP` \ X T s` d 9HSX ?T` X98 ы8 B8 48 l$$\$T$L$ ]D$L$T$8p e ut uǂX 4Ít ڋ8 Ly8  8 l 9jD < L99)݇ۇ!L5T5 T5 L5 iɽ5h |$0`$l$\$T$ t$D$L$T$\$8\ e uT |$0ˉŋD$8L$$[T ދ\ X T } ?9UX L$$&L$,`$t$l$T$ |$vD$L$T$\$8\ e uT ͉Ɖ؋L$,뗍T Iu$` 9 Wl8 YP@ < 9X T r\ 9rX \\ X T @t(8 A8 HWƀP Kl$\$T$ $AL$D$L$T$8p e ut uǂX 닃4Ít ݉\$,L$(`$l$T$|$ t$D$L$T$\$8\ e uT \$,ʉŋD$8L$(T މP o|$$l$D$ T$D$L$T$tT$8` d ЋL$$\$ PT$8P tM@ < i95X T r\ L9ZX LƀP \ X T 4Ë8 l$$\$T$L$ D$L$T$8p e ut u ǂX 묃4Ít g߉L$,`$l$T$|$ t$3D$L$T$\$8\ e uT ʉʼn؋L$,T 4H< A= := 3= ,< 0$xD$J = 4e ;avxD$@ D < H 9wL))!Ս+\$9~2\$ L$9t$L$\$7D$ L$H D$$Éh< 葿le ;aD$H ~XuaD < 9w[$\$L$T$ D$L$T$p e ut ǂH Ít pP(u; ؾSe ;aD$H D @ < 9}X(tu|j9wfX$D$l$L$ T$<D$Hp e ut ǀH Ít : 8e ;aD$t p L$(T$$\$ ʉËD$L$(T$\$ P$$ ыD$P $L$ L$\$\$l$(l$ 2֋D$L$9ws)\$()É!؋\$ ؋\$t p wD$,|$0t$4ËD$$D$,D$0D$4D$,\$0L$49 e ;a D$t p @(P$$ ыD$p t@(p t L$D$ ËH $D$D$*D$H $D$Hp e ut 뒍t |\$L$ e ;ad&$D$D$詎D$D$8L$L$4T$ T$X&$D$D$sD$D$0L$L$,T$ T$T3$D$=D$==D$D$(L$ L$PT$T$$ $D$D$D$D$ L$L$T$ T$Lm$z|$|$e ;apD$t @2$QT$D$+i511|$0|$x|$h1iν5$$l$D|$(ꋜ$|$8΋$l$X Q J C < 5 . '    ;e ;av;D$ǀ  @É$ޡe ;av1D$ ǀ ǀ$D$1舡e ;a(D$,H T$0)ыT$4ڋhp89S\$t$6хQ9I9Al$))݇ۇ!9$)ʋD$)!9T$9t,$D$T$GD$L$1҉T$ \$,l$#t$|$ 7t$ |$,D$D$l$9}x3{99|$))χۇ!|t9wpL$)ыD$)!9~!L$9z<$D$L$藿eۉK )L$8(É؉ʉ4D$ ЉƋD$   ɟDe ;aD$XAPtEPTP X ӉXh PvP@@@ P|=w5$T$L$D$ 9D$ǀX@  ٞe ;avoD$ uZPI\$$\$\$(\$\$,\$ $ыD$L$T$ e u ÍյJue ;aLD$,HT$ ! P !! މʉ\$ ! p Pp \$$XX0p@ ЉXXXu9T$L$ۇ߇ۇ!T( шL(L$ L(L$ ʈT(f|(} XÉ$\$t$D$ !D$1փ ٜe ;aL$XYt,DAY  ؉Ai AABAtArt1A $D$T$D$ LD$ǀX$D$D$D$D$D$ D$ ÍPe uÍ3x q 蚛e ;au8D$<  $D$LD$D$T$\$ $ e D$4T$\$,Ct$4|$ʼn=%5^ 0f )=\$,|$ | 3$T$T$<>$\$l$ t$|$9,\te xutpt$(L$,D$0Ét$(D$,D$0Ë|$É}뷉G* # Lfe ;avpD$tpd 9tptL$D$É$L$d D$葰D$ uD$D$D$ete ;a@D$DHs $D$L$tL$HD$L@ËHʃPrL$8\$T$4hhh nl$$1D$DL$8T$4\$l$$t$,xs $D$L$t̉L$HD$L@ËDX ^ xxxxFL$8T$4\$9}t$,E\$}$D7= ^ r$DPT$<$L$D$D$ 4D$<D$8L$4L$ 1 D$8ʋL$ 9T$(D$969.X)މۇ!ڋTL9uǁTǁXƁ\|e ubxd d pe u3te u@d4Íd@gk鍹tZkƉQk뛉Hk $u4Í0$D$(D$|$D$L$ T$8p e u t4Ítj/ ( QS|e ;aO4D$8HPLHT9)L$(!ىL$0)9t$$HT$L$ ` $D$L$ $D$D$0D$D$$D$ D$(D$裯D$L$8Q‹l$t$y Qljy )ЉTډTtzd 9t)pe u t4Ítil$,t$ 4$l$d D$虜D$ t5ȍd -̍d L$8랋L$8l$,t$ 됋PHL9X99X))!ލ\5L9uǁTǁXƁ\|e ux@d4Íxhd@h܅PlX)~n99X)!ލ\5L9uǁTǁXƁ\|e ubxd d pe u3te u@d4Íd@g鍹tgƍxg땉)    Oe ;aD$PI$ыD$ L$T$tUd 9t L$ D$$ÉD$L$ $D$d T$D$ t ȍd ̍d 뿋D$L$뵋D$Xh Xh H ! PPPD$ D$$N$e ;a(D$0\$,ks*\$,{{ C{ L$t$ ֍iD$0T$9l$t$ K@ $ЋD$ L$T$tT$ \$,ST$Sd 9tD$4L$8D$<(ÉD$$L$ $D$d T$ǘD$ t̍d ȍd 뷋D$$L$뭉t ً9| #9Ӄ9v ˉT$ueqiA Q0$T$D$D$L$ T$,pe utD$4L$8D$<(Ítd߉ȉp)͉h\$4D$8D$<(Éى։P Le ;ave $AD$SLe q$p)=B$$D$$L$D$L$ T$|$`5 ȹ%D$`T$d$@$D$Ht$0$!i@$e ׍t$`%|$0 e P\$ LHH\$,r1cHLD$ P=P=ǂLH$9p$ )݇ۇ!݋$)ف}mL$ 9t$l$L$HjD$ $TL9uǁTƁ\TXDŽ$DŽ$ù댋$x3$D$D$2D$L$T$ $LPe u H|$,al$t$($|$eh|$,D$(Xa$l$b`$T$D$`D$d$$P9$uX|  =I $< D$D$$ 3 $D$D$&D$L$L$T$ |$41aT$4L$L$8\$<$L$@$L$DD$XD$\ e u|$$t$4eD$$L $D$$D$L$4L$c1ոb [ He ;a``$$D$D$0 B $L$dL$T$hT$D$L$ T$3\$0 e S $e L$D$0@డ$e L$T$0D @dH e LHPt$ Ht$,1_HLD$ P=P=LǂLHt$D$1D${f1L$0TL9uǁTƁ\TX=D$lL$p`Í3$D$D$D$L$ T$\$0LPe u H/|$,]\$l$($|$d|$,D$(]T$0\$T$0D]d@]iT$0@j]{[]L$dP9D$huP| = $xD$D$$ 3 $D$D$bD$L$L$T$ |$41]T$4L$L$8\$몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$dD$D$(2 +>뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$4軿 =뢍|$9;u#e ;av=Yu:D$t$HP$L$T$D$ D$S L=몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$TD$D$(Ҿ <뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$D[ T<뢍|$9;u#e ;av>Yu;D$t%H$L$[D$ L$L$D$ ;멍|$9;u#e ;av>Yu;D$t%H$L$[D$L$ D$L$肽 {;멍|$9;u#e ;avJD$$L$L$D$D$ L$ $D$D$D$ D$:e ;av'D$T$f9uJ@9D$ 1:e ;a$x;k e L$u] ttd e $x;T e L$u xtd dRtd Í=xtd Q=td dRQ܍=ttd Q :We ;avZe $ e L$u |td lRtd Í=|td 'Q=td lRQ9e ;avuD$ =x;tA= u&e $pRD$ptd D$É$ D$D$Ípe $hRD$跂ttd D$8oe ;avnptd L$ 9tCG$e L$uD$ AD$L$ÍyD$ Oe $pRD$[8ve ;av% ptd $MD$L$D$L$ 8e ;av D$7e ;av D$7e ;av D$7e ;a@3$D$D$ 9 D$L$ T$T$,Z\$(9r9D$0L$<,D$DX$D$D$8D$8L$9D$:L$;D$,HT$09\$<29*l$8ll$DmD$4D$4D$5D$6D$7h 9w89L$4L\$Hl$LT$PD$TD$X@Él$ 3$\$L$T$ l$y T$\$D$,l$ 딉L$$3$\$<\$\$(\$T$ L$= T$\$D$,L$$-3,$L$T$D$ \$ L$D$T$,\$([P I B k5e ;aD$}J$|$G)e u+{pD$|$ Í+{vLL$crcu tJ$|$G#e upD$|$ ÍLD$ H $HD$L$QT$Zj j j 9uEAB J  J  J D$ D$D$ Í$|$Ge upD$|$ Í@K良 肯 3Fe ;attd L$ 9ptd 9uMe $pRD$}td D$$D$$D$D$(D$D$,D$ ЋD$D$0ËD$$L$D$$D$D$(D$ D$,D$D$D$0Ëtd D$$D$$D$D$(D$D$,D$ ЋD$D$02 e ;aD$Httd 9ptd 9uMtd  $L$ L$L$$L$\$(\$ ӋD$L$D$$D$,D$0D$4ËL$$L$ L$L$$L$ T$(T$D$L$벋td  $L$ L$L$$L$\$(\$ ӋD$L$|1 e ;av D$D$~1e ;a$D$0HT$(\$49;l$,Tވ\މTވ\މl$8L$<\$@$ÉT$ 3$T$,T$D$\$ L$Ql$D$\$HD$0T$ 0Ne ;avPe $pRD$3ztd $D$D$D$D$D$ D$ ЋD$D$$I0e ;a0`$D$L$411۽ |$(<B4D$(D$(D$)D$*D$+s9w |o9viT$,t$ \$$ 3 $D$\$l$ t$l$D$L$4T$,\$$t$ 벉$\$l$D$ D$801۽ 0/e ;av1  $D$D$L$ $D$D$ .e ;avND$10C}̓u1\$s J}1B k.e ;av7D$ЋL$T$\$ 14+E1Ɩ419|ЉD$.e ;a `$D$D$D$L$ $D$1+ 4]}Ձ1rA} sωD$ M F o-Ze ;aD$(L$ыT$ \$,l$$u1u4}1u1} 11111tхuL$0ÄT$ $l$D$ \$D$D$0ËT$ \$,l$$L$L,e ;av=D$$xtd D$D$ D$D$$D$ D$(D$D$D$,+e ;av=D$$|td D$D$ D$D$$D$ D$(D$=D$D$,+e ;avge vu褪 e fda$ e L$u ptd e Í=ptd B+e ;avmF$D$D$$L$L$L$ L$MD$ L$tD$$D$(L$,ËD$D$$D$(D$,|*we $x;A$1󫋼$ W@_<$$Ƅ$e [$B$$D$$L$D$L$ T$$ K4 e S8|$|1B$t$|$|FD$d d T$DT$hL$lD$pTɉk2D$hL$lT$pT蛗 /e ;av) D$H<@@I$ыD$L$D$L$ pe ;av+D$$D$ D$D$D$ D$$e ;a(D$4H v|D$ D$$ `& $D$yD$L$ D$ L$$$D$#D$ D$D$ D$苁D$L$D$8D$<$D$.pD$L$ vd e uT vd ޻$D$oD$L$ vd e u vd e Í=vd $=vd $ e ;avED$@ SL$ @e L$L$ $ЋD$L$ 9uD$ 1 e ;avCe vu躋 e V°mX1e 6 e ;avaD$$L$L$OD$L$Q$D$D$hD$ L$ $D$D$ID$ D$ e ;aD$HT$Z*09tJ1Ʉt@JX8u0J X 8u J RX9‹@ 9!ˆT$1114$L$\$UL$ D$T$ ^e ;ae vu  e ݄$D$#WmD$ L$ d e +d $D$mD$L$ d e  d ݴ$D$-lD$L$ xd e  |d ܞ$D$+lD$L$ d e uT d ޼$D$ {lD$L$ d e u d e Í=d !=d !룍=|d ]=d =d K Fe ;av#D$uD$ ^ D$ e ;avD$D$e ;avD$D$e ;avyD$D$$D$D$L$L$ _qD$|;w6L$ $D$D$:D$ L$ T$L$ D$!T$$ ke ;aD$L$0sm|XIQ` @s/=93 @!b D$D$D$fD$D$fD$D$ÀQZ-` D@sb=IQD@s.=9@!b D$L$D$fD$D$fD$D$fD$D$ÀQZ-` D@=QZD@sc=IQD@s/=9 @!b D$D$D$fD$D$fD$D$fD$D$fD$D$fD$D$fD$D$ @!b D$D$D$J C < 5 . '  IDe ;aD$L$0sm|XIQ` @s/=93 @!b D$ D$ D$fD$ D$fD$ D$ÀQZ-` D@sb=IQD@s.=9@!b D$ L$ D$fD$ D$fD$ D$fD$ D$ÀQZ-` D@=QZD@sc=IQD@s/=9 @!b D$ D$ D$fD$ D$fD$ D$fD$ D$fD$ D$fD$ D$fD$ D$ @!b D$ D$ D$~ ~ |~ u~ n~ g~ `~ De ;av`\$=D$D$Le ;a"e vu` e 2$le L$ Hvd $D$ D$D$ D$  $D$D$- D$ $L$L$D$. lD$ $L$L$D$* DD$ $L$L$D$+ D$ $L$L$D$, D$ $L$L$D$f D$ $L$L$D$g D$ $L$L$D$h |D$ $D$D$D$i TD$ e uD$Dvd e Í=Dvd D$=Hvd 4e ;av8Yu5D$ tH$L$yD$D$訁 믍|$ 9;uÉ#e ;av9Yu6D$ t H$L$YD$D$G @뮍|$ 9;u‰#e ;av9Yu6D$ t H$L$)D$D$ 뮍|$ 9;u‰#e ;aD$L$1\$l$‰9}}T$)Љ!ȉ$l$6D$ L$ T$uD$@벃u/^ t t tL$D$ Éэ^ D$ z /e ;avoD$D$$D$D$D$ D$wD$ L$tL$ 9} D$$D$u D$$Àujue ;av D$>e ;a>4D$@L$L9 d d 1ۉL$0T$(l$8,$l$Hl$D$D$PD$ \$D$L$T$\$P9\$@9ӉD$,L$ \$$l$BZT$ sT$ \$ȉP2k +k $k MHe ;aE4D$<$L$PL$D$D$XL$TL$,D$0D$1D$TL$XD$$L$(D$*fu*111ҋ\$8$L$T$D$ 1D$D$\4ȁJb  ?LɅ@9wJww)_ۉ!؍ʉ냋D$8$|$t$< D$PD$D$TL$XD$L$ D$\4ËL$8 $D$ D$\4j i e ;a+4D$<$L$PL$D$D$XL$TL$,D$0D$1D$TL$XD$$L$(D$*fu"111ҋ\$8$L$T$D$ 4ȁJb  ?LɅ|y@9wqJwi)_ۉ!؍ʉ돋D$8$|$t$<2 D$PD$D$TL$XD$L$ qL$8 $D$hi ah e ;a6DL$Hǁe ǁ\$Pl$T-e l$Lt$@1;D$H$L$8T$$D$($|$5(#D$ L$D$ $e ;aD$сL$Jى!ʍ $\$\$L$ L$ $QD$L$ s3Cl$T@c d &e ;a D$$L$( ȍ w`T$L$\$Mى!͍($T$T$D$,D$ /PD$L$AT$\$A c b @e ;aD$ L$$ st ȋIT$L$L$T$҅|B9w;w3Yۉ!ˍ$)ʉT$l$ID$ D$(&c b HSe ;a0 L$0TD$0$IꍌTT$0)щL$ba)ʉT$L$ L$$ $t$(t$|$,|$NL$k\$0)ӋT$(\$D$)aD$ D$,Hl$$ $JL$\$dND$tHL$(rKT$,l$$$L$\$D$ ND$4 D$4 a a e ;aL$TT$$IꍌT)ىL$ ba)ʉT$L$L$ $L$ T$ )ʍaL$L$ $L$ kT$)ʅuËD$$D$,7e ;a$D$(L$T$4\$,l$0|$0o|$ʉ9r |? l$0 lmRL$ T$49t(8؇ݗr UЋ)I+KJ|t$$t$gD$D$ L$( $T$0T$KD$L$ s=a| =vT+s1=~*=}#ø$Iꍔ T)k9t1D$4 L$ Q\$(,Ë MU@t$D$($T$T$YL$\$(D$4ʋT$($\$\$iLkdD$\$(D$4똉D$؉ƋD$$] ] ] ] e ;ad@D$D(L$1۽t$F|$ˉՉ9 T$4Ћ>N|$,L$0L$,|$-99Q!хw9VL$4T$8L$8T$4T$$L$(L$)M :T|$61҄t ^4^Ut$h1M$D$D$D$ D$3D$L$D$hD$lD$pL$tTÃu&\$Xdl$\͉Ћ\$`ىu&\$Xl$\͉Ћ\$`ى$D$D$D$ D$2D$L$D$hD$lD$pL$tT"e ;avD$dD$e ;avD$d9D$_e ;av0D$\$ЋD$L$\$ L$D$\$  e ;a > = e D$;AL$L$X$pl$0lt$,ȋhL$Lh|$T1}|$\1L$LL$dT$,T$h\$0\$l$,$|$Xt$\L$(L$\$Dl$H\$l$ <L$ET$(ʋD$XL$L$l$0t$,|$T9T$(1FL$LL$t$ l$T$+ՋL$\$L$D\$HL$H\$D\$4L$8L$6uL$8T$4T$D$4 = $ $$T$D$D$ $$rD$L$T$ $$$ÉqC 9; 93 )މۇ!9~9D $\$T$r/߉3 e  X\L$4# Yۉ!ٍ 9~`$$9t $\$T$D$\ = $$$DŽ$É뜋$$$$Í\Xu\$4ۉȉ$L$4u9$ً$$$$1\ߍXD$D X|$"T$X$dD$獴$ЋD$L$$$$$TXD$D XT$Xt$\|$"|D$4=y $$$DŽ$ÉE 9= 95 )!\$H9~$$9Y$L$l$D؉ڋXTl$l\$p\$rÓfpll$\ڋhhtHǁlǁp-e uǁhl$\Љ1:≹lT$Dpe uI$hY\ $D$L$T$ $$$É$\Y믉$׋T$DP|$\T$8dD$$$D$L$4\$`, ]$dD$\T$8d9t$`D$e $T;A:,|$D1]$4L$L$8T$P$<\$T- c c $09D$<$|$t$DD$T$D$ D$$L$(pD$4 3 $D$$8L$7oD$L$T$ \$4h$<9Y9݉D$0L$,T$8$49t$t$\$o ͵$[D$|$X5i̴$t$<&$t$D $8$L$8$L$,$ L$0$$ X$( e uCǍt$X[$D$4D$-D$L$ T$$@$D$H,ÉD$@ ͵ $D$L$XL$wD$@뤉݉$4$@$8$D$<$H,  贚e $T;A:,|$D1$4L$D$8T$Hc - c $09D$<$|$t$D舷D$T$D$ D$$L$(D$4 3 $D$$8L$lD$L$T$ \$4s$89d90މD$0L$,T$8$49t$|$\$  ͵$\YD$|$X5kg$t$<$t$D觶$8$L$8$L$,$ L$0$$ X$( e u\Ǎt$X$D$4D$D$L$ T$$T$L$D$ DD$L$$<$@,ÉD$@ ͵ $D$L$XL$D$@닉މ$4$<$8$@,"  De $X;A(|$@1}$0L$H$4T$L$8\$P- c c $,9DD$4$|$|$v|$t$ t$ 9l$|$D$D$D$` Y 肔 e $H;A8|$<1转$@L$<$DT$@c - c $<9D$0 `& $SD$D$8L$0 $|$|$4t$<:D$$DL$D$ ?D$$L$(T$8  ͵$zSD$D$,|$d1蒫$t$0߰$t$<Ű$D$ e |$,t$d<`]$SD$ ( e ;L$8H$DP e $@X\$,ǃǃ-e ǃ]D$,|$PL$8T$$|$4t$P$DL$D$ D$$L$8$D\$,9}2D$$D$D$ L$8zƄ$H8Ƅ$H8Í1肩u뛍xË$@bxD$8MȋL$8 ͵$D$,D$L$dL$aƄ$H8[  脑e D$;A$T$L$\$  $"D$L$D$hL$lD$L$hT$lL$`T$duƄ$ĔL$at$)˅)9L$()|$4)!H1ۍl$$9l$|,$D$|$կ$T$(e9]$"$$ǜ$T$4 \$09w~ 9l$4t$x$D$|D$T$@D$0$D$4e uD$xƄ$ĔÍD$xL$,3$t$L$l$ \$cl$t$$L$,T$4\$0@D$t3$L$$L$D$D$ |$qc\$l$D$tL$($|$4p9)Ɖۇ!ƍ\5)Dž|$$L$4\$p$!D$dL$`L$PD$T$mL$TT$PT$@L$DT$Dш ƀ$1蕦$艦L$p$L$$$L$4$$ $|$$1D$L$dT$`T$L$ Ƅ$ĔÉ$O$$蠤$ƀU$%D$dL$`L$8D$D$,t$L$t $D$D$D$ ‹D$(;D$t$mD$,ʋD$,ݸ똋D$t.L$$D$tt$l$\$ \$\$T$L$'D$ L$T$\$te u$D$T$$s|$Xڛ݋D$xϛߍX輛2e ;avnD$L$T$1$T$D$D$ L$ $D$"T$D$L$9|ˋD$ T$$L$(蛃ve ;av|H|$41|$4L$\L$4L$`L$8T$L$T$PT$T$TT$T$XT$ |$t$4艠L$`L$$.L$,T$0\$(\$dL$hT$lHhe ;a@|$,1G|$,>L$HL$4L$LL$8T$PT$<c  c l$D9s9$|$t$,D$D$LD$D$ D$$D$T@) R]e ;a@|$,1藚|$,莚L$HL$4L$LL$8T$PT$<c  c l$D9sv$|$t$,2D$D$LD$L$TL$ 6D$$L$(T$L9}.t d d D$XL$\T$`@Ë xd |d 11< e e ;a@|$,1跙|$,讙L$HL$,L$LL$0c  c l$D9sv$|$t$,ZD$D$LD$L$PL$ ^D$$L$(T$L9}.t d d D$TL$XT$\@Ë xd |d 11d 荀(e ;asXD$"D$t1ɉˉщډD$t\$x9*T$$L$#L$` $D$\$覧D$ L$t9t D$"H1붋D$\Pt$`ZL$tL$ӋD$L$L$PD$TD$QD$PL$TD$HL$LD$"D$LL$HL$0D$4D$"L$4ȈD$" D$"D$RL$#8D$$L$\QtrT$T\$P\$(T$,T$-uT$R\$Ql$tL$xT$t9u T$|t$Ƅ$XÉ鉄$Ƅ$XËT$T\$P\$@T$DT$Et륋D$$$Ƅ$XÃu D$tAt D$$3D$$$Ƅ$XÄu&L$LT$HT$8L$<L$=L$"1D$|tD$x$Ƅ$XËD$$$Ƅ$XÉ0$D$ }me ;av{@|$,1;|$,2L$HL$,L$LL$0 c c l$D9s9$|$t$,ޚD$D$LD$D$ D$$D$P@% N}ie ;av\4|$ 1蛕|$ 蒕L$L$ T$i9T$l\$h\$XT$\T$\\$X\$0T$4T$5?T$2„D$L$lT$hT$8L$<L$+L$ 8$$D$L$ e L$ c c \$94 e ǀ e uhǀǀǀ e u-ǀǀƀ pUL$ D$$Í1{ʍ1r{돉D$  $|$t$D~D$ ND$:{~ ce ;av|$t$ t$ :9 l$|$D$D$  Ge ;ae vu@ e bx<$e L$; Lvd Ԡd ؠd  e  q` Рd c c  c d d e ܠd &$D$D$vD$ D$1;L$\$&$D$9D$ L$`AD$| e $Tvd $e L$ Pvd d ed e e  ` d 0c ,c (c d d e uod d d d e u@d d d d e u$d e Í=$d y]=d l]빍=d _]늍=d ` L]F=Pvd :]=Tvd *]=ܠd ]A=Рd q` ]=Lvd \hECe ;avo(YuoD$,tV$D$0D$D$4D$D$8D$ D$$D$$D$D$(D$D$,D$ ڦD$L$T$D$0L$4T$8 C됍|$ 9;u#e ;avGYuDD$t.$D$D$D$ D$D$$D$ *D$D$(Y RC렍|$9;u#e ;av?Yu$D$$D$D$(D$dD$ L$D$L$D$L$L$,D$0y r?뀍|$ 9;u#e ;avGYuDD$t.$D$D$D$ D$D$$D$ *D$D$(  ?렍|$9;u#e ;av?Yu먍|$9;u#e ;avGYuDD$t.$D$D$D$ D$D$L$ L$$D$() ">렍|$9;u#e ;av'Yu$D$t$ٿ =|$9;uԉ#e ;av` Yu]D$$tG$D$(D$D$,D$D$0D$ D$4D$1D$L$T$T$8L$4ie ;av{$D$D$ s$D$(D$D$L$ D$L$ 0$D$D$D$D$ D$D$L$D$,L$0$3ie ;a" xL$|Q 11ҋ$$1quK݉~ u.t≜$$D$L|$X1yKl$X\$\D$L$$։ȋT$0D$LT$0L$l|$\9 D$"D$X$D$L$GD$0L$LT$"D$0\$tkl$tt$d|$`t:9| \$\\$loF9u9D@uD$0ӋD$0F\$pkl$lt$\|$XF9u9D.ut$lD$0 L$|Qu L$LX b$|$$G e uP$G e uW _߉ōI׍Ӊ$Hȋ$렃f1҄u}OGp9~ωl$$|$X&$L$D$T$ t$@L$D$T$pD$,\$\l$$|$X눉L$lT$04$\$|$Wl$ |$D$,L$lT$0\$\t$ty\$(1H|$D|$81L$<$D$,|$ L$D$L$R$T$T$(T$\$,\$ D$tD$0D$0e ;avaD$L$Iȉх~ u4uI~T uuD$ L$À  e ;a D$$D$ D$SD$D$L$ L$ $L$D$,R6D$ L$ 9D$L$ $D$D$L$ $L$D$$D$L$(L$ D$t D$,ËD$@L$ 9we)!ȋL$ȉ$T$D$$D$D$(D$ D$뷋D$$D$ D$D$$D$D$(D$ D$D$,r e ;aD$ L$(9T$$\$1t$94+}G}}3^w'^ 9sq,*uw 8ÕtD$,ÉD$,Él$$D$l$t$ |$D$ L$(T$$\$l$D$,D$,p e ;aD$tkL$19}X}*B}sV- ^ \uD$ Í- ^ 1 $D$T$/\$ T$D$L$D$ D$ p ?Ze ;av9D$L$1B9}s-_ \uD$ D$ o e ;av\D$L$1B9}>sB s't uuD$ À ÇD$ 4o ]e ;av/D$L$1B9}srD$ D$ n e ;a9(D$,$L$0L$D$D$,$L$0L$DD$L$ T$\$l$D$0L$,11ۉT$ \$$ $D$D$L$ T$\$u`T$ uD$4L$8D$<D$@(É$L$D$$D$T$ vKD$L$D$4L$8D$<D$@(D$4D$8T$<\$@(Éʼnȉ։ډKD$,D$4D$0D$8D$<D$@(e ;ade vup e ] ȕ $D$D$uD$ D$  $D$KT$D$ D$ $L$L$KT$D$ D$ $L$L$T$D$ kD$ $L$L$T$D$ <D$ $L$L$]T$D$  D$ $L$L$LT$D$ D$ $L$L$:T$D$ D$ $L$L$ʺT$D$ D$ $L$L$T$D$ QD$ $L$L$T$D$ "D$ $L$L$<T$D$ D$ $L$L$'̺T$D$ D$ $L$L$T$D$ D$ $L$L$nûT$D$ fD$ $L$L$PT$D$ 7D$ $L$L$T$D$ D$ $L$L$T$D$ D$ $L$L$T$D$ D$ $L$L$.T$D$ {D$ $L$L$ƝT$D$ LD$ $D$D$ ЉL$D$ D$e uD$4vd e Í=4vd D$!|e ;a  $ɬD$D$@(@,@0L$H4 e uwL$H8re $uND$HYe $u#D$H$D$D$D$ ËT$zҋT$z멍x8D$4e ;a1pD$t@@H0@0H(P 9@(H@P(L$8 !Љƒٽ !پ ! T$@9Ët$<9ƇÇ!9Ç fL$0Y|$49\$0)Ƌ\$, D$0!΀Έ  ȉt$<$@vd @L$$)D$)ȋ $9s*4|$,D$@D$@D$@R R e ;a.(D$<D$@D$DD$HD$L@$葖D$D$L$,Q(T$L$ $XT$VS$ND$ ( e mL$HT$,B($D$0D$D$4D$D$8D$ fD$L$D$,H@HD+HLd11Ʌt*D$<D$@D$DL$HD$L%](ËD$H@T$ʃX89 9ӇÇ!9 u=H 0 / 0 / L$ D$xD$|DŽ$DŽ$`&$T$KD$ L$L$xD$|`&$D$ D$]KD$ L$$$i$D$(D$xD$D$ D$D$L$L$PD$T0$D$PD$KD$ L$ $D$= (e ;aC$D$<D$(HL$ $ $L$,T$0L$T$ 豼D$H… ӄt-T$($D$L$D$L$ L$@D$DD$H$D$@D$DD$H$D$D$D$D$ D$0L$,L$D$D$4L$8D$L$ D$(HL$ + $L$L$рD$ H… ӄT$($D$L$0D$L$ L$@D$DD$H$±e ;a_4D$8HT$@9Ëh t$<9Ç!9ʇÇ ߗuI))ʉӃ-@vd 9t@)D$D)щL$H4ÉL$D\$H4D$$D$(D$,D$0`3$t$T$HD$L$ L$$D$(D$8H@ D$L$`3$HD$ L$D$,L$0T$D$D$$D$D$ D$D$L$D$L$ 0$D$D$HD$ L$ $D$: 6e D$;A]$oD$D$8ze $D$8Hze $D$8H Gd 1 \$<ʉىL$购e ;av' $]mD$ L$ D$be ;av&L$e uD$A(Íy(D$#e ;a$BHPj9?JH<e u t$(4$Íʳ$|$D$(D$(D$ ʳ$\$T$L$ l$D$L$T$|$ We u ʉÉuΫ9e ;ae vup+ e 2&=(#$D$D$ L$ Xd e  \d h$D$eD$L$ `d e  dd I%$D$-D$L$ hd e u{ ld <$D$# D$L$ Pd e u8 Td e $u @vd e Í=@vd {=Td l뿍=ld ]y=dd K3=\d ;豪\e ;avYD$$L$L$gD$L$Q$D$PD$L$ $D$D$2D$ D$0e ;aD$HT$Z*09tX1ɄtNH Z jp9t1Ʉt@J8D$1,$t$\$L$ D$T$1,$t$\$L$ D$T$uPe ;av2Yu/t$tD$D$ .+ '뵍|$9;uɉ#e ;av1Yu.t$tCD$D$ * Ȩ붍|$9;uʉ#e ;av9Yu6t$ t @D$L$L$$D$(g* `뮍|$ 9;u‰#e ;av: D$$L$L$D$L$ $D$D$D$ e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$D$ 1݉4$T$l$zL$ D$\$fqe ;av>Yu;D$t%@ $D${D$L$ D$L$) 멍|$9;u#e ;av7 Yu4D$t$D$L$L$D$ ( 袦밍|$9;uĉ#e ;av+D$$D$D$D$.D$ D$Ne ;av,D$D$D$$D$D$ D$e ;av;1L$#D$ \$$L$L$D$ @=|؉L$螥e ;aD$ L$$1B=T$\$l4t$|49tt'ul\ 8ؕtD$(Ël tt$| t9t뿉4$D$D$|$l$ D$ L$$T$\$둉4$D$D$l$l$ D$ L$$T$\$UD$(肤e ;aJPPL$T9+D$XuCD$ ˱ $ de |$uD$p D$\|$`PËD$~D$Xu P} $cD$D$ 3 $D$D$vD$L$L$T$ |$$1 T$$D$D$(\$,D$TD$0D$XD$4D$HD$Le u|$ t$$oD$  $D$ D$L$$L$薽׸( e ;a$D$( $D$L$T$ T$\$l$t$(N =e VFT$ ,$\$D$D$ D$ L$T$\$l$(EMU 5e uF]u;!фt d d M e uE$Ë|$ 蟹$Ë|$ Ɖ茹묃$É}Re ;avZD$ H+H~>$L$ߑD$ L$T$ $D$T$D$ D$D$$D$$oe ;aD$ @ $D$D$D$ D$L$D$$L$( e ;a1D$L$ 111B ؗ 94~З w_uЍ$yX|$Ge u*NfD$D$pD$ |$$ÍNfϯэ~w~뒍~w~냍$X|$Ge u*~D$D$pD$ |$$Í~Wщ\$l$D$ D$$贗e ;ae vu e 2s߻$D$D$L$ d e u d e Í=d 臮[e ;avD$D$D$釞–e ;avD$D$D$釞蒖e ;avD$D$D$D$ 鏜Ze ;av/D$D$D$D$D$D$ e ;avD$D$韛ڕe ;avD$D$D$7袕e ;av'D$D$D$D$D$針be ;avD$D$D$ D$?*e ;av'D$D$D$ D$D$駟e ;av'D$D$D$D$D$袔e ;av"YuD$ $8D$D$gō|$ 9;uى#e ;av"YuD$ $D$D$ō|$ 9;uى#e ;av* Yu'D$$D$L$L$D$ 迓뽍|$9;uщ#e ;avJYuGD$ $D$$D$D$(D$xD$L$T$\$ \$,T$0D$4L$8O띍|$ 9;u#e ;av* Yu'D$$D$D$D$D$Ș 뽍|$9;uщ#e ;av"YuD$ $XD$D$跒ō|$ 9;uى#e ;avJYuGD$ $D$$D$D$(D$D$,D$ 耚D$L$T$D$0L$4T$8?띍|$ 9;u#e ;av3Yu0D$$D$D$D$ L$L$D$ 봍|$9;uȉ#e ;av:Yu7D$$D$D$`D$L$ T$T$ L$$D$(뭍|$9;u#e ;avBYu?D$$D$ D$D$$D$訝D$ L$T$D$(L$,T$0륍|$9;u#e ;avaD$$L$L$D$ OD$ L$Q $D$xD$L$ $D$D$D$ D$舐e ;aD$T$9JXhr9Ç9!t_JXj p 9t01Ʉt&JXf9u@J8D$11,$L$\$L$ D$T$11ǏBe ;av`|$P5D$P$D$D$\D$ D$,L$L$ |$@5ŬL$@ $D$D$!D$D$L$ L$(|$05芬L$0 $D$D$D$D$L$ L$$`$D$/D$ D$  $N|$D$ Ge uvL$,L$O e uIL$(OL$O e uD$$GD$G|$d`ÍOω‹D$$٥֍Oω‹D$(å먋D$,趥/je ;av^1L$AL$9}4D$L$Z$\$|.D$L$ tɉD$$L$(D$$D$(諍e ;a ߱$YMt$|$|$ e uV親D$ $ $"MD$ ( e uL$ HD$ÍxD$ 菤$|$t$eIe ;a:D$H httpJsL$QtytYT$$o D$$#D$ tD$D$ D$$D$(D$ D$$D$(D$ D$$D$(ËQ tYt$K|$GRe u"3yD$ pD$$|$(Í3y3ًL$1L$1L$1苋e ;a DD$LL$H $D$D$D$ L$L$$T$ T$K$D$D$D$HD$ L$LL$D$L$ $D$ID$L$ D$L$HL$,L$LL$0t@D$(D$4D$8D$<D$@ 0 $L$,L$#D$ L$L$4D$8D$(D$D$0L$L $D$`D$L$$Q(Y$jq,91ji(,Ӎ5%u|e u>ݜ4D$Hb$\$T$t$ l$YD$L$T$$S,e uC$ʉËD$H$v{$wD$L$L$0L$D$D$(L$L$DT$ \$l$*+[ l]j[ډl$$T$@$l$hD$ L$T$L$$${1dI\$@م.L$L|$XyL$LL$XT$\L$DL$`L$(L$dL$h % $T$XT$$Q8Y4i0sD$ ϋL$9.SW4T e Tu_D$PL$4b$l$\$T$ t$WD$L$T$$S8e uC0߉ˉŋD$PL$4v{0蒚\$#$D$D$L$ T$T$L$D$#.L$@T$$D$@$ L$D$D$ L$$[L$,|$l1T$l\$pL$,L$tL$DL$xL$(L$| % $T$lT$a$Q(Y,i$rD$ ϋL$9.Z_(\ e Tu膙D$PL$4b$l$T$\$ t$LVD$L$T$$S,e uC$߉ʉŋD$PL$4v{$Չl$0T$L `ˡ$XAD$ p%e @e P$C(C,-e uwC$`ˡ$AD$ p% e u< @e H$A4A8e u A0ĀÍy0Ux@e C빍{$7낍x@e %Ѝ@e CĀË e u$A$y e u$A $y 輗  $Oe ;a D$$$+DD$D$L$L$$L$D$L$ T$D$L$D$L$T$$$/DD$L$t0T$$T$T$D$L$ D$L$D$(L$, ËD$$@L$D$ "$8vd D$D$@‰ȉ떉‰ȉke ;aD$ $L$$L$D$t$D$ D$(D$$D$,D$0D$4Ë c $D$ D$D$$D$GD$ L$T$\$D$(L$,T$0\$4o~Ze ;av/D$L$1B9}srD$ D$  ~e ;avD$ }e ;av4D$$D$,D$D$0D$D$4D$ D$D$8}e ;aD$(L$ T$$ $T$D$D$DD$ D$HD$D$LD$裐D$t@D$,L$0u D$PËT$@9t1$D$  {e ;ame vu e D胔n$F$D$ " $D$T$D$ |$Ge "$L$L$ؿT$D$ 谋|$Ge u~C"$D$D$ ٺL$D$ k|$Ge uԩD$8vd e Íԩ=8vd D$ߑٍCґz‘%8zse ;av2B$D$D$(D$L$ T$T$L$ D$$Wye ;avpD$$L$L$觺D$L$Q$D$萺D$L$Q$D$yD$L$ $D$D$D$ D$Yyte ;aD$HT$Z*091ɄH Z jp9tX1ɄtNJZhp9t1Ʉt@J8D$1$t$L$辶L$ D$T$1,$t$\$蛶L$ D$T$1뇉,$t$\$xL$ D$T$Kax e ;avb Yu_D$$tID$($D$,D$D$0D$D$4D$ D$8D$D$뽉NjD$Ë$[$U\$D$L$ D$)Ћ$\$ ,$t$|$i -e uy$u\$Tk,[0i,Y0\$\t$@$$7D$@$D$\D$$ЋD$ L$DŽ$$$cÃ$ωʼn|nmo|in$[nbopHn,ODω‹D$X/nOtnzD$HnzD$lnD$Lm~$CHKD11,$t$\$BD$ 1111L$\T$@$$5D$P$D$4$D$@t@D$tDŽ$DŽ$DŽ$DŽ$ 0 $$L$0D$ L$$$D$t$D$\$E$D$&$D$D$ D$CD$L$ $D$$ЋD$ L$DŽ$$$RË$ $4DŽ$DŽ$$@D$`&$fD$ L$$$$D$#$D$D$ D$oD$L$ $D$$ЋD$ L$DŽ$$$~Íx$ky‹$ky Ë$tkyŋ$ckȉщډ달$$G!$@ $D$mD$ D$DL$L$t$o|$|$hGe e $<|$D$DGe ubL$t pO e u3D$hGDŽ$ $$RÍOω‹D$hij뾋D$t\j뙍eOj`$D$$D$ $SD$.u $Ë$i; $`cD$D$=   8Re ;a@D$HH $D$D$(L$DQ D$HH $ SʺL$D$D$$D$,L$H $,D$D$8L$L$$1\$ SD$8L$$9T$ L$0Y)l$\$ $l$,l$bD$HPj9'JH e $D$=$D$D$ D$c&T$LD$4L$|3$|$T$t$ l$t$|$D$4L$|T$L$l$PB$$ L$Pt$L3$l$L$\$ t$G\$l$$L$P$t$LQ$$D$@L$xT$L3$|$T$t$ l$t$|$D$@L$xT$L$l$PO$$T$LD$8$3$|$T$t$ l$|$t$D$8$T$L$l$P$$褣 0$(D$j 胣 0$D$I b 0$D$( A 0$hD$  0$(D$  0$D$Ű ޢ 0$лD$褰 轢 0$D$胰 蜢 0$XD$b { 0$HD$A Z 0$D$  9 0$D$   0$D$ׯ  0$D$趯 ϡ 0$D$蕯 计 0$ȻD$t $e ;a,h`?$D$lD$SʺD$D$ 1D$L$PT$,D$T`$#D$111 l$HEÉЉʉl$,9bL$HT$8\$4D$dD$TȋZ$\$2D$ L$ $D$D$D$ `D$L$uQuD$4L$8T$dtD$$L$PT$4\$8l$d1p|$$؉Ӊ‰9l$`t$0\$DT$@D$\P$T$L2D$0L$PT\$ l$e MT$\*uT$D\$@l$`z\$D$ D$ # Le ;av5ud $D$D$D$D$mD$ L$D$ L$$e ;a$:$D$ 8UD$D$(D$ D$,D$D$L$D$(L$,$L$D$ ]D$ |N$1D$D$L$(L$ L$,L$D$D$#D$L$ D$0L$4$ËD$($L$,L$D$,\D$ }D$(D$0D$,D$4$ÉD$0L$4$e ;av.D$H_s"t;t \D$111e ;avG*$D$ 4UD$D$ D$ D$$D$[D$L$D$(L$,"e ;avD$H_s ;D$1e ;aQPD$dL$`\$\1l$$Ul$dt$`|$\9T$$$D$uD$$L$`T$TT$8T$XT$@ $D$tD$ L$(T$\$$ld d D$@L$D,ËD$0D$@D$4D$D,ËD$0D$@D$4D$D,n g ke ;aWD$L$ T$t@ $T$D$$D$D$D$ BD$L$D$PD$TD$XL$\<Í L$PD$TD$XD$\<ËL$@e D$;Av$?-$@D$$ $ЋD$ L$T$\$l$D$,L$D$ 11D$8(D$8(D$8(te ;a/xD$|@$»D$D$qD$L$ uDŽ$xÉD$0L$8獴$D$u͍|$d1L$8 $L$0L$st$|$dIL$L$4|$*e ;a8D$<HL$4 $rD$ ~ e ;aD$ D$$D$ D$$UD$@uJD$$ؿD$D$0"D$ D$D$uD$ D$$/HÐ%HWe ;a$D$($D$,D$VD$ D$L$L$ T$T$@$D$L$%_D$t ܎d ؎d D$0L$4D$8$ËD$D$0D$D$4D$ D$8$Ve ;a D$L$1Bc -c s9}09\9؇Ç9Ç!9 tsVR @d $~ D$L$9uQID$T$L$ É$T$'D$~T ; ; 9$e ;a)<c c T$D1C9}j,9uD$@D$0T$4D$HD$8\$$D$0D$WD$L$ D$L$D$@ @d $( L$HT$L\$P1|$DD$ ʉl$ p\$Pl$ p87h X/9'9))ۇ!9iT$8L$H\$$9t $l$\$D$$L$89T$DZ ÉZ )B)l$P)ʼnۇ!ŋ|$H|$ z}D$ zR9L$4t$0l$<$|$T$bD$DHPj/T$,l$($\$l$L$ I ىL$l$T$D$DH\$(9L$, IDD5e |u.DH9X@ L$4l$OD$L$ D$tL$x$`aD$D$l @  e $H0$D$tD$9D$L$ T$lBe uDJ $HloB$D$T$D$ D$Ӌ$z [볍x$JmDŽ$DŽ$$$|ÍUDŽ$DŽ$$$|Ëd d DŽ$DŽ$$$|DŽ$DŽ$$D$d$|ËJ$ы$1o$D$kD$5 ǟe D$;A$Q Y$i5e $A qUT$T\$(M$эt$t$X|$0贼$H<T$1 T$89uKL$1u:L$2u$@DŽ$DŽ$ĔËL$8Hڀ tD$dD$hD$lD$p 3$L$8L$I6D$L$ D$dL$h$HL$ 3 $6D$L$ D$lL$p;$D$2D$dD$D$ D$D$D$L$L$L$]D$L$H e u`L$L p$J e u6B $D$8D$L$ $$ĔÍzÉNjD$L뗋D$(@L$T $Ѝ|$$D$%D$\D$D$ D$D$D$HL$L$$$D[D$L$$H e u`L$H p$J e u6B $D$6D$ L$$$ĔÍzqÉNjD$HdDŽ$DŽ$ĔÍy $4>誚e ;avD$@D$se ;avAD$ tHP@ D$T$L$Í0$D$$ e ;a,L$<L$0pL$ύt$4BL$6=L$D ȍd ̍d 1111ȕ9U)˅9L$Yqe u%A 0PD$LL$PD$TD$X,Íy 軰D$D$D$D$sD$D$!P!$D$D$3D$L$ D$LD$PD$TL$X,D$LD$PL$TT$X,ËD$HpۇT$@2I*1҉Ɖ؉11\$DD$@t$H$AXL$yD$ D$$D$(D$ _D$$D$(P!$D$ D$ 2D$L$ D$LD$PD$TL$X, e ;avd,D$0$D$4D$D$8D$D$|$Ge uhpD$4|$8$ÍhT$(Wf~e ;avAD$ tHP@D$T$L$Í0$D$ ~e ;avD$@D$}e ;avD$@D$}e ;avD$@ D$s}e ;a!8@$)=|$|$t$@誚D$HL$BʃZL$P ̍d ȍd 1111 | ̍d ȍd 1111DT$r 9J ̍d ȍd 1111핈D$1L$L$J)΅~I9 rz e u%jpPD$XT$\D$`D$d8Íz術ҋD$HD$(D$,D$0D$4!$D$(D$D$L$ D$XD$\D$`L$d8D$XD$\\$`D$D$d8ÍKwmߕD$11D$XD$\T$`L$d8ÈD$_}^nF  6 D$ˉ11QT$D$XD$\\$`L$d8ËD$Txۇ\$L4;i 1ۉlj1|$Tl$Pt$L1D$D$ D$$D$D$ D$$P!$D$D$tD$ L$D$XD$\L$`D$d8  4ze ;aUDL$L1„T$^T$\tT$]tT$e\$dl$`1҄T$HZHjP $ CKCKCrLjP e zHZH|$@D$^tN9\NJL3D$dL$`\$e6$1ۄBLL$T\$4jPrH|$P9V9 l$0t$<$|$L$/D$4L$HALT$0QPe \$re ;aM(L$07„T$4\$,kPsH } FNFNFCLkP e {H(sHL$8t|$$H9HKLLTLCHKLQkP9*QSLT$9$wD$L$L$l$\$D$HL$0T$8t$(|$$@ω-D$HD$#3$\$D$l$ D$ =\$D$l$p D$#L$D$D$(L$L$P$|$D$(Ge uD$P1ҍp6D$PP Ld Hd 1CD m8e $;A|$(5bR1L$A/D$L(T$ IL$$L$艶D$D$$L$ L$"$ud \$H|$D$G e uTL$ "$ud \$L$D$ VH|$D$Ge u D$$LD$$N>D$ N‰ȉ럁ĠI7e ;avq"$ud D$D$D$L$ L$ CDD$HT$t D$$L$(ËD$$D$ D$q=D$L$ D$$L$(6se ;ar$D$!D$D$L$ L$$L$CT$D$ D$te D$$D$D$CD$D$ D$te e e 5Ae ;av'D$s c HD$L$ 艱 5e ;a,D$D$ D$$D$(Q$D$0fD$D$ L$L$D$  3$D$4D$D$ L$L$$D$( $D$ D$D$D$ D$KD$L$L$8D$<,4-e ;aD$fu3D$tuD$ D$Í D$ D$fu D$=vɍ D$ D$fuD$=v D$ D$&4Qe ;a(D$,fD$  $ 8ud L$L$L$mD$ L$Pt D$0T$4(D$ D$$2$D$,fD$D$L$ D$ L$$?$D$D$ D$D$ D$詚D$L$D$0L$4(@3e ;aD$t~L$19}k}=B}-si- ^ ttÿwD$ D$ Í- ^ 1։ $D$T$l\$ T$D$L$D$ D$ S |2Ge ;adL$A=D$ ` $dud T$D$^!D$ @tËD$$*D$D$L$L$`$0ud \$\$\$#|$ D$Ge u D$gD$.IY1+e ;ava`$0ud D$D$D$!D$ L$Pt D$T$ ËD$$)D$L$D$L$ 1e ;avD$ $D$D$臊0e ;avD$ $D$0e ;av< @$D$|$e L$u ÉG=0e ;avD$$/0e ;avD$ $D$7/e ;avD$@t H +HL$D$/e ;aD$ Ht?@$D$$D$D$(D$D$,D$ Y7D$L$T$T$0L$4D$8ÍXc $zD$L$@9uiL$ Q-e u@@@Xe u PA`xÉ0Fy&Fx1F뷉 $T$'D$ w.e ;aD$HL$ $l4D$L$T$e BD$L$ BBe u\BXc $@D$T$bxe uD$@D$ D$ D$D$$ËL$y1E܍z1E럍z1EeD$ D$$a-e ;avD$HD$L$ '-e ;av D$@D$,e ;avD$,e ;av D$@D$,e ;aL$ Q \$9sgl<ً_t$9sS$T$RUe Lu&$ e u L$Ë|$C‰Cڧ ,^e ;avXD$HT$9s=ЋZl$ 9s-@L$D$ $\$NhD$D$$X +e ;aBlL$pT$0Y\$$|$<1C `? $L$tL$L$?ЋЋe uL$ AD뛋L$ yD1?C $ЋD$ D$ dD$ H(@,IT$$T$T$(T$T$,T$ $ыD$L$T$T$0L$4D$8|D$0\$4L$8bÍ TH e u@ x k>0&"e ;aaD$0D$4D$8D$ $lD$ D$$ WL$D$ HHL$$ WL$ϥD$ H0uqH8t"D$(D$0D$4D$8WËH(@,IT$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8Ëȏd ̏d D$0D$4L$8Ð߬Í TH e u@ x <譬T%e ;av4D$H0L$$D$D$D$ D$ D$$e ;av4D$H8L$$D$D$D$ D$ D$^$e ;av4D$H0L$$D$D$D$ D$ D$$D$U$e ;an D$ED$$iD$D$$ WL$菣D$HHL$$ WL$[L$e umT$ \$SDS89uC(e u>C,T$e uD$A$謪 ÍyD$:{,1:뽋\${DD$ :댐v Ðl Í TH e u@ x u:: Í0$D$~ "re ;av@ D$H@t.$L$D$t ËD$@@$蔃 i"e ;a D$D$D$$gD$D$$ WL$蛡u8D$H(~($/(oTƋ$(~$(Eo Ƌ$'o Ë$<'߉$4'W׉Ë$'ωt tQI t8c x$V'$@҉ȉԷ$L$0Ve ;aXD$dD$@L$hL$DD$HD$LD$PD$TP$T$`T$D$ L$L$HD$L0$D$@D$蛧D$ L$L$PD$TD$\$ A&L$D$$L$HL$ D$D$D$ $D$dD$D$hD$yD$\H$ $D$L$`L$ D$\H $ D$\H@ I$уX`e ;av.D$ HdPh $T$uD$ H|L$ e ;av D$@$D$ e ;av) D$H@ I$ыD$L$D$L$ e ;av& D$@$D$L$L$D$ C e ;avD$ L$D$  e ;aD$HdPh $T$!D$L$ % $L$L$MD$ L$ufD$u6D$9vD$ D$$D$ D$$ËD$9wD$ D$$ËHLL$ D$$$ e ;av0 D$HQ9e ;atD$|DŽ$@$D$JD$D$(L$xL$D$ $\TT$d$ TD$`D$D$$$ XL$"r]L$$ L$0D$<D$@|$D1 D$D$ fD$LL$0L$DfD$dL$(L$\L$99te69[9>)Չk4k8t)UP)ʅ3@tDŽ$DŽ$ĴÉ$ىT$$$D$T$,$$D$DD$L$L$,$\$D낋C$D$HD$L$D$$D$ GD$L$u7L$ 9O\$DSʋs SΉs $D$(D$TD$XD$\D$`!$D$TD$aD$ L$$$ĴÉD$(D$dD$hD$lD$p!$D$dD$TaD$ L$$$ĴÉ*\$DcD$LD$PD$DH$P(L$T$ ' $^D$L$ L$LD$PbT$D$BD$LD$D$ D$.D$D@L$T$$T$L$JD$(D$tD$xD$|DŽ$!$D$tD$a`D$ L$$$ĴËL$ $DŽ$DŽ$DŽ$!$$D$_D$ L$$$ĴDŽ$DŽ$ĴÍ0$xD$HP 0$pD$.P 0$hD$P 0$`D$O 0$PD$O )e ;a(D$,HhPd$L$AD$0Ht|D$ D$$ }L$ D$$D$,$ L$D$6L$ L$ D$D$BD$,$D$,@lD$4D$8(D$D$ }L$D$D$,$ L$D$6L$L$ D$D$Ve ;a,D$0QhId $T$D$0H(P$ÃÇ ݕtX 9X9 ʄ$eD$ p. e u\L$0HQ$d d \$T$D$ 襞D$0H $ d d L$T$D$0@L,ÍxD$0ȋL$0D$D$ D$$D$(H(P$T$L$ ' $ZD$L$ L$D$ D$0H PT$L$ ' $ZD$L$ L$$D$(UI$D$?D$D$D$ D$S*D$0HT$\$ $\$T$ *%e ;a\L$`QX|$,1i `? $T$T$,T$苝 D$,$D$,L$0QT$\$$hl$ D$(IL$t$`~\|$=`?<$D$l$ D$tD$`H\L$ `? $T$(T$T$ T$ |$D$GD$Ge u D$$ID$$;\ e ;avn,D$0HL$D$ D$$D$( PY $L$L$ZD$0L$T$ $L$T$D$ D$,{ve ;a $HdPh $T$~$I$˃]\$$\$ % $D$)D$ HPHLuSD$$D$pD$tD$xD$|!$D$pD$YD$ L$$$ĀÉ$$D$!D$ L$$$ĀDŽ$DŽ$ĀË$T$$9AH|AXx9@puOT$`D$dD$hD$l!$D$`D$XD$ L$$$ĀÉT$PD$TD$XD$\!$D$PD$sXD$ L$$$ĀË$[>$T$D$\$ @$T$T$(Y uOYI 911ۅ$Y\(q`[zEUm l$T$ D$ |$4$Ӌ$$L$(L$$T$ D$ L$T$\$T$(e iXj\D$,L$0Y$i 5Q9-e [ `ZA,Y0B$Z($PT$ X\$<- ,$|D$ .L$ H e L$}D$ 2D$($\0$D$5= ~e D$;A$HdPh $T$p$$ պL$D$FRD$D$HL$ L$h$$ٺ\$D$RD$D$DL$ L$d$$k \$D$ QD$D$@L$ L$`$$,\$D$QD$L$ L$\$1D$h$L$H$\$d$l$D$t$`$t$@$|$\$$e8CONNWxfECHxT9$kD$?u=HEADu M{$$$$QD$L$D$H1 \$Xى‰L$XT$D$$$$$$$\$L$3$L$ T$$L$T$$$L$ D$D$D@L$H9a$$$$D$|$$D$8L$4T$,\$0vD$?u+$$DŽ$DŽ$ÉT$L\$P`?$$D$]D$D$ DD$@T$I$L$D$ D$ @ED$L$T$PB,J0ɱ$nD$L$PQ,Y0PXQ$Y -Q9T$hD$T $GnD$ {H( e u1L$TH,L$he uA T$L\$Py x,D$TċD$P@,@0CDŽ$DŽ$$$Ë$$D$D$jD$L$ $$CD$lD$pD$tD$x!$D$lD$jGD$ L$DŽ$DŽ$$$Ë$A$DŽ$DŽ$DŽ$!$$D$FD$L$ DŽ$DŽ$$$Åt tuhttp$AD$|DŽ$DŽ$DŽ$!$D$|D$HFD$L$ DŽ$DŽ$$$ËhttpcSsV$ D$gD$A ' 軫Fe D$;A5 $HhPd$L$i$$ =http As $HPL$H$$ʺD$D$D$L$ > 1D$ `?$$L$ SʺL$D$ 譴D$H@r`?$$L$ .L$D$ mD$L$t@D$811kl$,UL$pËD$09CT$,\$lыX$\$>D$ L$ $D$(D$ L$u$TraiuQfleuQruD$l놉D$$L$\tlT$ltRT$D`?$T$L$D$ }|$GGe uD$D1 Dt$D$$L$\뜉 $ƝT$D$aD$ UD$$L$\d $]T$D$1D$ %D$$L$\/l$4UD$8L$t\$D9}ET$4ы@$D$ D$D$ fD$D$0L$L$p1ҋ\$DY`?$$D$.D$D$ м$$u =CONNuAf=ECu AT$$ $D$C7D$ L$!$$L$@D$ T$L$gD$ e $H$D$hL$H  $g$$|$Ge QL$@O$QXATW`e G\e $GT$ Whe T$LWdGe W GGe FT$HWl$$WHe  GD|$XQW e D$hG$T$DWX$HP$T$L$CD$L$ D$`L$($Vf|$|$Te @t$XL$(T$TJx e  D$`B|D$XHc $ |$D$ `W9q|$e ;avP D$H tPt@D$D$ É $ďd d L$D$tD$əe ;aI(D$,HH tP t d d D$<D$@L$D(É $D$0D$D$4D$D$8D$ pD$D$L$L$ T$T$$d 9t^\$,kt6\$,$L$D$ T$D$ D$dL$hQ|$41Y `? $T$T$4T${hL$hD$4$jD$hD$4YT$8X\$ jl$2t$$D$,RT$1t1؉|$D$( $D$|$D$,L$h6$$DŽ$DŽ$0$$D$zD$ L$$$!$D$8$D$D$ D$D$L$$$ĐÉ $D$D$lT$ D$ L$X?$$K D$L$@$$ DŽ$DŽ$0$$D$|D$L$ $$$D$$D$D$ D$D$L$$$ĐË=HEAD`$$D$D$l c $FD$D$hL$L$(ʱ$<|$e L$P$$We GT$LW T$lWT$(@9e aT$hW|$\T$TZ(i r< L$x|$|$H1 D$<D$@D$DfDŽ$P$HfDŽ$h$`fDŽ$$xL$x$|L$D$$@ D$D$$cmKe ;ahL$l|$ 1*D$D$D$fD$(T$ fD$@\$8fD$XL$L$L$ $D$L$ t6tuHD$pD$thËhd ld D$pL$thËD$lD$pL$th le ;avaD$D$,L$ $OD$ D$$WD$AuD$@\D$Ðke ;aD$tmD$L$Q,T$ $İD$L$e u)D$D$@4$#D$ $dzÍD$tЍ0$оD$ jNe ;aD$(HugD$ @L$,L$L$0L$L$4L$ L$$ $ЋD$L$T$\$( -e uSD$8L$AIL$D$ $T$aD$D$HL$L$$$1X\$$$$ID$L$@$T$\$H\$l$$l$ $ЋD$L$T$D$D$ $D$D$D$$D$.D$L$T$T$8\$$$L$D$@D$L$T$D$T$u+httpu$u$K"|$Ge u.BDŽ$p$$ĨÍBy be ;av<D$$`U$D$L$ T$uËI$ae ;a0d L$89Bd 9!9D$ OG T$1g 1ɈL$04$D$L$T$xT$ T$8T$\$l$OD$L$$T$(\$ l$,$$ $L$@\$<$$*D$$ e  $H $Ze L$U $HL$0H]$$`$\$X\$$\$D$L$ L$D$ $$$D$it$$R $-D$ . e xn $nR$A`$$ $~zD$1! 1ɋ$P $l$ $T$L$$L$L$붋D$uD$@D$D4É$衇1D$ud d L$@D$D4É$nދHLt1HHt1P\X`Ӊփ!х Z$|$D$ D$U@D$8%e ;atL$L$TT$x\$|$$$$D$L$D$0L$DL$*D$LL$D^L$xT$T\$|$$$ыT$xD$<$D$0$$T$4T$$茨|$GJe uRmpD$\|$`D$HH L$L$0 $D$L$`T$\T$ L$rD$H|$8Rm멋L$()ˉXthx d T$,9L$X D$0H,L$4 $w-D$4D$$WD$igD$0H@H@PD9 ۉ)с@9…Çݕ8•uH@\$$L$\1ɉL$ L$4 $,D$4D$$WD$fuxD$$t&=L$0Qp$D$D$fD$ t)=L$0Qp\$H[ \$$D$zfD$0@h$nDÐmDÅBL$HQlQliptkm9}dl$D$@$#D$D$=?}=ًT$HZl)Í@9ÅÇݕ8ÕuBlD$0\$$T$H11]WmDÐMmDÉ$D$h 0$D$$h m(e ;av+D$$D$D$D$D$ e ;a D$,L$01҉L$0D$,T$\$(k,$:D$tD$$@D$(H $L$,L$T$0T$\$\$ D$(@D$D$D$L$,L$L$0L$$D$D$3GD$t d D$0 d L$,@$D$ . e uL$(HL$0‹D$,xD$(hȋL$(e ;a\L$`|$,1 `? $T$T$,T$8 D$,$誹D$,L$0T$`(qt$y|$ L$ @tQ L$ `? $l$D$ |$D$GD$Ge u D$ xD$ ujl$(\$$D$蟥e $uD$$Ël$(D$||$$2\e ;a$D$(D$ $3jD$L$@T$T$ $ЋD$,Hu$L$ $D$ЍD$0D$4$D$D$ HL$ P $qD$ L$L$D$ D$$ L$D$)L$L$ D$D$ D$,he ;a D$,D$0D$$D$H,L$ $D$D$$WD$X.D$(HuHD$HJt@JD$,D$0P` Í D$,DD$02` D$D$ <.L$L$L$$D$D$JD$ L$D$L$ $D$D$$WD$Wu@D$Hp $uMD$Hh $vD$ D$,L$0x_ Ðn_ ÉL$,D$0\_ ÐR_ Te ;aD$(D$,D$ D$L$$QT$$D$D$ D$L$$QtD$H,L$ $D$D$$WD$VusD$H8T$tJdT$$R ,9…8u)u%@4$(D$(D$,R^Í D$(HD$,4^Ð*^D$(D$,^e ;ai. e L$(HT$PT$,P e }T$0Pt$F D$$@WVF…!Єt |$4 ËA@D$`?$ʺD$D$ -D$HP$T$L$#:D$ D$ D$ut$댍 w$e L$D$HE$軉D$ P?. e uQL$H$-D$ pD$me L$ ut$N|$4 Ët$~xD$뤋T$zf11x‹D$0t$~ pxD$(y‹D$ȉ(L$yt|$40 ÉD$(W8e ;avD$uÉ$ie ;av>$D$,t/$i|$t$($TD$$Ã$+e ;aviD$tFD$@$贂D$$8iD$uËD$$D$,L$(L$D$jދD$ $D$I{e ;avxD$H@t D$ Ë@D$`?$D$D$ D$P@ $T$D$bD$ D$D$le ;aD$ tbHGS3upR9uFT$t4u R9uD$t D$@D$øBD$ú뷍0$D$Q NYe ;av' D$@L$ $ЋD$L$L$D$ e ;avD$e ;avD$@ L$9D$e ;avKD$(@L$, $ЋD$$D$D$D$ D$D$$D$ 78D$L$L$0D$4>e ;av|(D$0HT$4$ыD$L$,IL$$T$D$ D$D$V?D$D$$L$L$ T$0R\$4$ҋD$ D$8D$$D$<(he ;avD$ se ;ar $D$(L$$L$D$ D$*L$T$T$DL$H<e ;avZ D$(@L$, $ЋD$L$$Yi qIL$ t$l$$T$\$X+D$L$L$0D$4 e ;avD$@ L$9D$ e ;avCD$@L$ $ЋD$$D$D$D$SD$L$ L$$D$(fe ;avD$ D$ :e ;avCD$(@L$, $ЋD$$D$D$D$D$OSD$L$ L$0D$4e ;avD$ D$e ;avJD$ @L$$ $ЋD$L$Q IT$L$ $D$h8D$L$L$(D$,?e ;avD$D$ e ;av3 D$@L$ $ЋD$$5D$L$L$D$ e ;avD$ D$e ;a4D$L$PL$0L$()ˉ!ډT$4)͉l$8D$e ;av D$D$e ;avYL$T$ 9sC\$,D$@$D$D$PD$ L$T$D$ L$$T$(+ue ;avhD$@$D$ D$D$$D$ Te ;aD$ @$KD$D$ fD$L$ u)D$$D$(D$,D$0D$4É $D$ED$L$T$ \$l$L$$T$(\$,l$0D$43TNe ;a(D$0})D$4D$8D$<D$@D$D(ËD$,$D$ ʺL$D$ OgD$tod $D$0T$,ЉD$L$D$L$T$\$ $\$T$L$ ZD$D$$L$L$ $L$D$:踒D$ |=L$ 9P9w|\$$\$4D$8)щ!ىL$e ;aS,L$0QP811ҋYLt T$4D$8,ËYPD$T$yL|$(Yua1ۉD$T$t9iLu-e uYL륉yU똉,$\$iD$T$$D$L$0T$|$(뭋C4K0 $D$#D$L$ T$\$tL$|$(ډÉȋL$0dˉ=e $u(D$0HLHPL$D$L$0T$|$(|$(TD$01QPT$$Y)uPOST $D$ L$T$e uU\$0SPSPt ʉsD$ L$e $uT$0JPD$ L$ʋ|$$TT$0|$$É T؋\$0띃uufPUuuTYu.]PATCu]H<11V11K11@"$L$L$t$@D$D$ $ЋD$D$8L$T$tJd 9t$$  ÉL$lT$<$L$d D$nD$ oD$8uZ$@e $DŽ$DŽ$z$g|$GGe D$t|$pG GG$H$P T$L$ ` $D$ L$DŽ$DŽ$DŽ$DŽ$$T$p$$$`$D$D$D$D$0L$ L$hT$T$,`$L$T$D$ $\$D$D$ ?$2|$D$,GD$0Ge D$hDŽ$DŽ$DŽ$DŽ$$$$H P$L$T$  $)D$L$ $$Z$$D$誻D$ L$$$D$h8ED$t8L$lT$$ $\$$L$D$PP$L$T9|\$5`?$L$dL$ƝT$D$ (D$HeHL$@D$\T$XZT$[D$L$@Ʉt D$5 D$XP T$7 X8h<ÃÇ ݕD$9X \$8r `?$L$dL$T$D$ D$ `?$L$dL$T$D$ .D$@ I clos @e D$X@DHY I$-O9v u I _ HY,q0ÅÇ ޖt XD~H@L$DY\$Tc0-lc 5hc t$|l$<1>T$P֋@ $D$$$ЋD$PPD$XL$D\$Tl$D$$H PT$L$$D$ l$$L `%L$D$$$<D$ $Q0Y,ۇÇ݅҉  \$lT$x返$獴$D$lD$D$xD$$$$HP I$$$$$$ы$H( $D$[D$u $aaIËYQIIË$HEt$$tIÉ$D$uHÍxʼn$I$ $n$M$H$P \$Se u:K$ OP -e uX$x$ʼnz{‰ߋ${Ћ$uH'1 $H`?$L$ ʺL$D$ D$H~'@$$G1؋ Xd 9$$D$D$dL$h9C$H foD$`$$Z RT$\$@$H]D$$L$ $$T$D$ $T$ \$`\$-Ml$D$@T$\$ GD$(L$$L$D$ $$$D$D$D$D$E%FÍ$$foT$D$T$ D$D$L$]L$D$ +FÉ$$D$ \d L$g D$ u \$h@$H PT$L$ @ $[D$L$ $D$#D$D$ D$D$D$D$$$EËH PT$L$$D$ *$$\$h$z,XP$z(@$-H$ω|DË${u httpZ/1.0uhttpuZ/1.1[8\$ $T$L$ D$u VDÉ$$$$$$ " $$L$V$$$D$$늃>'$|$$hD$$$zM\$pT$|B$,獴$,D$pD$D$|D$聃$$\$HP I($$$2$$ы$\$t$謍$T獴$TD$tD$$D$$@$$HP I$$$$@$$ы$$$1vXBÍzw8e ;avcD$$OD$$D$D$ bD$ D$*D$$D$kD$$Ofe ;aB D$(D$,D$0D$4D$8D$$HT $ND$D$$HL$QHT$$ZD$D$$WD$L9uxD$$|D$L$T$ \$l$\$(L$,T$0l$4D$8t @ ËD$$H $Ƿe u D$$@ЋL$$y1@ ÍH $KD$$10$D$C e ;avID$ HT $ D$uD$ D$Í0$D$GC 萸e ;a=,D$0tSHq uPO9ubT$4tJ!؟+u> O9u-L$4uAI $D$D$8D$,Åt)@$Ѕ$D$8D$JֺD$$D$(D$$D$4D$($D$D$$D$D$ D$D$L$$T$D$D$ L$iD$L$L$D$ 0$D$D$OD$ L$ $D$A (e ;a_,D$0tHp9tTHq uPO9ufT$4tK!؟+u? O9u.L$4uAI$L$D$D$8,Åt5@0υ$\D$D$8,úD$8,D$$D$(D$$D$4D$($D$D$$D$D$ D$eD$L$$T$D$L$ D$D$L$D$L$ 0$D$D$QND$ L$ $D$]@ 覵e ;av& D$$D$D$D$D$T$Ѓ ce ;a/0D$4HT$8$ыD$$:D$D$ ID$ D$w%D$4HT$8$ыD$$lD$D$]D$ D$7%D$4HT$DT$T$8$ыD$L$0HL$8Q0I4H4 e uP0D$D$@G- $$D$X$D$8$ĜËD$@Y뽋D$P$T$\$D$ u \$0$@H@ L$ D$$$D$TD$D$4D$ D$L$T$\$ $$$$ĜÉD$L$+FD$D$,L$L$D[$b|$D$,Ge u@D$DG-D$LH@  $$$$ĜËD$D?뻋HQYi qL$$ $\$T$t$ l$D$L$D$H$^ED$D$$L$L$<[$0b|$D$$Ge u@D$<G-D$HH @ $$$$ĜËD$e ;a D$$$; D$D$$Pu ַ$D$L$T$ hD$L$T$\$u8z9uRD$$$D$L$D$ L$D$(L$, ÉT$(\$, ËԎd Ўd L$(D$, É$`lD$OD$,' 5e ;avOD$@t8H8P4@0$T$L$^D$ D$5D$D$ D$ ʐe ;a\D$lD$pO$iPD$L$dxe \$hXD$H|$Dlud b@$#PD$L$HQe $P{e AQT$$ D$|D$`$D$L$D$HD$L$` $D$OD$ XD$HD$ L$`L$D$$ST$nd  $D$Pc .L$D$  D$D$`D$zD$D$u56D$ D$$D$ D$$D$ D$$P I B kue ;a$D$, xL$(QYi   9*9"\$ A$D$D$0PT$ c c -c \$ T$l$舲D$D$ 9 tQ9\$09L$)ˉ!ˋl$($D$T$c c 5c t$ \$T$D$u D$ L$t D$8D$< $D$8D$<$D$8D$<$D$8D$<$D$8D$<$y s=e ;avuD$L$9wb)T$ )!ЋT$1B9}1v tk vwD$D$ÍID$D$ soe D$;A$:DŽ$ DŽ$$DŽ$(DŽ$,$$$D$ID$L$T$ \$l$D$D$T$P$1車$Q$ $ҍt$$$qL$L$+$$UL$+t$$9$$ ‰ щʁ€׃ !ʄ?nd $9@$D$D$$ @ $D$D$$$(L$ $L$$ TT$v9$D$$ L$ $T$$\$$l$$l$$-Tl$&3$D$L$PQT$UCD$ L$T$Y9o\$T$iqy$~l$t${9 ͈ 1 8C$$$9}U w9~׉\$pL$\|$l 3 $D$|$T$ t$DD$L$T$qL$\\$pl$t|$l댉T$X|$T$$Y,D$|$T$ $,$ӋD$L$$($,ED$X`$$L$$T$e D$ L$$L$$D$D$ L$XL$D$L$$($,D$TW$4A=W$Z$ T$XS $\$TT$XAA$$l$Pl$+D$L$ T$y D$P=L$TQ\$X9$D J9RDT$T9R9J\$X$ $$L$D$D$TL$X$X9|$\$TL$Xl$D݈݇ވ\ދ$h,T$\$L$ $4$ՋD$L$$($,D$X`$$L$$T$E D$L$ $D$$D$D$ L$XL$D$L$$($,}D$T $QQto$%,|$Ge u?DŽ$ DŽ$$p$($,HÍf뼍$+D$L$T1$$Q F3$D$D$j>D$L$ T$$C Se KL$X9$L$XD$T$`$$\$$\$]D$ L$$L$$D$L$TL$ T$XT$D$L$$($,$H P\$T9ً$9t$l$\$D$TH9 $TX9 D ‹$P R$ $$DŽ$(DŽ$,XÉˋL$TiL$TQE $$D$T$L$XL$ DqD$L$$Ge u/#Í 3 $D$D$bD$tT$(ՋT$(BHˉ$D$uT$(랍`ȡ$6D$ 04Pe u3L$(A,A0e u A(K|$$Hlj}H‹Y,I0ɇÇ݅ۇÇ t ȉz7Hz (HSO8ωƉHO4ωƉG׉ʼnGGiFD$,D$0H,@0L$D$ '$#D$L$ L$,D$0ޥ$D$,D$,D$D$ D$՗D$L$D$@D$DL$H4É1!y/re ;aiD$ H P…!Ӆ لt D$$ËHtH}xuAfGEu7ZTu.t$D$ @D$$D$$Ãu(HEADtÃu DELEu JfTEt1몃t^uSEARu ZfCHtu"OPTIuZfONu ZS`u PROPuJFINDB뗉L$T$$L$kʺD$D$ jD$D$ L$T$L$D$ T$O .we D$;A$D$j$ e T$NPLH PT$ L$D$$ TL$$A$ D$ D$D$L$QLDŽ$DŽ$DŽ$Ƅ$$1ED$DD$HfDŽ$$$$fDŽ$$D$DD$$$D$D$ $Q T$d+UA QD$xD$|DŽ$DŽ$p \$xL$|$$`$D$D$-D$D$(L$ L$TT$T$0`$L$D$T$ \$x\$D$D$H$D$L$(HL$0H e u9L$T $J e uB BHË|$dCNjD$TC뾋$D$@$L$#$T$<$\$`l$L,$D$< d T$@9QR$D$D$\L$#D$pD$tL$@L$pL$`L$t P  $L$pL$D$L$ DŽ$DŽ$DŽ$DŽ$P$T$\$$$`$D$D$>D$D$,L$ L$XT$T$8`$L$D$T$ $\$D$D$F$D$L$,HL$8H e u6L$X $J e uB |$d&ANjD$XAR$dD$L$#$Q YDŽ$DŽ$DŽ$DŽ$-P$$$$`$D$D$D$D$$L$ L$PT$T$4`$L$D$T$ $\$D$D$sE$D$L$$HL$4H e u6L$P $J e uB |$d?NjD$P?D$hD$lT$hD$`D$lP $D$hD$D$L$ $Be uJ D|$d[?$D$`D$ d L$orD$ t?$Ae uA AA |$d1>D$ G'Be ;aD$H,P(jZ*U]chun?]fke)]dÄ$X hۇÇޅÇ! ח! ӄPuPOSTu D$ ÃufPUu XTt߃uz $Iui idenu[KtitytBu8fGEu)HTu D$ Ãu =HEADtD$ ÃD$ 111D$ D$ D$ 1111%Ze ;apD$tH$x$D$D$tH(P,Q chunQfketIdH8\ 0 $D$D$D$D$(L$L$$T$ T$4\$t[8|$@1&=`?$\$D$@D$HD$(L$$T$4D$@$D$(L$$T$4D$(L$$T$<\$@C $D$٢D$ D$,L$L$8u"TraiuQfleu Qr9T$$Zl$(98t$;/0$L$$P0 Ɲ $D$|$D$ D$Ӌ$뎉58뻉$$p1111zD$x$L$|L$T$D$ zD$L$ND$tH P$L$D$ D$ L$$D$L$D$ D$&D$L$D$L$ D$x$L$|L$zD$L$$tH0u D$tD$tHP $T$D$ D$ D$$P0  $D$ |$D$ D$ ы$뎉A5뻉$$p11 e ;aXD$\HjH(P,UQ @chun+QfkeId pT$`9L$d~X<4L$dT$ L$8$D$L$ e T$8PD$D @ $ RL$D$D$L$ $D$#D$D$\D$ 6{D$L$o11ۋl$ t$8O\$$T$(t$dl$`D$czu 9u%tD$DD$H<ÄCX$ݻԄA@$lj˹먉릍$[|$G2e ugpD$D|$H<ÍgD$DD$$D$H<Ëtd pd L$DD$H<ËD$@@$D$D$DD$H|$=`?<$D$l$ |$D$GD$Ge uD$닋D$뀃PË e u D$XPËD$Xme ;a$萣|$Ge u.L~DŽ$@p$D$H4ÍL~͉$L$D$t $< DŽ$DŽ$$<D$0${D$L$ $$]i$D$$D$D$ D$JD$L$DŽ$@$D$H4Ë$<$Q$d|$Ge u\ oL$4O e u-D$\GDŽ$@$D$H4ÍOω‹D$\čo럋@$<T$ $ЋD$L$T$ ؎d 9t$@$D$H4ÉD$`L$pT$<$L$܎d D$O,D$ t D$+;D$`L$pT$<1u&2httpursÇ11 $軮$ |$Ge u.}0DŽ$@p$D$H4Í}0_͉ $U$觠|$Ge u.eDŽ$@p$D$H4Íe͋nd ae ;a @$D$,D$L$0L$~D$rd L$,90D$$$VD$"L$,9uuD$(H tt8Ip9u+11҅…!ʄt D$4 ËH(H0P,ÅɇÇ ݕtˉщ뵹멋D$(P tjRp9YP<fGEuXTudtR#9u D$4 ËPd 9t D$4 É $D$0D$Td D$q)D$ tD$4 D$4 Ãu =HEADt1돃tEuTRACu XEbuϋOPTIuPfONu@S;뫉T$D$$T$ 䪺L$D$ D$D$L$,T$D$L$,T$kP(;D$4 É $D$0D$d T$`(D$ D$4 D$4 7e ;aTtD$xH(L$8 $"D$8D$$WD$\D$x0D$4$Y D$L$!9]D$,$D$L$|L$$\$ D$>莧$D$0|$D10!$L$,L$L$DL$N D$D$D$Dt_L$HPY\$( L$$-!,$t$0t$D$T$ D$L$$ e u L$(H뛍xD$(덍!$L$0L$T$|T$$T$ D$$ e u2$HD$4$!D$D$0D$ ctÍx$(1bt$=D$D$ D$|D$ $D$kD$D$D$ L$L$D$\IQ L$dT$hI $xD$L$D$lL$pD$XPHu11ɉL$tD$xTËD$\$ЋD$L$\$ D$`tυtL$$\$0$詛D$D$(L$L$ $L$=D$t L$$\$0빋D$(D$DD$ D$HD$LD$P0$D$DD$DoD$L$ D$LL$PC$D$D$LD$D$ D$v>D$L$D$tL$xTËD$,D$4D$D$8D$<D$@0$D$4D$nD$ L$L$ID$$v$8s$p |$d$ $$D$$ WL$R$t$dq$HL$  $$T$趡D$ D$0$L$D$T$DT$=D$D$0B$HH $t$dH L$ ` $$T$*D$ HP$kll9=L$$T$ D$4$1F9}yߋ9ut$,D$HD$L`D$Hl$L h $D$T$HT$D$ D$-D$4L$$T$ $t$,$뀍|$|t$dJދ\$$9FD$@L$,\$(<e ,F D$`$D$|D$肥|$ D$,GD$(Ge D$@$HL$< $$T$y$HhT$<P~9HQ^1ҋZ j5`9Z96z5e r-e sBBQJQ|$8HL$ ե $|$6D$8$ `d dd L$T$6p$$L$8L$$HtPxÅɇÇ!҇Ç ݕt$ktt|L$T$,$r辡|$Pe $y`u,t$PDŽ$DŽ$VÍ$|$D$PD$@$)D$ P. e u\$H$QtIx$L$D$\se L$ u$Ht,$zt^x$F뙃߉41+Z!z1$ƉQ1}D$@)-`,$D$T$\$ L$蛢D$L$\$AT$ $$xld hd $$7Uý葘e $u$H $z $|d xd $$TÍ$t$d$HL$  $$L$?DŽ$DŽ$nTÐaTË$d d $$:TËd d $$TÉ$t$'D$a ze ;ahDŽ$D$lHdTD$p$<t$|$ D$l$D$lD$$ WL$KD$l@H|$8t$ EHL$  $T$8T$dD$ L$t$ShÍ@~$D$>#D$D$|$Pt$ L$lIL$  $L$PL$蘟|$ e uD$닋D$e $u D$lH)T$lz\RhDŽ$GRhYe D$;A$DŽ$$1"$ $;t$|$@$ $$L$$WT$I$t$@$H L$ ` $$T$誚D$ L$PX K9DL$ \$|$Xt$@%L$ T$D$$$H L$ ` $T$XT$ɝ|$ D$ GD$Ge 8D$$$H$L$(PT$ ե$L$D$ L$tt$QX9uFx-e -e pu|s@@BHBAD$ ե$T$(T$$$Q>D$S$p`$OĠÍ{É1k{1mʼn5D$$$|$pt$@q$H L$ ` $T$pT$|$,5P'CDŽ$$t$,(OĠÐOĠ{D tC e ;av[ D$$ D$D$$ WL$FuD$$D$D$'N ÐwN e D$;A$Ht$QQT$ ե$D$YD$ L$t{$QX9uJx-e !h5e k@@BHBAD$ ե$$D$$p |$0p|$xt$0c$Q T$`$\$x\$諔D$ HP$1E949u9l)ډ)ىL$(!͍LC9G|$$t$ D$,-`,$L$T$L$(L$ )߉ۇ!ߍ\$)։t$l$|$Ht$0~$@ D$`$D$HD$6|$ D$ HGD$$Ge u D$,ĐËD$,S$9u|$`t$0 $@ D$`$D$`D$蓝뮍{É1k{1 ʼn $e$a A 3e ;aD$HL$ $r D$D$$WD$dCD$H$toL$ tH@$D$ӥ$D$D$茸|$ e uD$ JËD$ @$D$ӥ$D$D$D e $u D$H$sT$z$^iJe ;aD$(D$HL$ $MD$D$$WD$?BD$H$L$ ӥ $T$ T$&D$t|D$$tQD$@$D$ӥ$D$ D$D|$ e uD$$D$(IËD$$D$@$D$ӥ$D$ D$D$(FIÐie $x;A $|$$e h $8$IZ|jx1 $$$l$@ ؋ $L1|$$$$  $L$$t$$L$$L$$tPuO$ $$D$TD$$$(DŽ$,DŽ$0É $|$$ 5t$$8$P獴$8h@$D$D$$$ $.t$$$thc dc $$1 pN.$$$$$ $$$t$$ @ $D$GD$$ A $n}D$ O. e  $H$  $$T$D$,$ Hp$L$D$T$@T$ $T$$T$$T\$$$B$ $ED$$DŽ$DŽ$DŽ$ DŽ$$Qp$Y|ix1E$ЋD$$DŽ$DŽ$$1|$XfDŽ$ $$$$fDŽ$8$$0$$4fDŽ$P$$HfDŽ$h$$`fDŽ$$$x$$|T$XT$$$D$$HDL$  $L$,L$Ɔ|$D$$HDL$  $T$DT$M|D$ $냐4ļÐ4ļ^e ;a$D$(H$ $D$ND$tD$,D$0$ËD$(PI$э|$D$D$L$L$ T$(Zr !$D$D$,D$ D$0$謬We D$;A$HIX $TD$$H@u"$H@ e I$H<$H($P$T$p $kD$L$pe $P$X$D$t@ @ $D$g$HT$T$xY`I\ɇÇ݅ۇÇ 1ɋ$D$\$t\$ L$T$$ tTL$DŽ$DŽ$D$x$$D$$$tmD$dL$|D$p@$ $Ћ$tP,uD$d$D$|$É5@rD$dD$\L$|L$`'$jD$$L$t $=t$e $$tQ,ux e uV$$J, J$ e u$D$tB(DŽ$DŽ$Íz(D$tՋ$z,$g룉狴$D$\D$`a$\'$$D$$L$\$lL$h`D$SiD$ O. e u,L$xHL$h $L$lL$D$ML$ T$xxD$xɍx‹$z$$x<$gۨ6e $P;A0$T$nh|$$8e $@$8$t$$<$D$D$$0  $D$D$$, @ $D$D$$( @ $D$qD$$$ @ $D$PD$$  X $wgD$ e  $4H$e x $m$<$0H@$,HD$(HH$$HX$ H\$8$$<L$D$$8Z$u%httpuRsu$4ZT# $QD$L$$4$$8\$$<l$5t$ D$D$L$D$L$ T$$\$($8u DŽ$T$X$\0ÉT$l$ ȱ$e|$G e u{ GFG  e uJ OL$lO e u$G$0hO$ω‹$ڍOω맍GF뀋$B$e J($8Y uhttpu Is3 Y usockuIfs5 HXu+http  httpKsJ($Z$$$4n $$Zd|$$Ge ) Lߺ $$dD$$8QY P e X$BYA ZHe BD$B $D$L$7@$$D$$L$AD$L$ L$D$$$f4`$$D$$L$@D$L$ P9‰$L$|X$$D$rD$L$T$ H$8t"HPu httpu JsL$Q,tZtZ R-$4PpP $qbD$$ 3 $D$D$XuD$L$$T$ $|1躺$|$$$ $$$DŽ$DŽ$ e \$$|$H03$D$D$tD$$L$$T$ $$`aD$$H $H e $H "H e us$HA4L$$|TD$趴$D$$ TL$蕴$$TDŽ$XDŽ$\0Íx$9x4‰-vx$> $$D$$|L$ں$x0$Է8$!`$H(P$\$e { uGK$4K$\ H$ e uX(Nx(a;$ S׉ʼnC{$44  $l$$L$$$ |$4T$\$ `$L$蝬D$L$$8H@ $k([$5 9l$$L$ЋD$$L$ $X$^D$$ e u.$H$TDŽ$XDŽ$\0Íx$Nj$$$$$L$ D$L$u $8zDŽ$T$X$\0ËH$L$D$D$ D$$D$$L$$$R$$ҋ$}^$]|$Ge u. лDŽ$Tp$X$\0Í л͋$H$@ D$x$(]|$D$xGe u/$DŽ$Tp$X$\0Ë$x̉$$$@$ $DŽ$T$$X$$\0Í $v\D$$ 3 $D$D$]oD$L$$T$ $1迴$$$$L$|$$$DŽ$DŽ$ e u$$$ $$D$$L$"1̉¸H$Z$nû\$D$L$ D$ zDz$ڲdx‰ɲ${踲Lߺ覲e4$BL$8D$L$$$E$ZD$ P.$H e u$H$x$$pB$$J($X $ӋD$L$@ $ЋD$L$$$T1蟲$T蓲 $XDŽ$\$$`$dDŽ$T$8[BZ \$D$ $T$$8D$$<D$$D$ $\$L$D$LD$,L$0h$$$@$ $DŽ$T$$X$$\0É$CD$t $[$X|$D$tGe $$$Q AW e G$}XTL$PADŽ$pDŽ$t$l$=XD$ . e u#$H$x $8Sx$蓯ҍO腯U$t$ D$L$ $D$D$L$ T$\$$8 u DŽ$T$X$\0ÉD$p$ ȱ$UW|$G e u{ GFG  e uJ OL$pO e u$G$0hO$ω‹$聮ڍOωi맍GFZ뀋$$T$L$$L$ D$L$$8u DŽ$T$X$\0É$L$h ȱ$@V|$G e u{ GFG  e uJ OL$hO e u$G$ 0hO$ω‹$lڍOωT맍GFE뀋$8$HXgz(B $.$4PTL$\$-,$D$\$L$ ыD$L$T$\$$]$5e *U($8u DŽ$T$X$\0É$L$d ȱ$T|$G e u{ GFG  e uJ OL$dO e u$G$ 0hO$ω‹$ڍOωګ맍GF˫뀅 9$$t Y($yD$L$$$$H$@(D$$ AD$d$tP,u.DŽ$T$$X$$\0É5!$D$\$L$`멍'$-SD$$4$ $zt$e $4迯$tQ,u?e u$4$B,$8$z,$4F܉狴$4`D$\D$`Ћ$떍$7'$$4D$$L$٬$OЋ$9$S$R|$G/e ˽$8u&pDŽ$T$X$\0É$ ȱ$Q|$G e u{ GFG  e uJ O pO e u$G$0lO$ω‹$ƨ܍Oω讨맍GF蟨뀍˽蒨 }(Ɖ聨QY$|$$<D$B$x@$0:yD$,+yH$(yX$$ y\$ [x$4ȋ$4$|$$@D$譪$D$D$ & @e ;avfD$ H$P(I,\$$\$\$(\$\$,\$ $ыD$L$ Q8‹l$t$yHPu) httpu111݉ӉʋL$0aL$ T$L$ T$ۃu(MhttpuMstL$ T$븋L$ T$뮋L$ T$뤉ee ;av; D$t $/D$L$L$D$ ËH@ D$L$ e ;av{D$ H L$@D$ $D$]D$uD$L$L$$D$(ËD$$L$L$T$D$ JwD$|L$9vE  nie ;a4|$1趥 0 $T$8T$%L$ T$T$L$ 0 $T$@T$%L$T$ L$$T$( 0 $L$HL$j%L$ T$T$,L$0 V $D$L$L$D$ D$L$T$T$PL$T4背e ;a0D$4HTPPÅɇÇ!݅ ݕ@… ڄD$(D$, '$D$L$#D$L$ L$(D$,nټ$D$ D$(D$D$ D$D$L$D$DL$HD$L01ɸt\$<9ˇÇ9ՇÇ!9 ߗL$@9X$h([t$8t$T$L$ ,$ӋD$L$T$d 9t-\$4kP)ŋ{TkP)lj{Tl$DL$HT$L0ÉD$ L$T$$ $T$d D$`D$ t\$4CMD$ L$T$$뒋D$ L$T$$넋L$@EC le ;avC D$HxL$ $D$D$L$ $D$D$ e ;avvD$D$D$HxL$ $FD$ D$$WD$8 u"D$D$L$Ðsne ;av@ D$HxL$ $D$D$L$ $D$D$ e ;a4|$P1WL$8QxT$$GL$L$$ WL$9D$8L$XH$@(L$PD$TD$Y|$ t$<ХD$$L$ tv щ ȁ׃ !Ȅt9?t b4Ét$D$$D$D$bD$$d d L$D$b& Ð Ð /*e ;a8D$LD$<$D$L$D$@H L$$ $JD$@HL$ @D$T$$$lD$Pd L$L93#9uL$TD$PD$X8ËD$<$D$D$Le ;ad,BJ Z\$$R t ID@$D$L$T$$ZL$D$H$L$jD$D$L$ L$ $l |$D$Ge utL$L$O e uGL$OL$0O e uD$4G D$8|$<,ÍOω‹D$4b؍Oω‹D$b몋D$zb뇋A$L$D$ D$(L$  $ND$(L$ \$$ !J|e D$;A,JZj RT$xI t(|$|1b `? $l$T$|T$% D$|$^(L$|$T$xhl$(0t$P@D$,9|$TIL$8[$FD$ <$L$\$sD$t$HL$ `? $T$TT$T$8T$ ^Z|$D$(GD$,Ge u D$P=D$P`/ e u$L$xË|$x$`\$\l$X$Ht $D$D$LL$L$t11l$HU\$' ËD$LL$t9}pT$H\$'D$dX(l$\$ $l$\l$UD$tD$&D$dHD$L$ $L$\L$\D$&vu l$XD$X$ SʺL$D$d$1`  $L$\L$$L$#111|$LG\$D$2D$H$L$$L$(T$D$ >D$D$} D$4Hu L$T$1B\$0 ؋i t$H4$|$$|$L$l$ $ ыD$0XD$4L$T$9|D$4L$T$똋L$&e ;a\JL$ T$`f|fcfT$dT$YX|$,19? `% $\$L$,L$[L$dT$)щL$D$,$L$\$dD$,t*D$0PdPd, 9͇Çޅ–8Жuhd뺋D$ H4 $TWD$dL$ D$hD$l\Í D$hPD$l\D$$D$(X$fT$D$dD$D$L$ L$$D$(D$ $:D$D$D$$D$ D$D$V^D$dOfuD$d:f\D$dǁ$e ;a4BD$$Z\$ jl$(R T$, $|jD$$@\, $mD$$HQ$I L$T$  $"D$$$D$D$D$(D$D$L$D$,L$0D$ $D$,D$"~4#4e ;avBH@ D$ $m#e ;avD$$D$D$m#e ;a((BD$ J L$$RT$\$0j`D$,$l$wD$L$T$ \$l$t$  e V^n L$$txNR9ubu\AL$, $D$D$|D$0t$D$H`H`}@`D$4(ËD$Hdt@`1룹D$4(Í~W:~M:~ C:N"e ;av"D$ PD$D$D$D$D$X$D$D$D$L$ D$$L$(D$,D$0 Íz$|$t$5;. 9e ;a T$/$eD$p|$|$e ua=D$D$p D$D$D$X$D$D$?D$L$ D$$L$(D$,D$0 Í/$|$t$e:^9e ;av%ZD$@e D$D$ D$e ;avpD$$D$Hd 9tÉL$$d D$jD$ t݋ ȍd ̍d T$ e uB뼍z6te ;avk\|$HID$ L$\$ -e uhC\$ tkt-d 9tS $D$D$$ÉD$L$ $D$ d T$m\D$ uЋD$L$\$ 봍{)둋D$ tPu D$$$D$e ;avG BD$J $ FcL$jD$$D${tD$D$ re ;a BD$J L$Rd l$$9t1ۈ\$\$$D$D$NjD$uBD$$uD$,D$(D$0 ËD$$聆D$L$uD$$҉L$,D$0 ËD$$D$sD$$묉T$,$D$(D$ d L$Z\$ T$We ;axBD$(JL$$D$|Q$\$yD$D$ $ XL$;L$ L$,T$$RH|$01'D$D$D$fD$8L$(L$0fD$PL$,L$HfD$hT$`L$L$L$0 $D$jL$ T$t(tu6D$|XxD$|IxÈT$|;xÐ1x Fe ;av4 D$u ËD$@L$ L$$D$lJe D$;A2e vİu薍 e Wâ>I"j*+f3q5" &6*Zc|;&LRauӑxi$D$-pD$ L$ d e 1d  $-|$|$pe 15l*D$p$D$D$e L$ ;1 ud $D$oD$L$ Hd e 0 Ld nּ$D$ ZoD$ L$ d e 0d $D$D$D$ t$t$le 50=d )X$D$nD$ L$ 8d e /d :$D$[D$ L$ d e ďd ߽$D$1[D$ L$ d e d L߻$D$i[D$ L$ hd e fld  *$ie L$. $d  $D$aZD$ L$ d e d $D$!)ZD$ L$ d e d H$D$?YD$ L$ d e fd 8C$D$>YD$ L$ xd e |d 0~$D$YD$ L$ d e d w$D$IYD$ L$ d e d 5$D$;YD$ L$ d e Fd V$D$XD$ L$ @d e Dd u$D$"XD$ L$ Xd e \d e0$D$iXD$ L$ `d e ndd if$D$1XD$ L$ Џd e &ԏd "$D$WD$ L$ d e d $D$8WD$ L$ Pd e Td vC$D$>WD$ L$ Hd e NLd 6k$D$(QWD$ L$ 0d e 4d $D$D$nD$  $D$=D$ L$ d e d  $e |$|$PW5<D$P$D$D$e L$   ud $D$D$D$ 4e =0d t$l$D$!VD$L$ d e O d $D$L  $D$T$D$ D$ $L$LL$T$D$ D$ $L$LL$]T$D$ D$ $L$LL$ƝT$D$ RD$ $L$LL$.T$D$ #D$e 4D$LXud ,$D$TD$ L$ d e Ďd Ǽe $ d 諼e $ d R$D$6nTD$ L$ d e Dd W$D$H  $D$]T$D$ ,D$ $L$HL$ƝT$D$ D$ $D$HD$ .L$D$ D$e  D$H\ud e&$D$$SD$L$ Ȏd e 9 ̎d O$D$@QSD$L$ d e  d $D$"SD$L$ d e  d $D$1RD$L$ d e [ d uۺ$D$RD$L$ d e  d 9$D$qRD$L$ Xd e  \d x$D$9RD$L$ d e } d $9e |$|$D2 5 D$D$D$ D$ e L$  ud 迹$D$@  $D$D$|$ Ge  * $L$@L$D$|$ Ge C ͺ $L$@L$D$`|$ Ge   $L$@L$D$!|$ Ge   $D$@D$D$|$ Ge G кD$@`ud  ʻ$D$QPD$L$ Ўd e  Ԏd ;$D$PD$L$ d e  d e $y pud $D$D$D$ e  =Pd t$lH `$D$<D$ D$ D$<1 PD$<у<}ZL$0\$`$D$|$ D$0 `o\_e u륉É똋 e Jdud d d d e d |$D$!ND$L$ d e  d &$D$$ND$L$ pd e  td $D$D$L$ t@$L$蟺D$L$ d e  d $/D$D$8 `.  $D$#@@0#@4@$ e L$8A d @$D$}Be L$U td $D$!_MD$L$ ؎d e   ܎d Y$D$''MD$L$ d e  d ,$D$-LD$L$ d e w d 5$D$2LD$L$ xd e - |d  $D$,LD$L$ `d e  dd *$D$5GLD$L$ hd e  ld :$D$!LD$L$ d e O d $D$"KD$L$ (d e  ,d $D$KD$L$ d e  d $D$2gKD$L$  d e q $d $D$#/KD$L$ Pd e ' Td V$D$JD$L$ 8d e  $Pd D$$D$-=pud +{=d M=Ԏd к=`ud D$@Sͺ*f= ud $|$D$e=d cw=\d Q-=d ?=d -=d O=d =̎d =\ud D$Ho=d =d h=d :=Ďd =Xud D$L=d y|$tt$lE$0d D$D$tD$7;=ud 5 $|$D$=d T=4d =Ld =Td `=d =ԏd =dd =\d @=Dd =d t=d dh=d T =|d D=d 4=d $H=d =$d =,ud n=@ud 6=4ud =Fʺ.`Y$P l^k`=蚲e ;av"YuD$ $D$(D$=Wō|$ 9;uى#e ;av4D$D$D$D$ D$D$D$]e ;avCYu@D$$\D$L$T$\$ l$L$8D$<\$@l$DT$H薱뤍|$9;u#e ;avD$D$D$D$ 9Je ;av* Yu'D$$X9D$L$L$,D$0 뽍|$9;uщ#e ;av'D$D$D$D$D$;貰e ;avBYu?D$$D$8D$D$Yu;D$t%H$L$D$L$ D$L$& {멍|$9;u#e ;av: D$$L$L$'D$L$ $D$D$D$ e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$D$ 1݉4$T$l$L$ D$\$vqe ;avWYuTD$ t>$D$$D$D$(D$D$,D$ *D$L$T$L$0D$4T$8 % 됍|$ 9;u#e ;avWYuTD$ t>$D$$D$D$(D$D$,D$ 'D$L$T$L$0D$4T$8$ 肢됍|$ 9;u#e ;avxD$$L$L$D$L$Q$D$D$*D$ L$Q $D$D$L$$ $D$D$r*D$ D$le ;a.D$H\$k391ɄKP9KPh s 91ɄKPhs9tV1ɄtLK Sh p9t1ɄtK$@$9D$14$T$l$L$ D$\$1‰,$t$T$L$ D$\$1뉉,$t$T$L$ D$\$M1v1o$L$l$NL$ D$\$臠e ;av. Yu+D$@L$ $ЋD$L$L$8D$< ;빍|$9;u͉#e ;avNYuKD$ @L$$T$HT$T$LT$T$PT$ $ЋD$L$T$T$TD$XL$\軟뙍|$ 9;u#e ;av. Yu+D$@L$ $ЋD$L$L$8D$< [빍|$9;u͉#e ;avC$Yu@D$(|$@ L$,L$ t$PfL$ $ЋD$L$L$dD$h$뤍|$(9;u#e ;avC$Yu@D$(|$@$L$,L$ t$PL$ $ЋD$L$L$dD$h$v뤍|$(9;u#e ;avC$Yu@D$(|$@(L$,L$ t$P膻L$ $ЋD$L$L$dD$h$뤍|$(9;u#e ;avNYuKD$ @,L$$T$HT$T$LT$T$PT$ $ЋD$L$T$T$TD$XL$\苝뙍|$ 9;u#e ;avBD$$L$L$D$%D$ L$ $D$D$D$e ;avHD$T$9u1JRX@9t 1D$É$L$\$qD$ 1豜e ;av^ Yu[D$$tE@ $D$D$(D$D$,D$ D$0D$scD$L$T$D$4L$8T$< 2 +뉍|$$9;u#e ;avaD$$L$L$D$_$D$ L$Q$D$D$L$ $D$D$)$D$ D$蘛e ;avuD$T$9u^HZhr9t/1Ʉt%H Z 8u@ J 8D$11$t$l$L$ D$T$1oe ;av14Yu.t$8tݷD$$D$$D$D$(D$D$,D$ 誤D$L$T$L$0D$4T$8 肘됍|$ 9;u#e ;av9 Yu6D$t D$$D$D$D$D$ ' 뮍|$9;u‰#e ;avBD$$L$L$D$_ D$ L$ $D$D$D$跗e ;avVD$T$9u?JX9u1J XR@ 9t 1D$É$L$D$D$ 11Ce ;ave$YubD$(tLHP$T$L$D$,D$ D$0D$D$4D$D$8D$ D$L$ D$$D$$D$D$(D$D$,D$ D$L$T$L$0D$4T$8 p됍|$ 9;u#e ;av+D$$D$D$D$D$ D$pe ;av&D$T$9uJ@8D$ 1Cpe ;avBD$$L$L$D$D$ L$ $D$D$D$oe ;avHD$T$9u1H@ZR9t 1D$É$D$\$葭D$ 1oe ;avEYuBD$t,P@ $T$D$4D$ L$D$L$  o뢍|$9;u#e ;av>Yu;D$t%H$L$[D$L$ D$L$ n멍|$9;u#e ;avNYuKD$t5@ $D$D$ D$D$L$T$ T$$L$(D$,2 +n뙍|$9;u#e ;av2Yu/D$ tD$$D$D$ m뵍|$ 9;uɉ#e ;avAYu>D$t(D$$D$D$8D$ L$L$ D$$_ Xm릍|$9;u#e ;av'Yu$D$t$<  m|$9;uԉ#e ;av'Yu$D$t$; l|$9;uԉ#e ;av1Yu.D$ tG$L$D$L$_ Xl붍|$ 9;uʉ#e ;avYD$$L$L$ׯD$L$Q$D$D$xD$ L$ $D$衯D$D$ke ;aD$HT$(r9tI1Ʉt?JX9u1H@ ZR 9t 1D$É$L$\$D$ 11ى,$L$t$L$ D$T$$k_e ;av8 Yu5D$t$D$D$zD$D$  j믍|$9;uÉ#e ;avGYuDD$t.$D$D$D$ D$貧D$L$ L$$D$(Y Rj렍|$9;u#e ;av>Yu;D$t%H$L$KD$L$ D$L$ i멍|$9;u#e ;av>Yu;D$t%H$L$苷D$L$ D$L$ {i멍|$9;u#e ;avBD$$L$L$'D$L$ $D$D$D$ D$ie ;avWD$HT$Z*09t1Ʉt@J8D$1,$t$\$覦L$ D$T$he ;av1Yu.D$ tw$L$D$L$O Hh붍|$ 9;uʉ#e ;avYuD$t gˍ|$9;u܉#e ;avWYuTD$ t>$D$$D$D$(D$D$,D$ 躠D$L$T$T$0L$4D$8y rg됍|$ 9;u#e ;avD$D$?:ge ;avD$D$ ge ;avD$D$fe ;av'D$D$D$D$D$fe ;avGYuDD$t.$D$D$蚥D$ L$T$T$ D$$L$(9 2f렍|$9;u#e ;av'D$D$D$D$D$ee ;av>Yu;D$t%H$L$英D$L$ D$L$ e멍|$9;u#e ;av=Yu:D$t$HP$L$T$4D$ D$# e몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$dD$D$( d뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$d+ $d뢍|$9;u#e ;avBD$$L$L$觧D$L$ $D$D$HD$ D$ce ;avUD$HT$Z*09t1ɄtJ@9D$14$L$\$L$ D$T$Dce ;ave$YubD$(tLH@$D$L$D$,D$ D$0D$D$4D$,D$L$T$ D$8L$$D$$D$D$(D$D$,D$ xD$L$T$L$0D$4T$8 a됍|$ 9;u#e ;av8 Yu5D$t$D$D$JD$D$  a믍|$9;uÉ#e ;avGYuDD$t.$D$D$D$ D$©D$L$ L$$D$( a렍|$9;u#e ;av8 Yu5D$t$D$D$蚟D$D$  `믍|$9;uÉ#e ;avGYuDD$t.$D$D$D$ D$žD$L$ L$$D$(I B`렍|$9;u#e ;avFYuCD$t-HP$L$T$D$D$ D$D$  _롍|$9;u#e ;avUYuRD$ tD$t(D$$D$D$訝D$ L$L$ D$$ ^릍|$9;u#e ;av?YuYu;D$@L$ $ЋD$L$ T$\$\$4D$8L$$D$$D$D$(D$D$,D$ *D$L$T$L$0D$4T$8 U됍|$ 9;u#e ;avBD$$L$L$ǕD$L$ $D$D$8D$ D$Te ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$HL$ D$T$4Te ;av/ Yu,D$@I$ыD$L$D$L$ S븍|$9;ủ#e ;av. Yu+D$@L$ $ЋD$L$L$D$ S빍|$9;u͉#e ;av7 Yu4D$t$D$L$L$D$ ) "S밍|$9;uĉ#e ;av: D$$L$L$觖D$L$ $D$萖D$D$ Re ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$D$ 1݉$L$l$L$ D$\$&Rqe ;av. Yu+D$@L$ $ЋD$L$L$ D$$ Q빍|$9;u͉#e ;av. Yu+D$@L$ $ЋD$L$L$ D$$ {Q빍|$9;u͉#e ;avNYuKD$ @L$$T$0T$T$4T$T$8T$ $ЋD$L$T$T$$D$$D$D$(D$D$,D$ D$L$T$L$0D$4T$8 H됍|$ 9;u#e ;av>Yu;D$t%@ $D$sD$L$ D$L$ H멍|$9;u#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8 H똍|$ 9;u#e ;avNYuKD$ @L$$T$(T$T$,T$T$0T$ $ЋD$L$T$T$4D$8L$<G뙍|$ 9;u#e ;av81L$ D$ T$‰$L$,L$D$ @ |ۉL$!Ge ;avkD$L$1\$S\$l$؉ };Ѝ,ыum{9uT$$l$|$讄D$ uD$ D$ Fye ;av81L$ D$ T$‰$L$|L$D$ @|ۉL$1Fe ;avAD$L$1B}),mf9u\lm9tD$ D$ Ee ;av81L$ D$ T$‰$L$輵L$D$ @|ۉL$qEe ;avAD$L$1B}),mf9u\lm9tD$ D$ Ee ;av81L$ D$ T$‰$L$輅L$D$ @/|ۉL$De ;avkD$L$1\$S\$l$؉/};Ѝ,ыum{9uT$$l$|$>D$ uD$ D$ Dye ;av81L$ D$ T$‰$L$蜇L$D$ @2|ۉL$Ce ;avjD$L$1\$S\$l$؉2}:Ћk4ы~69uT$$l$|$D$ uD$ D$ /Cze ;av81L$ D$ T$‰$L$܃L$D$ @<|ۉL$Be ;avkD$L$1\$S\$l$؉<};Ѝ,ыum{9uT$$l$|$^D$ uD$ D$ >Bye ;av: D$$L$L$DžD$L$ $D$谅D$D$ Ae ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$%D$ 1݉$L$l$ L$ D$\$FAqe ;av0 Yu-D$H@ I$ыD$L$D$L$ @뷍|$9;uˉ#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8z@똍|$ 9;u#e ;av. Yu+D$@L$ $ЋD$L$L$ D$$ @빍|$9;u͉#e ;avNYuKD$ @L$$T$0T$T$4T$T$8T$ $ЋD$L$T$T$=e ;avoD$tWL$ tJT$j29sA@uluu L\$ÉLl߉D$ËD$ D$聸 @D$t$xhÍ w$|$$D$:MD$P뢉|$\ w$L$T$l$ \$D$L$T$|$\We u$lʉD$P+I \QIL$PT$X111t$$FT$XÉ͋L$P9}D$$4u$l$t$D$ L$\$0l$8$l$t$lD$ L$$l$\$8\$\$0\$L$ D$ D$L$j$t$xhË$lRT$P|$`1ID$`$l YiЋ΍M9WMNLm<ʋ e u t$`sN$t$xhÍ w$|$D$`D$^KD$Pɉt$\ w$T$l$\$ L$6D$L$T$|$\We u͉‹D$PYHAD$PIL$T111h\$(l$D$ v|$$ w$T$L$l$ \$D$L$T$|$$We ut$D‹D$ ; $e ;aIDL$HRT$$|$,1ID$$fL$$T$D$ u)D$(HrX@L$$fPD$, À      ޗ e ;a@D$DHP\i9T+t D$P@*ukrf9uډ\$4T$0L$,js|5|$(BJ[9U9MD$$L$<$\$t$9D$(L$0AD$$Ae T$ 7 ` ke ;a4D$8t4ÍHL$0 $]D$ L$T$\$8KC-e cSuD*u>ju3CC e uC4Ë|$01*$uT*uNj uFj u>j u3CC e uC4Ë|$01#)ȃdL$$C wb9l$ D$,$T$L$+D$$L$8AD$ Ae u D$,A|$0D$,Y#T$(&$D$D$D$ L$l$D$L$$T$(\$8`|$0ʼn#H q e ;aXL$dT$\zZ\$Ta|$@-e G$B1v#D$@L$lhE@@ 5e xhD$<|$Pl$dt$`D$41D$0D$4+L$0AT$d\$ll$`T$\\$Tl$dt$`L$0L$l\$09T$D28ȖpHiX 9.YXe ,u덉É!؉w$t$L$\$ l${D$L$T$\$L$,h XB R99 9l$(\$L)l$$ۇ!,3l$|$l$$l$ -,$T$|$D$&D$,L$Su2 e l$\Eu C]떍{|$T|$P}븉Ɖrb`j$L$P&T$\\$T`j$D$T$\\$TD$`D$pXa %e D$;AF$z$$Љ111fD$$1҉T$01҉T$,1҉$$1ۉ\$8N$$T$"t$\L$4L$$t$4T$,9}%9}!9$ 99tL$09iT$$$l$\$D$L$P$l$X$|$8kL$xt$@T$|B\$|l$X$ΉыT$|9}B9+9t$t28؇ޕsu [R9|ʋL$t뢋L$@9,9$$-e t$T$|\$Xl$xpD$|T$@\$XȉыT$||$89}g49l$L L$4$"D$L$e $uurU땍zÉ } x$D$8HT$@$l$p9W$L$8ߋe u"L$XT$|9щщT$8l$XωÉh L$XT$|9щЉ$$$\$D$l$ L$t$D$l$HD$8$$^$Ɖ ߋ$ pu ,u 11ˉ90$q99c9L\u $9(t$h] 9a$$$$\$|T$<5e $u t$hыl$|T$T$D$0e$c|$G"e uX /L$0O e u)D$DGD$LD$P0 D$T|$X<ÍOω‹D$Dȍ/룃:SD$$}iD$>D$Ѓ:t#L$@f\$LT$PD$TD$X<ÉT$ \$4fD$D$@$D$~D$T$ \$4밃:D$뤃i:UuD$ L$$)iD$L$$ muD$L$$suD$L$$D$LD$PL$TD$X<É< $D$D$>ED$ H|T$H9p`L$,D$(T$DЉD$8$L$7D$L$ *D$8$L$(L$*D$D$@HAH$D$D$L$@IH0L$(H8 e T$H\$,)ډ!ڋ\$Dڅu#L$8H4T$Ll$PD$TD$X<Íx4D$8N֍e$螘|$Ge uX LL$,O e u)D$DGD$LD$P0 D$T|$X<ÍOω‹D$DȍLD$LD$PD$TL$X<ËD$D$L$HL$d6D$ L$e$֗|$Ge uX LL$HO e u)D$DGD$LD$P0 D$T|$X<ÍOω‹D$D ȍLD$LD$PL$TD$X<ËL$D"T T T T 6e ;aD$t{L$19}h}:B_tkЃ wuD$ Íkwkى $D$T$o\$ T$D$L$D$ D$ Qe ;aD$L$ 09|0uQ0r 9ʉHt)0r9v܉)Å911}<$<*twЋ<$9}+} 49r`T$L$D$D$ ÉD$D$D$D$ D$D$D$D$ %Q R Ge ;aD$whtDu9L$1Xh9}sf49r9sX\9D$ D$ D$ ËH@uL$9D$ 1t uD$ ËD$ D$ bP Fe ;avK D$$D$$D$tD$D$ ËD$$D$e ;an(D$,L$0QY2Xh"]9uQXf9u(PXh PfT$$D$l$L$ m$D$L$T$\$,KC{-e unS|$$l$0u}mfl$$L$D$\$ $D$L$T$\$,KS e uCB|$$a4ʼnS눀L$0umPXhqyIfL$$T$l$D$ #D$L$T$\$,CKe uS{PXhqyIt$ |$L$,$\$T$O'D$ L$T$\$,KCe uSO{m@t2-D$0$D$ D$ D$,sM lM eM ^M re ;a L$$QT$ Yj9[lmD(pr9tt$|uvi8ȕvz e uiDL$L$$L$D$ e T$$Zu"XBD$ HJ 9BD$( Íxz딉D$됃DJ9/luD$L$l$|r9D$L$$QYl$9e l$ |uC\$\UYI9 e |uD$DD$( ËD$D$D$( Àu u ~Çou  u ÇJ J J J K J Ye ;a D$$;D$$D$D$HIH$臿D$HP)\j9LhQfQ0to QAA -e u?Qye u"$L$D$D$ ɉQӍyʼnA봉$\$e$聍|$G e uD GL$QAW e uG0 D$|$ ÍOލG뷍e$ |$G e uD GL$QAW e uG0 D$|$ ÍOXލGI뷋D$?I H {I e ;a,D$8H\$4كe$ |$G'e u^ `G e u1GD$<D$@D$D0 D$H|$L,ÍOω1Q`B띉 $T$+D$L$T$ \$l$f70u[йAۍDMۇ݃}t 0r7vωD$ e ;a$D$(fD$8}PD$,$D$0D$D$4D$D$r9t9x苕/l$`\$\3$T$\$L$ l$PRL$T$$\$\l$`r e uQ,E$9HPX i9wN95ȺߋȺ ft hx e uPhx赔YL$`l$\3$T$L$\$ l$zQ\$T$$L$`l$\p e uOVC$9H PXj9wN95Ⱥ Ⱥ4fLhx e uXx֓zT$`l$\3$\$T$L$ l$P\$L$$T$`l$\p e uOwC$9H PXj9wN95Ⱥϋ Ⱥ fthx e uXxT$`l$\3$\$T$L$ l$OL$\$$T$`l$\p e uO衒C ' RQT$`I$$1l$\Et$`$É9D$\,u39$s ϋKSi9K9t$T5f4 \ $i\$TY e i$Q $$D$$9AH PZh9wL"95 DXH e uh$+T$T\$P3$l$T$L$ \$ML$l$$T$T\$Pr e uQʐE輐 L$Tl$P3$T$L$t$ l$Mt$T$D$\L$T$l$P$h5e u:߉ƉN($l${$AD$`I$1%$$\$>D$@PD$`$9T$@~ȉ$$$D$|k&$례 Q8X$*9; P Xhs9 9 ϋ LpP e P|hO8_4(H9 $ht t$`x P9 9 $|$\*$\$L$ՖD$`$AD$\A e uj$A $D$>L%$H@ u$$D$)% D$$$ϋ$$9닉l$\L$,$3$T$l$|$ t$J|$T$$L$,$l$\t$`-e uɍ׉É赍؉qt$`\$\3$l$\$T$ t$vJl$T$$$\$\t$`e uK$$D$(#ZQY  f$89O $X hpύM9# 9 \$`f.\.HL$`H e P$ep$$L$$!9 H PXj9s 9k 5 hH e |X$wntIt$If $D$?"v$D$+m"$$뼉$D$*M"$$뜀u$D${"$H( $mlD$L$$o9`W_,l$`w 9991t$\$ډ$L$D$D$`$AD$\A e y$A$P,X(9u# $D$}V!$$$ $D$,,!$H,} $믉 $mkD$L$$9?W _o4t$`9wy9$T$\T$L$D$D$`$AD$\A e u$A$V$$豉߉\$\D$0$3$l$\$T$ t$rFT$l$D$0$\$\t$`$3e u?‰A$.bD$$$T$\3$\$T$t$ l$Et$\$D$$$T$\l$`$e u?‰軈x$D$?T$$$聈pT$`l$\3$\$T$L$ l$DEL$\$$T$`l$\ e u ׉Él$`L$\3$t$l$\$ L$D\$t$$L$\$l$`$e u衇u Z$$T$$b  $9H PXj9wB}9u5Оf4hH e uXxT$`l$\3$\$T$L$ l$CL$\$$T$`l$\| e u[蕆OIf$9H PXj9wL9{5ݺϋ ݺ4Lhx e uXxl$`T$\3$\$T$L$ l$B\$L$$T$\l$`r e uQ貅E$9H PXj9wB95f4hH e uXxGl$`T$\3$\$T$L$ l$ BL$\$$T$\l$`| e u[O $9H PXj9wB95잺f4hH e uX'xtl$`T$\3$\$T$L$ l$9AL$\$$T$\l$`| e u[O$9H PXj9wB95Ҟf4hH e uX]x誃Nl$`T$\3$\$T$L$ l$o@L$\$$T$\l$`| e u[KO 0$D$W p 0$D$6 O 0$D$ . 0$D$  0$D$  0$D$    0$D$  0$D$b { 0$D$A Z 0$D$  9 0$D$  0$D$  0$D$  0$D$  0$D${  0$D$Z s 0$D$9 R K D 0$xD$  # 0$pD$  0$hD$  0$`D$  0$XD$  0$PD$e ~ 0$HD$D hHe ;avQD$D$ D$D$D$$D$D$D$ D$ L$D$ L$$he ;a @D$H$ˍD$ L$H QD$D9? HP Xi9w> 9 5Ꞻf4 hP e uX@Íx~L$,l$(3$\$L$T$ l$;T$\$D$DL$,l$(놋 e ue~Y D$D9 H PXk9wB 9 5f4hH e uP5x~&l$,\$(3$T$\$L$ l$:L$T$D$D\$(l$,낋 e ua}U D$D9m H PXj9wBN 9F 5f4hH e uXkxU}\l$,T$(3$\$T$L$ l$:L$\$D$DT$(l$,낋 e ua|UD$D9P Xhs99 fLpP e PT$<Fh<$|$D$^\D$D$$L$ L$4|$D9eW\$,ow 9wdB9:l$8t$($L$D$D$,L$DAD$(A e u D$8A|$L$PH@@  e ux\HωÉmED$Pm뺉X$ĈÀH(u H,HP$D$D$H$Q,Q( [`j$D$@@  e xPPD$h|$t$T$H1l$<]$i(M9\$$H$ud "$D$D$D$ $ c L$c T$c $-",$D$5 t$D$ YD$L$HL$H e $Hc D$ c L$c $"$$l$5 t$D$ YD$L$HL$H e  $Hc D$ c L$c $"$$l$5 t$D$ YD$L$HL$H e _ $Hc D$ c L$c T$|"$$l$5 t$D$ XD$L$HL$H e  L$|Hc D$ c L$c T$x"$$l$5 t$D$ XD$L$HL$H e N L$xHc D$ c L$c T$t"$$l$5" t$D$ WD$L$HL$H e  L$tHc D$ c L$c T$p"$$l$5 t$D$ +WD$L$HL$H e @ L$pHc D$ c L$c T$l"$$l$5, t$D$ VD$L$HL$H e  L$lH c D$ c L$hc T$"$$l$5 t$D$ ?VD$L$HL$H e 2 L$hHc D$ c L$c T$d"$$l$56 t$D$ UD$L$HL$H e  L$dH c D$ c L$c T$`"$$l$5' t$D$ SUD$L$HL$H e $ L$`H c D$ c L$c T$\"$$l$5@ t$D$ TD$L$HL$H e L$\H0c D$ ,c L$(c T$X"$$l$50 t$D$ gTD$L$HL$H e L$XH0c D$ ,c L$(c T$T"$$l$5J t$D$ SD$L$HL$H e L$TH@c D$ Yu;D$t%H$L$D$L$ D$L$袻 9멍|$9;u#e ;av: D$$L$L$GzD$L$ $D$0zD$D$ /9e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$vD$ 1݉4$T$l$vL$ D$\$8qe ;av8 Yu5D$t$D$L$L$D$ H A8믍|$9;uÉ#e ;av8 Yu5D$t$!D$L$L$D$  7믍|$9;uÉ#e ;av/Yu,D$ t$2D$D$葹 7븍|$ 9;ủ#e ;av@Yu=D$t'$D$D$D$D$BD$ D$   7맍|$9;u#e ;av7 Yu4D$t$D$D$D$D$肔 蹸 6밍|$9;uĉ#e ;av81L$ D$ T$‰$L$\wL$D$ @ |ۉL$Q6e ;avkD$L$1\$S\$l$؉ };Ѝ,ыum{9uT$$l$|$sD$ uD$ D$ 5ye ;aD$ L$AQ+AR@ЍBDQ(9^A$Q AT$$9|28Q A 1 DB9}Y i9r Í`&$T$T$D$L$ T$\$C Se uK뜍{>L$D$MRL$b 3 $D$D$ zD$ L$T$\$K$S( e u C { K !$D$D$(D$L$ T$\$CSe uKD$ {Kɯ ° 軰 3/e ;aP d|$L#LD$hRD@P\$l+ыUmƋD$x9 L$#@T` SBЋl$|T$l1l$Tً\$l֋SNjC 9h9@t.Ck֍U[9EU\$lSTm<,EtCS l$T9T$,D$PT$"yt$< ! $D$l$\$ T$ D$L$T$\$lSe uCt$<|$0L$"e|$HDT$,뉉ً\$lD$lHP \$T9bT$,0uBD$pHT$,T$\$t$D$#D$TuD$PL$,T$"|$lD$lHP T$,QL$hYP\$#iXދYT[9~)YXiT׋P @9~V9t,$D$T$KD$h@PL$#t"T$lZl$,9t:Ƅ$dƄ$dÉ릉빉t$#녋T$,?D$h@PƄ$dÀw}SuD$PL$,D$pH T$,T$\$t$ыD$L$ L$$T$L$D$;D$t\$$l$,LD$PT$"/|$lp tP D$pH T$,T$\$t$ыD$L$ tt\$,ًD$PT$"|$lD$pH T$,T$\$t$ыD$ L$t\$, D$PT$"|$lD$pH T$,T$\$t$ыD$L$ T$X\$\9u\$,ًD$PT$";|$l|FP$dÍ !$\$T$L$ l$D$L$T$\$lSe uCt$h|$|ʉËD$l{AD$l& ˥ ĥ 轥 趥 该 訥 补 蚥 蓥 茥 0$D$R 0$D$8 Q J C < e)e ;a3(D$0HT$4$D$D$,I0L$t T$8HL$$ $T$L$0L$LL$L$PL$ L$TL$,L$X\$\T$` e T$(zt$LSC 3$D$$D$D$D$D$ L$ L$0T$T$`d$D$\$$\$D$L$L$$T$ |$41 >D$0D$4D$ D$8D$D$5 e$|$D$LD$>cxD$h;y‹D$l;  3$.e ;avGD$HHPD\$1^E9}4~ |9vH\|9wXX蠠 虠 #e ;a"hD$lI0@PPX1C9}hXpT9rL$*D$pH T$xT$\$t$ыD$D$8L$ L$0q1ۉ\$,T$4l$x8$D$D$L$lQY,l$*t$,|$0Jl$*t$,|$dT$`D$+L$XL$DL$x\$P\$4\$8t$PL$lL$HL$XL$4L$lD$+\$`T$dZ\$xqiP\)EFE(l$49[D$8t$,\$x|$0l$4D$8qP$l$ D$D$+L$l $T$dT$\$`\$l$xl$ t$0l$Dl$|$8|$D$D$0t{D$lHXuHPuHL$4u ʋ\$,D$pH T$,\$D,l$l$t,$ы\$ L$D$lT$4$L$`L$D$l@PD$|hËD$lڋqTyX~A@ iXq\yT|$l$t$ $T$D$\$ D$+D$D$ D$8l$4t$@|$$l$T$t$ \$D$L$T$\$LSLe uCD|$`ʉŋD$,v{D4T$<*LksT$+QPQXYTS\$X9g^QTiXt$8^v9v9`$t$\$;D$+!L$LAP1҄T$8t*YHiDqL׍S96SQHe tu|D$,|$`Ér3|$D$l$\$t$ T$u n9rpO+ND$D$D$ D$$ [4ʉQuDV ^u9^fu/t$D$D$$xD$,H\$[9ruVNtJHV9 Ru'L$L$ T$T$0L$4D$8l$<(111҉QD$0D$4D$8\$<(ÉD$0D$4D$8\$<(E > 7 0 ) Re ;avd D$$L$L$kD$|L$QI9s.D$ ËD$u @D$ D$ 蜂 e ;ae\D$pD$tD$xD$|DŽ$DŽ$D$`HT$dZ\$ie ;a)e ;aApD$XD$\D$`D$dD$tHIL$$$D$D$L$xL$ T$|T$$T$D$D$D$ \$X\$(D$,D$0&D$8L$4cD$HL$lD$t@4  $@D$D$@D$L$ L$hT$T$@$l$Ht$x|$lD$P1D$DD$P+L$DA$\$Ht$xT$@$l$HL$DL$hT$D99L$D ϋ r9T99))ˉ\$L!ً\$xً\$D94[l$hTT$LTe \u L6߉Ɖ l$h$$D$@$pDŽ$DŽ$DŽ$pH G G e ;aD$D$XD$D$\D$D$`D$ D$H$D$LD$D$PD$D$TD$ D$dD$D$hD$D$lD$ D$$D$(D$pD$,D$tD$0D$xD$4D$8L$D$0L$P3$L$\L$|$T$ \$țT$D$L$P\$`l$pt$@|$4D$\D$0N9eDR9J$9;)ȉD$0T$4,l$`!ȋL$|ȋL$d9w? 9L$dL$\ʉ$D$D$0D$0D$\L$`T$dD$L3$\$\\$T$L$ l$D$L$T$4$l$`t$@$D$\D$Ll$T$$\$DD$XH3$\$\\$\$4\$L$ D$]\$D$L$@T$l뗍3$L$\L$T$l$ \$%l$t$D$,L$lT$`\$4D$lL$`T$4\$d9wSl$\9w~\$dl$\ $L$hL$D$D$\$D$4$D$d$TÍ3$D$\D$L$\$ T$|\$l$D$lL$`T$4v> > = > = = > = > = x= q> j> ^e ;a D$((L$$$Q{ȹD$$T$(L$1l$t$.l$(t$$L$\$9}b )ډ!‰$l$%D$D$L$ L$$D$uD$$)D$uD$_zD$L$(9T$9T$$}X11E<twЋL$(9}}94|OЀ wd|̅ *0u ~l$(9T$,D$0L$4)݉ۇ! L$8D$L$H\$h1L$h$$$pDŽ$DŽ$DŽ$p8 7 7 谻e ;a@D$DHIL$$$D$D$D$ D$D$L$HL$L$LL$D$ D$(D$,D$0蹭D$4L$8T$<\$D$D$L$T$ uD$L$T$D$PL$TT$X@Ժ/e ;a@D$DHIL$$$L$HL$L$LL$D$ D$D$D$D$D$ D$(D$,D$0٬D$4L$8T$<\$D$D$L$T$ D$L$T$D$PL$TT$X@/e ;a@L$TL$LQD$ D$$D$(|$,1 0L$,L$ L$0L$HL$4\$L\$8l$Pl$D$(L$,T$0D$HL$LT$P4ËD$@L$Daв+e ;ahD$xTL$lQ<T$t $L$pL$T$D$ 8D$D$XL$L$(0$D$L$.D$ L$T$\$(sl$xt$t|$pD$PD$XD$dL$HL$<L$,L$HD$PD$@D$0D$P+l$d |$x|$pl$dT$<\$0\$(l$xt$tL$$\$dK~ M9+n\$\l$,KLL$09@98r)͉l$8ۇ!͍ /l$$9l$$\l$8+Ћe  L$$T$$9$$$ks|9ODL9<L$ $IDD$|$谣$H@T$\$l$l$|t$$t$T|$ l$$9L$x4v\Te ؋\$X$Lu[T$x,$|l$Tl -e u$D$|D~u1D$+ω‹D$|0щlj!띋$$D$X$\$$\$$l$$t$ 2D$)$\$$\$$l$$t$ 2D$L$X$l$9_$,*$9ED$+: $hD$$QYl$X$|9||$T19\$P$$T$|$$HP$9[l$Tll$Pl-e <$,H@9[D 3 $@D$D$zD$ L$T$\$X$TL e |u/D1<@9}Lt|9rD$+oΉ$]T$t&$D$D$ |${\$D$$T$tl$X$|$TCw)$9T$ :$9$;\t\$ptl$h]}9\/&$D$D$=yD$L$L$0T$ \$X$t |K\f<\$Hq9T$\t$0D$8\$fD$L$8T$0\$\+\$\t$0L$8D$9D$L$8T$0\$\T$0l$H9tBr9~‰D$@&$\$T$L$ t$y\$D$L$pD$@T$0뇉L$T$$$$0$$D$AD$L$ $L$0D$TL$0$$ksߋ$9 ,[LD e ؍OW9 D 3 $@D$D$wD$ L$T$\$X$TL e u9D1<@9}Lt|9rl $+|$p誻߉Ɖ蛻R&$T$L$D$ t$dxT$D$L$p\$HȋL$09\$T9wE 9 D$8$$t$|$D$8L$T$t$l|$P-&,$T$L$D$ \$wD$T$L$0\$T$t$l|$Pq $c$H@T$$9O [DDe T \D$D & $D$D$ D$uD$D$`L$L$TT$T$4\$DX$D$TL$T$4\$`+\$`t$,T$4 L $vL$T$4D$,\$`D$,l$D9tBp9~‰L$< & $\$D$T$ t$!u\$D$T$pD$,L$<뇉T$P$$$$ 0 $$L$ZY RT$,TT$0Te |u D$(D$ËD$( ҟ$l$T$t$ \$]D$L$T$|$ We u ʉʼnz輠ҟ$D$D$ \D$ L$T$|$ OW e u nWe ;aDDB D$(JL$ZY RT$,TT$0Te |u D$(D$ËD$({ҟ$l$T$t$ \$KZD$L$T$|$ We u ʉʼnz,ҟ$D$D$ |XD$ L$T$|$ OW e u ޜDŽe ;avRe vuz e 87& 蘵3辬e e ;avD$D$D$:资e ;avD$D$D$ 腄e ;avD$D$D$ 7Re ;avD$D$D$D$ oe ;avJD$$L$L$D$_ D$ L$ $D$D$@ D$ D$诃e ;av4D$T$9u JX8u@J9D$ 11Ue ;avaD$$L$L$D$L$Q$D$D$ D$ L$ $D$D$i D$ D$؂e ;aveD$HT$(r9t-1Ʉt#JX8uJ @ 9D$11,$L$t$L$ D$T$Te ;av=Yu:D$t$HP$L$T$D$ D$ 몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$贇D$D$( {뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$脇  뢍|$9;u#e ;ae vu e $D$#GD$ L$ (d e +,d $D$D$L$ 0d e  4d ݴ$D$-D$L$  d e  $d ܞ$D$+D$L$ 8d e uT BZT$ sT$ \$ȉP   -{He ;aE4D$<$L$PL$D$D$XL$TL$,D$0D$1D$TL$XD$$L$(D$*fu*111ҋ\$8$L$T$D$ 1D$D$\4ȁJb  ?LɅ@9wJww)_ۉ!؍ʉ냋D$8$|$t$$D$($|$5D$| xL$D$ ${te ;aD$сL$Jى!ʍ $\$\$L$ L$ D$L$ s3Cl$T@y r s&e ;a D$$L$( ȍ w`T$L$\$Mى!͍($T$T$D$,D$ D$L$AT$\$A   r@e ;aD$ L$$ st ȋIT$L$L$T$҅|B9w;w3Yۉ!ˍ$)ʉT$l$D$ D$(  (rSe ;a0 L$0TD$0$IꍌTT$0)щL$ba)ʉT$L$ L$$ $t$(t$|$,|$L$k\$0)ӋT$(\$D$)aD$ D$,Hl$$ $JL$\$DD$tHL$(rKT$,l$$$L$\$D$ D$4 D$4   pe ;aL$TT$$IꍌT)ىL$ ba)ʉT$L$L$ $L$ T$ )ʍaL$L$ $L$ kT$)ʅuËD$$D$ p7e ;a$D$(L$T$4\$,l$0|$0o|$ʉ9r |? l$0 lmRL$ T$49t(8؇ݗr UЋ)I+KJ|t$$t$gD$D$ L$( $T$0T$KD$L$ s=a| =vT+s1=~*=}#ø$Iꍔ T)k9t1D$4 L$ Q\$(,Ë MU@t$D$($T$T$YL$\$(D$4ʋT$($\$\$iLkdD$\$(D$4똉D$؉ƋD$$    me ;a@`e $PPD$_D$D6L$1۽t$F|$ˉՉ9 :T$4Ћ~L$,|$0L$,|$-99Q!хGVL$4T$8L$8T$4T$$L$(L$)M bT|$61҄t ^4^Ut$h1m$D$D$D$ D$ؽD$L$D$hD$lD$pL$tTÃu&\$Xdl$\͉Ћ\$`ىu&\$Xl$\͉Ћ\$`ى$D$D$D$ D$0D$L$D$hD$lD$pL$tTU"e ;avD$dD$Te ;avD$d9D$Te ;av0D$\$ЋD$L$\$ L$D$\$ ITe ;aggT$ \$$D$H$\$KD$'D$hTXL$(\$,L$,\$(\$8L$<\$<وƀ|$Pt$HvldL$t$Pal ыD$L$L$@D$DL$@\$hTXe u)\$ЋD$ L$\$\$lL$pD$tdÍ\f΄`L$,\$(\$0L$4L$5=L$hT$ \$$" 0$D$ 1Ne ;avD$D$ D$Me ;aHL$Lplh@9tT$(l$$t$D\$=؋\$ ؋L$LT$(l$$t$D9D$ 1et$l$ T$L$ L$3֋L$\$\$>O'e $T;A:,|$D1?$4L$L$8T$P$<\$T-c c $09D$<$|$t$DDD$T$D$ D$$L$(pD$4 3 $D$$8L$gD$L$T$ \$4h$<9Y9݉D$0L$,T$8$49t$t$\$E$D$|$X5 d>$t$$D$4D$-D$L$ T$$@$D$H,ÉD$@  $D$L$XL$?D$@뤉݉$4$@$8$D$<$H,¡ 軠 $e $T;A:,|$D1=$4L$D$8T$Hc -c $09D$<$|$t$DAD$T$D$ D$$L$(D$4 3 $D$$8L$D$L$T$ \$4s$89d90މD$0L$,T$8$49t$|$\$:C$D$|$X5f<$t$<@$t$D@$8$L$8$L$,$ L$0$$ LP$( e u\Ǎt$X&<$D$4D$D$L$ T$$T$L$D$ t*D$L$$<$@,ÉD$@  $D$L$XL$)=D$@닉މ$4$<$8$@,R K t"e $X;A(|$@1:$0L$H$4T$L$8\$P-c c $,9DD$4$|$|$$t$@>$4$ e a|$0t$TD:L$0ǁǁe ǁTP|$8$8$0l$,ZL$0|$<7>L$0$D$$4D$D$ l$$$4L$0$8$0|$89}d)艁)ꉑ5e !څu2 $l$D$#D$ VƄ$<(É7Ƅ$<(É17߉ōTP{7Љ$D$0D$L$TL$D:$4Ƅ$<(脜 } Ae ;aD$1VGKJ\$މl$8؇ޗs/v~)sn08؇ޕtD$E9}? sJ4>v|$t$ t$ 9l$|$D$D$D$萚 艚  e $H;A8|$<16$@L$<$DT$@c -c $<9D$0 `& $ D$D$8L$0 $|$|$4t$D$,t$L$t $D$D$D$ ‹D$(;D$t$mD$,ʋD$,ݸ똋D$t.L$$D$tt$l$\$ \$\$T$L$D$ L$T$\$te u$D$T$$s|$X &݋D$x%ߍLP%be ;avnD$L$T$1$T$D$D$ L$ $D$"T$D$L$9|ˋD$ T$$L$( ve ;av|H|$41&|$4&L$\L$4L$`L$8T$L$T$PT$T$TT$T$XT$ |$t$4*L$`L$$.L$,T$0\$(\$dL$hT$lH- he ;a@|$,1w%|$,n%L$HL$4L$LL$8T$PT$<c c l$D9s9$|$t$,*D$D$LD$D$ D$$D$T@Y ]e ;a@|$,1$|$,$L$HL$4L$LL$8T$PT$<c c l$D9sv$|$t$,b)D$D$LD$L$TL$ 6D$$L$(T$L9}.t 0d 4d D$XL$\T$`@Ë d $d 11l e ;a@|$,1#|$,#L$HL$,L$LL$0c c l$D9sv$|$t$,(D$D$LD$L$PL$ ^D$$L$(T$L9}.t 0d 4d D$TL$XT$\@Ë d $d 11蔆 (e ;asXD$"D$t1ɉˉщډD$t\$x9*T$$L$#L$` $D$\$薧D$ L$t9t D$"H1붋D$\Pt$`'L$tL$ӋD$L$L$PD$TD$QD$PL$TD$HL$LD$"D$LL$HL$0D$4D$"L$4ȈD$" D$"D$RL$#8D$$L$\QtrT$T\$P\$(T$,T$-uT$R\$Ql$tL$xT$t9u T$|t$Ƅ$XÉ鉄$Ƅ$XËT$T\$P\$@T$DT$Et륋D$$$Ƅ$XÃu D$tAt D$$3D$$$Ƅ$XÄu&L$LT$HT$8L$<L$=L$"1D$|tD$x$Ƅ$XËD$$$Ƅ$XÉ0$0D$ْ "me ;av{@|$,1k |$,b L$HL$,L$LL$0c c l$D9s9$|$t$,%D$D$LD$D$ D$$D$P@U ~ie ;av\4|$ 1|$ L$L$ T$i9T$l\$h\$XT$\T$\\$X\$0T$4T$5?T$2„D$L$lT$hT$8L$<L$+L$ $D$L$ e L$ c c \$94 e  ǀ e uhǀǀǀ e u-ǀǀƀ IL$ D$$Í1ʍ1돉D$ $|$t$tD$ ND$ji e ;av|$t$ t$ :9 l$|$D$D$N N e ;ae vuPQ e 2@mPL)$be L$ dsd Td Xd  e l g` Pd c c c `d dd e $\d $e L$ hsd td exd e e  @` pd c c c d d e uo|d (d ,d d e u@d 0d 4d d e ud e Í=d =d 빍=|d 늍=pd @` F=hsd =\d =Pd  g` =dsd Je ;avo(YuoD$,tV$D$0D$D$4D$D$8D$ D$$D$$D$D$(D$D$,D$ :D$L$T$D$0L$4T$8YP R됍|$ 9;u#e ;avGYuDD$t.$D$D$D$ D$D$$D$ D$D$(O 렍|$9;u#e ;av?Yu$D$$D$D$(D$dD$ L$D$L$D$L$L$,D$0 L 뀍|$ 9;u#e ;avGYuDD$t.$D$D$D$ D$D$$D$ 芼D$D$(K 렍|$9;u#e ;av?YuD$t(D$$D$D$D$ L$L$ D$$?5 8릍|$9;u#e ;avAYu>D$t(D$$D$D$D$ L$L$ D$$4 Ȳ릍|$9;u#e ;avQYuND$t8D$ $D$$D$D$(D$D$,D$ D$L$D$0L$4O4 H떍|$9;u#e ;avQYuND$t8D$ $D$$D$D$L$ T$\$T$(L$,\$0D$43 ȱ떍|$9;u#e ;a9 `$D$ZD$|D$ D$1DL$@ʋ+[l$\$ `$D$D$L$AD$Z| e td `$D$[D$/|D$ D$1LL$ʋk\$l$ `$D$wD$L$`ʋkhAD$[| e u td Í=td =td T\e ;a"HD$\L$P9)\$T)É!Ë|$L,gt$,tD#Dx1 |$LƉЋT$P9}l}D$<(P2GЀ wÇߍD뿍GwD>멍GwD>듗;D$7D$\L$P9T$Ll$X9*ML$`@D$dHÍNwl ^ T$X\$P9D$D$T)Љ!Ћt$L$)Ӊ\$l$L$ D$L$XȉD$`D$\L$ȉD$dHÅu떍(vy!GЀ 4DwXq1oD$\9 \$X9 KL$`@D$dHÉD$D D$DӋT$P9}04+SFvݍFvՍFЀ v͖;jaD$,9U\$D$X T$\49\$T9)!9T$T9L$,t$(9t$l$D$D$D$,D$`D$(D$dHÉl$@`$ td L$L$DL$ST$T$ ĶD$t[L$XT$P9s\$T)ˉ!ˋt$L$)ʉT$l$D$ D$L$XȉD$`D$\L$ȉD$dHÍ`$td D$D$DD$L$L$ 7D$@L$8D$' 7' 0' )' "' ' & ' & % % % & e ;av5td $D$D$D$D$-kD$ L$D$ L$$贩e ;a\e $tRD$/D$`$L$dL$D$&D$ UD$ D$4$D$`D$L$dL$ D$D$,L$L$(T$ T$T$L$D$\$ \$ \$D$L$T$,\$Tl$(t$`|$dPD$T$L$(L$T$,T$\$ l$$݉l$ l$\$dD$L$T$,\$Tl$(t$`|$d9)ω|$0ۇ!|$X|$0|$d9L$D$$4& 1|xt$ R9H))!ڍ09(9 ۇ!΋|$`9~9$t$D$Yl$ 9)ʼn)!ڋt$09~jt$0l$X9t$l$t$D$$L$0ȅL$,9$T$TT$D$L$ ׮D$L$L$hD$l\É뒋D$X$L$0L$D$&t$ D$$L$T$,\$Tl$(|$dD$`D$hD$dD$l\# # # " # ɦe ;ae vu% e }$Of|$|$e uU5 D$$D$ D$ 6be L$ u td e Í=td 芽$|$ D$\ e ;av:1L$ D$ T$‰$L$L$D$ @=Z|ىL$菥e ;avnD$L$1\$S\$l$؉Z};Ѝ,ыum{9uT$$l$|$D$ uD$ D$ ve ;av81L$ D$ T$‰$L$L$D$ @[|ۉL$衤e ;avkD$L$1\$S\$l$؉[};Ѝ,ыum{9uT$$l$|$.D$ uD$ D$ ye ;a& D$(1ɄGT$$ЉL$D$ $td T$D$L$ ̰D$L$D$1ɄL$ $D$ϦT$D$ D$t D$, ËD$$L$L$T$D$ 跋D$uȋD$$D$D$D$D$ 舋D$uD$, D$, ËD$$ L$D$L$ D$(D$, ËL$$ $D$D$:D$ tYL$(9u:T$$xmlnu Zst@9wZ)! jD$, ËT$$׋\$(D$$D$$$ 齺L$D$L$ D$(   迡e ;a$D$(s[ȃ4^  @9:w~)ȉ!-ȉD$,T$0$$D$D$ 臘$cD$D$ D$D$GD$ L$L$,D$0$  e ;a,D$0D$$L$4L$(T$$hCP$ЋD$9 d L$0 d e D$4d L$D$ L$QӃ u$ʀ $D$\$T$D$L$ Ӄu&jwFuÀt2ƒt $D$\$D$L$ L$8D$<,É̉T$^$W_|$Ge u ͻjͻͶ]111_=d D$4豶D$4L$0D$0D$8D$4D$<,11D$8D$<,ËD$G E$|$) Ξe ;aJ0L$4 d  d e D$8d L$(D$,L$(QӃ u,ʀ$D$ $D$$D$L$T$D$L$ T$D$$L$ $D$T$%D$ L$d d @@\$T$ $D$ D$ $L$$L$T$T$$D$ L$d d @@\$T$ $D$ D$PwZt>D$$ƒT$ $D$L$.D$ L$D$\09u@L$,D$0D$4ø݉\$,l$0D$4ý룁\룁u%9uVht>;%9uHD$,L$0D$4ù݉\$,l$0D$4ý  Ae ;a\L$`L$ T$a\$bl$ct$dt$t$e|$$1X LL$$ _ t$ Ήt$(5 Lt$,ʉT$0 MT$4 T$8LT$x 1.뷍xD$0蓀e ;atD$\D$`D$dD$xH $|$5裝L$|L$$L$$L$$T$D$ [6t$$|$\`|$Pt$\SD$X$He ~$P \$8D$@D$x@@D$ $T$L$ YD$trL$8e uLT$@PX-e u C@ $$tÍ{1蝖{ 蕖؍x‹D$@腖ÉЉ륋L$8T$@븋D$xH $PD$x@@D$ $$D$$D$ 荈D$t. d  d  e u >谆-0,$D$L$T$ \$~CD$L$T$YL$(땀D$TD$X`fD$T$D$XH L$ $ L$D$ĽD$D$/D$TD$D$D$ D$$DŽ$DŽ$DŽ$Ƅ$$ĄÍY99lE<ȋ e u 0w0w茅-0,$D$L$T$ \$WBD$L$T$YL$(딀 v uxY9>lE-e <ȅu bƄ$rb-0,$D$L$T$ \$AD$L$T$YL$(돍kwsY99lE-e <ȅu bb艄-0,$D$L$T$ \$TAD$L$T$YL$(딀 !Y99lE-e <ȅu B|B h-0,$D$L$T$ \$@D$L$T$YL$(딀usY99lE-e <ȅu 卼卼蕃-0,$D$L$T$ \$`@D$L$T$YL$(딍k$$#ĄÀuD$xD$|L$|<^  L$xD$yD$|$$ĄÈ$eD$L$$UT$D$L$ D$qD$L$L$DD$H0$D$DD$|D$ L$ $D$ $޳D$L$L$LD$P0$D$LD$8D$ L$ $D$D ] V jZe $X;A ($4v $,Q Y$i $~+Trz  w?-`9, 1\$H @ $\$T$$‰wމƋ$w볍@$|$t$\$ T$4|$D$\$P$, `t$$Y$$$H@ D$L$  $ td L$iD$$QI L$T$  $D$iD$t$,\$0T$$$$, `t$$$9˺1lz vx‹D$xvx ‹D$hvz1vbxv x /zvy1pv$,$4L$` (  ~ w p i b [ ^e $$;AX \DŽ$DŽ$DŽ$$`$l$$`i{$$lV{$$8$ $8i$ $8J$ $8+$ $8 $ $8$$9$$`z$n$$$vz$$lcz$$8Q$$82$$8$$8$$8$$8$$9y$$`y$o$$$y|$x$lsy$T$x8$T$y8$T$z8$T${8$T$|8$T$}8$$9O$$`xD$<D$@D$D$Ƅ$|$<$x$$lsxD$HD$LD$P$ Ƅ$|$H$2x$ t$<"x$t$Hx$$ w$$w$$w|$l$`w$T$l8n$T$m8R$T$n86$T$o8$T$p8$T$q8$T$t9$$ w|$`$lw$T$`8$T$a8o$T$b8S$T$c87$T$d8$T$e8$T$h9f$L$4$L$8$8$`Qv$,$l>v$D18q 0 $L$4L$8L$ T$$D$H õ $$8T$IL$T$ $L$P õ $$,L$L$ T$$T$X$$xL$$|L$D$ (L$D$1$DL$D$D$ ML$$DŽ$DŽ$DŽ$Ƅ$$\É獴$u|$ $t$xD$$|L$$T$ $\$$t$(|$TtD$T0$t$Tt\1 111111'1 111 1uƄ$Ƅ$$<^  $Ƅ$Ƅ$uƄ$Ƅ$5,$=<^  $Ƅ$Ƅ$Ƅ$$$ps\11y1r1k1d1]Ƅ$$$$s\1V1O1H1A1:13$$`r\1111 11$$lr\Í$$`r\  Te ;aDŽ$DŽ$DŽ$$HL$$ $|$|$@$qbt$t$<|$\qD$ D$8L$(L$4$$+rangukeul$\$HL$$ $|$@$oq|$Pt$<]qt$\Rq|$8t$PEq D$$D$$D$ $D$$3|$tt$4q$t$tpĀD$hD$lD$p$HL$$ $|$@t$\pD$t$|$hp|$Dt$hpt$\p|$8t$Dup D$$L$$T$ $\$$c|$\t$48pD$\D$d$I HD$dH@D$ L$$2D$D$wXD$dL$T$Pe uH$t$\oĀÍxi݋$'R2e ;aD$L$$L$bD$L$ $D$L$?D$ L$T$-$t$@JTL$,)T$0)‰!Ћl$8څD$XD$\D$`$L$,T$0D$8-@ d \獴$SD$ L$,L$T$+Ս|$Xt$2$$S$$İ$L$+$ueu`$uS$9$$L$D$T$ =D$L$$L$T(D$t[D$+$tCL$4ADŽ$DŽ$DŽ$Ƅ$$$İËL$41릅:$9+$$D$L$û\$ D$D$} D$4pH9$9)‰!Ћ$ЉD$pD$t\$xT$dD$4D$hL$lDŽ$DŽ$DŽ$DŽ$$L$pL$AD$ L$$$$D$dD$D$ L$$$$D$D$D$ FD$D$$D$D$D$ D$$DŽ$DŽ$DŽ$Ƅ$$$$İDŽ$DŽ$DŽ$獴$P$D$ $L$$L$W$t$L$4T$@\$0l$,ډ͉ƋD$@L$LD$+9l$8L$]#L$\D$a A9D$tD$xD$|))T$<!L$@уL$H-@ d Tt$\ >D$HD$ \$L$D$$ƒKT$ $D$L$vD$ L$D$ $T$c c c D$L$ T$D$L$D$,L$0É $T$c c c D$L$ T$D$L$D$,L$0(3e ;avD$ $D$$D$D$(D$sD$ L$$L$c c c D$L$ T$=D$L$uD$,D$0ÉD$,L$0ee ;a&0 $9D$D$,L$4T$811t$$΋|$4L$8T$8ŋD$,9 \$$l$)ډ!ʉ$l$tD$L$ T$@9\$<,Ëum=( =) t D$kͺt$$>|$92L$D$(l$ D$,$)ۇ!\$4,;l$T$EHD$,$L$(L$L$ L$)HD$$L$\$<ЋT$@ͺle\$<69$)!L$\$GD$,tJHP @9wT$)Љ!؉D$)щL$l$ D$L$L$HD$L0ø 귺L$HT$L02 + $   ? e ;aD$$D$D$D$D$L$ L$$L$T$D$ u"D$|L$9yL$ $D$D$ D$L$L$g}g t6t D$ É $ L$D$`JD$ tD$ É $GT$D$8JD$ u؋D$L$tTt&u $ L$D$JD$ uy $T$D$ID$ uD$L$뮉 $D$T$D$ ^HD$ D$L$D$L$i}ft1 $ L$D$ZID$  $ T$D$2ID$ D$L$tct1 $ L$D$HD$ d $T$D$HD$ iD$L$뢉 $D$T$D$ EGD$ D$L$D$L$Z $D$T$D$ GD$D$L$D$L$L}ft1 $ L$D$GD$ g $T$D$GD$ lD$L$tct.$ $ -,L$D$GD$ ) $,T$D$eGD$ D$L$뢉 $T$D$5GD$ D$L$m $D$T$D$ ED$D$L$D$L$% $D$ẻT$D$ gED$D$tdt2L$ $ ẻL$D$FD$ L$ $ϺT$D$TFD$ D$랋L$ $D$T$D$ DD$kD$t2L$ $ L$D$ED$ ZL$ $T$D$ED$ [D$랋D$D$L$o $D$T$D$ "DD$ D$L$D$L$&D$ 8e ;a$D$(s[ȃH^  @9!w~)ȉ!ȉD$,T$0$$D$D$ $}ӺD$D$ D$D$ D$ L$L$,D$0$  @ e ;a$D$(s]ȃ@^  J@B9=(w~)ȉ!`ȉD$,T$0$$D$D$ $1ںD$D$ D$D$ D$ L$L$,D$0$  > e ;adD$lD$pD$tD$h@D$,$jJD$,D$$ WL$\/D$,H F$D$L$D$D$ L$L$$T$ T$0\$,[|$41 $\$D$4D$D$$L$ T$0D$4$kD$$L$ T$0\$4tu\$8i9'T$0l$ D$$5e D$(HL$$ WL$x=D$(H $L$,L$T$0T$\$4\$ D$L$T$T$f$誸e L$T$Qe BA L$ e \$(CujAC@D$ $D$,D$D$0D$  |$e u$D$ D$8D$<D$@}$ËD$ ׍y돍y jyD${CD$8L$uFL$M^  T$MD$`D$dD$hL$`T$e@D$lDÉD$,$L$\$\\$D$ D$L$L$,9890T$\9$D$($)ʉ!ʋl$TT$)ȉD$\$ _D$L$$L$kD$ L$T$Mu]uXtypeuNL$(T$X9u6\$MD$`D$dD$hT$`\$eD$dL$lDúȉ $D$P<D$wu땀u1녀u vugD$\)ȉ!ȋ\$T؉D$8D$X)ȉD$D$L$D$L$ 0$D$D$gD$L$ $L$Y -e ;a(D$DD$HD$L1DL$<9D$ T$@)‰!‹t$8$)L$l$ L$ D$D$L$ 9\$<99l$8T'wR"t+'vD$,|$Dt$,L$ DD$P(D$,|$Dt$,L$ DD$P(À(tr/$T9T.*t+/D$,|$Dt$,JL$ DD$P(D$,|$Dt$,(L$ DD$P(ÅQD$$,$t$D$@D$ ׻L$ D$.D$L$T$ $T$D$D$ D$7D$uD$$L$ \$}З Ç}ÇD$PD$T<Íkd@ ? ? ? e ;avCD$L$T$B9}$s'kvkv t܉T$ÉD$M? ve ;a D$$$D$(D$D$,D$&D$L$ T$tGL$T$ $T$UD$tD$D$0D$D$4 ÍD$0D$4 ÉL$0T$4 \e ;aD$$L$ L$D$:D$ |1L$ 9D$L$ $D$D$/˫D$ t D$$ËD$$L$L$T$D$ D$uȋD$$L$L$ؿT$D$ D$uD$$D$D$iպD$D$ eD$fD$$z> e ;av8$D$D$D$ D$D$$D$ D$L$D$(L$,Ae ;av8$D$D$D$ D$D$$D$ *D$L$D$(L$,e ;a(D$0$D$4D$D$8D$K$D$D$L$L$T$ T$  $TD$D$$D$ L$ $T$T$\$l$, \$D$t_D$$tJH X@9w\$)ȉ!ЉD$)ˉ\$l$ wD$L$D$T$<$)ȉ!D$,ȉD$T$O(1UR14 4 3 2 3 2 2 2 2  e ;a$D$(s[ȃ^  @9:w~)ȉ!=0ȉD$,T$0$$D$D$ ǭ$D$D$ D$D$臼D$ L$L$,D$0$2 1 e ;a0BL$8T$L$4I PL$  $D$T$ |D$D$p|$$|$t$8D$$L$8uoD$%L$8u]D$&L$8uKD$'L$8u9D$(L$8u'D$)L$8uD$,L$ 9D$D0111111D$D0D$D0He ;a@e v@u3 e Mu0 T .Uvq  $D$qD$sD$ D$<1EL$@ʋk\$l$  $D$D$L$  AD$T$D$ D$ $L$4L$T$D$ D$ $L$4L$`T$D$ D$ $L$4L$vT$D$ D$ $L$4L$#T$D$ WD$ $L$4L$uغT$D$ (D$ $L$4L$"ƺT$D$ D$ $L$4L$T$D$ D$ $L$4L$ۺT$D$ D$ $L$4L$T$D$ lD$e t D$4td   $D$~D$L$ @( $ЋD$L$ d e  d x$D$D$ezD$ D$0 x $D$OT$D$ 蹿D$ e  xRPx$L$0L$ȍT$D$ nD$ e ; |RPx$L$0L$=T$D$ #D$ e  RPx$L$0L$卼T$D$ ؾD$ e  RPx$L$0L$T$D$ 荾D$ e ! RPx$L$0L$OT$D$ BD$ e  RPx$L$0L$BT$D$ D$ e e RPx$L$0L$bT$D$ 謽D$ e  RPx$L$0L$bT$D$ aD$ e RPx$L$0L$T$D$ D$ e KRPx$L$0L$wT$D$ ˼D$ e RPx$L$0L$0wT$D$ 耼D$ e RPx$L$0L$ >T$D$ 5D$ e 1RPx$L$0L$m+T$D$ D$ e RPx$L$0L$LwT$D$ 蟻D$ e uRPx$D$0D$ /L$D$ TD$  e  RHD$0td "u$D$,  $D$T$D$ D$ $L$,L$T$D$ ȺD$e mD$,td t$D$( " $D$OT$D$ y|$Ge  "$L$(L$OT$D$ 0|$Ge "$L$(L$wT$D$ |$Ge X"$L$(L$ >T$D$ 螹|$Ge "$D$(D$ LwL$D$ U|$Ge D$(td %s$D$$s$D$  $D$OT$D$ D$ $L$ L$T$D$ 迸D$ $L$ L$OT$D$ 萸D$ $L$$L$ȍT$D$ a|$e D$ Br$D$  $D$OT$D$ D$ $L$$L$=T$D$ |$e D$ q$D$  $D$OT$D$ 螷D$ $L$$L$BT$D$ o|$e D$ Pq$D$  $D$OT$D$ %D$ $L$$L$bT$D$ |$e D$ p$D$  $D$ LwL$D$ 謶D$ $D$$D$ >L$D$ }|$e uvD$ D$$td W[$D$D$D$ D$o D$L$d e u d e @Í= d 蹼D$ 讼=td D$$蟼뀋D$ 蔼D$ 膼lD$ xD$ j^Z=td D$(K\;+G =td D$,xR=td D$0ջxR»xR读#xR蜻xR艻gxRv xRcxRPMxR=xR*xR3xRxRwxR޺x|R˺xxR踺]=d 診=td D$4蔺=td D$8耺=d p=d `\=td PƢe ;aD$$L$L$D$ +D$ L$Q$D$4D$L$Q $D$MD$L$Q$D$D$*D$ L$ $D$D$D$Qe ;aD$T$9JZhp91ɄtxHZj p 9tI1Ʉt?HZ9u1HZR@9t 1D$É$D$\$D$ 11ى,$t$\$`L$ D$T$1떉$L$l$L$ D$T$^1W e ;av8 Yu5D$t$豚D$L$L$D$ " 믍|$9;uÉ#e ;av8 Yu5D$t$D$L$L$D$ h" a믍|$9;uÉ#e ;av8 Yu5D$t$1D$L$L$D$ " 믍|$9;uÉ#e ;av8 Yu5D$t$葘D$L$L$D$ ! 衟믍|$9;uÉ#e ;av8 Yu5D$t$D$L$L$D$ H! A믍|$9;uÉ#e ;av8 Yu5D$t$D$L$L$D$  믍|$9;uÉ#e ;avJD$$L$L$D$'D$ L$ $D$D$'D$ D$oe ;avGD$D$L$ $D$/D$ tD$@L$I9D$1e ;av9Yu6t$t GD$L$ L$D$  谝뮍|$9;u‰#e ;avBD$$L$L$7D$L$ $D$D$ %D$ D$Ge ;aviD$HT$Z*09t11Ʉu 1D$ÍJL$$D$ D$ ׉4$L$\$L$ D$T${e ;av81L$ D$ T$‰$L$lL$D$ @q|ۉL$ae ;avkD$L$1\$S\$l$؉q};Ѝ,ыum{9uT$$l$|$D$ uD$ D$ Λye ;av81L$ D$ T$‰$L$|L$D$ @~|ۉL$qe ;avkD$L$1\$S\$l$؉~};Ѝ,ыum{9uT$$l$|$D$ uD$ D$ ޚye ;av81L$ D$ T$‰$L$L$D$ @?|ۉL$聚e ;avkD$L$1\$S\$l$؉?};Ѝ,ыum{9uT$$l$|$D$ uD$ D$ ye ;av81L$ D$ T$‰$L$L$D$ @|ۉL$葙e ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$D$ uD$ D$ ze ;av81L$ D$ T$‰$L$L$D$ @]|ۉL$衘e ;avkD$L$1\$S\$l$؉]};Ѝ,ыum{9uT$$l$|$.D$ uD$ D$ ye ;av81L$ D$ T$‰$L$L$D$ @a|ۉL$豗e ;avkD$L$1\$S\$l$؉a};Ѝ,ыum{9uT$$l$|$>D$ uD$ D$ ye ;av$D$$D$D$7 D$D$ Ֆe ;avVL|$X1+|$8"L$P $L$TL$t$|$8|$$t$8׳|$Xt$$ʳLce ;av+D$$D$ D$wD$ L$L$$D$(e ;av'D$$D$ D$wD$D$$ҕe ;av+D$$D$ D$7D$ L$L$$D$(莕e ;av#D$$D$D$'D$D$ Fe ;av#D$$D$D$g!D$D$ e ;av+D$$D$ D$+D$L$ D$$L$(辔e ;av#D$$D$D$4D$D$ ve ;av#D$$D$D$:D$D$ 6e ;av#D$$D$D$MD$D$ e ;av3D$ $D$$D$OD$L$ T$D$(L$,T$0覓e D$;A$1$ $$L$(%t$ L$taQD?.1`39n*?u '9^D$@D$DD$HD$LL$@t$DL$Ht$L=$D$%D$@D$D$ D$D$L$L$0$5ͯL$0$$ĠÁw c L$<$谪DŽ$$$L$<$DŽ$DŽ$Ġúw c L$<$<DŽ$$$L$<$DŽ$DŽ$Ġû\?]A!&9 Dt$4L$$|$P1蝩 T$$9uX|$di|$Pt$d\9t ыt$4$t$P7DŽ$DŽ$ĠÍ|$d.릉빉\$,wc $1 DŽ$$L$,w$$DŽ$DŽ$ĠûDw&=J 39w29umw c L$<$9DŽ$$$L$<$DŽ$DŽ$Ġú뎁w c L$<$ͧDŽ$$$L$<$DŽ$DŽ$Ġûw\u09 nqS`&9uuT$(wc $1DŽ$$L$(w$$DŽ$DŽ$Ġú농|$x1趦$l$Nt$|$x耫L$ L$8T$$t$xd$$Q$L$8$Ġýƍ!e ;aTD$X$D$\D$cD$ L$QAjq.uJB9u@ $D$:D$$ZXD$ L$L$`D$dD$hD$lTÁ_B>f39u0 $D$$D$L$ D$`L$dD$hD$lTÁjuy9XD$DD$HD$LD$PL$DD$HL$LD$P$D$)D$DD$D$ D$QD$L$D$`D$dL$hD$lTÉT$`\$dD$hD$lTúMj-?w=.1u-`39? '9 ?߁>°u-`B9FA&9A߁wwS'u`'9W=Ju- 39Aw29'sw߁΀\09X(t΀2&9l$@\$,$\$D$D$ sD$t8D$@$D$D$[ D$L$ T$\$D$`L$dT$h\$lTÍD$ $D$@D$D$D$D$ D$9D$L$$L$D$T$L$ \$똽΀u29qS(`&9迉e ;a4D$8$D$uFalsu6Qe"TfalsFQe4Ճ봉 $D$PT$D$ D$D$L$ D$L$ R $D$OT$D$ OD$D$L$ fD$L$ qSuB`&9u8tD$@D$DD$H4D$@D$DD$H4D$$D$(D$,D$0D$$L$(D$,L$0=$D$%D$$D$D$ D$D$L$D$@L$DD$H4È\$@D$DD$H4û@D$@D$DD$H4ye ;aDD$H$D$LD$D$ L$QA_B>fzuV;9ZuCt"D$PD$XD$\DWD$PD$XD$\DÁ.B9_B>fu39t{D$$D$(D$,D$0L$$D$(L$,D$0vq$D$(D$$D$D$ D$D$L$WD$PL$XD$\D*D$PD$XD$\DúXD$PD$XD$\DW_B>f?.1`39X(tY? '9u7X$\$OD$D$PD$XD$\Dû‰,$\$OD$D$PD$XD$\Dýj?g>°uv`B9ugtCA3&9u&!*D$PD$XD$\DúZD$PD$XD$\DW똁A똁w'u`'9=J 39uytMw29u0n$D$D$PD$XD$\Dúˉ$D$D$PD$XD$\Dû낁w*D$PD$XD$\Dû1΀M\609X(tG΀&9u**D$PD$XD$\Dú҉D$ L$,$\$D$@h D$D$ D$4D$8D$<D$@D$D$4L$ L$8D$fu_;9uLt$D$TD$XD$\D$`HD$TD$XD$\D$`HÁ.B9_B>fu39D$(D$,D$0D$4L$(D$,L$0D$4eP$D$&D$(D$D$ D$D$L$D$TD$XL$\D$`H‰D$TD$XD$\D$`HúK$HD$L$ D$TL$XD$\D$`HW_B>fu?.1`39ulhtI? '9u'XT$T\$XD$\D$`Hû҉\$Tl$XD$\D$`Hû덁?덁>°`B9u|tDA<&9u'*T$TT$XD$\D$`HúZ$GD$L$ D$TL$XD$\D$`HW냁A냁w'u`'9=Juz 39uitEwx29u(fT$TD$XD$\D$`HúӉ\$TD$XD$\D$`Hû뒁wÉD$TD$XD$\D$`HûD΀a\J09-X(tH΀&9u+‰D$TD$XD$\D$`HúщD$$L$ ,$\$D$D$ D$L$T$D$8D$<D$@D$DD$ D$8L$$L$fnuO;9Nufu39tzD$(D$,D$0D$4L$(D$,L$0D$4?P$D$&D$(D$D$ D$D$L$D$TL$XD$\H‰D$TD$XD$\Hú_,D$TD$XD$\HW_B>f?wz.1uj`39uYt=? '9u T$TD$XD$\Húۉ\$TD$XD$\Hû뢁?뢁>°un`B9u_t=A&9u pT$TD$XD$\Hú,D$TD$XD$\HW렁A렁w'u`'9tz=Juj 39uYt=w29u T$TD$XD$\Húۉ\$TD$XD$\Hû뢁wÉD$TD$XD$\Hû_΀J\309htA΀)&9u$‰D$TD$XD$\Hú؉D$$L$ $l$D$D$  D$L$D$8D$<D$@D$DD$ D$8L$$L$fnuO;9Nufu39tzD$(D$,D$0D$4L$(D$,L$0D$4-$D$$D$(D$D$ D$dD$L$D$TL$XD$\H‰D$TD$XD$\Hú_,D$TD$XD$\HW_B>f?wz.1uj`39uYt=? '9u T$TD$XD$\Húۉ\$TD$XD$\Hû뢁?뢁>°un`B9u_t=A&9u pT$TD$XD$\Hú,D$TD$XD$\HW렁A렁w'u`'9tz=Juj 39uYt=w29u T$TD$XD$\Húۉ\$TD$XD$\Hû뢁wÉD$TD$XD$\Hû_΀J\309X(tA΀)&9u$‰D$TD$XD$\Hú؉D$$L$ ,$\$D$D$ D$L$D$8D$<D$@D$DD$ D$8L$$L$D$,ƒT$($D$L$4D$L$ L$\D$`PËD$,D$$^$)|$Ge u ͻͻYzD$,뉋D$,L$|D$,L$o111`=d ËD$X؋\$XT$T\$X 1111|D$\D$`PËD$$G E$|$ =ie ;ah 4D$8$D$°V_B>fW.;9u8t'PD$@L$DD$HD$L4Í辺ׁ.uB9DD$ L$$L$D$WD$L$T$ $D$D$L$ L$$D$L$T$ t,J$ыD$L$L$@D$DD$HD$L4D$$D$(D$,D$0D$D$$L$ L$(D$,L$0Da$D$'D$$D$D$ D$aD$L$D$@D$DL$HD$L4ËB $ЋD$L$L$@D$DD$HD$L4$D$fD$ D$@?D$L$L$@D$DD$HD$L4Wk .B~.8u9X(p3<$9X(te_B>f 39uH‰$D$D$ ]D$L$ L$@D$DD$HD$L4ú봉l$@\$DD$HD$L4ûn_B>fk$l$\$t$ 9mD$L$L$@D$DD$HD$L4þ.1Jk$9X(te.1`39uCX$\$D$ \D$L$ L$@D$DD$HD$L4û붉l$@\$DD$HD$L4ýn.1k?u '9h# %9htl>°`B9uQZ$D$fD$ D$ °d$l$D$ 1[D$L$ L$@D$DD$HD$L4ýWj'A&9td'`'9uG‰$D$D$ ZD$L$ L$@D$DD$HD$L4ú뵉$|[D$L$L$@D$DD$HD$L4ûd'a=Ju 39w29tIWj $9u'P\$@T$DD$HD$L4ú҉$D$D$ YD$L$ L$@D$DD$HD$L4ûoWjl$D$D$ 5YD$L$ L$@D$DD$HD$L4û΀\09X(td΀ &9uG‰$D$D$ XD$L$ L$@D$DD$HD$L4ú뵉l$@\$DD$HD$L4ýo΀lu29qSu`&9uytI;:%9u'P%\$@T$DD$HD$L4û҉$XD$L$L$@D$DD$HD$L4ûÉ$D$D$ tWD$L$ L$@D$DD$HD$L4ûD$@D$DD$HD$L4_xe $|;A"$OD$D$P"*e $T$P $YY)hbqQ-99$ LD$D$1hw,$L$DL$$L$:$$<$$QT$8 L$ XD$\\$`0$\$\\$D$ L$ $D$nD$ D$,L$L$LT$ $T$8T$JD$PT$ T$(\$\$HL$ " $l$Ll$l$,l$ n|$D$(Ge u D$HD$Hiu D$P$DŽ$DŽ$ÁY)u"9$ D$dD$hD$lD$pL$d$ D$hL$lD$p$D$2D$dD$D$ D$2D$PL$T$$$$É$DŽ$DŽ$ø=Y)MMEu-`9($ iS2- 9$ D$@|$t1t,$L$@L$L$tL$8 D$t$v:D$tL$xQT$4X L$$\$D$D$LL$ L$,T$$T$4T$D$PT$T$H\$ \$(L$ " $l$Ll$l$,l$ |l|$D$(Ge u D$HJD$Hs@ Y)bq-9$iY)"9E$$$D1p$$L$$DL$ 4$D$y6$D $HPY\$@ L$x$$0$$T$D$ L$ $D$D$ D$lL$$`ȡ$|$$D$@Ge uoD$x$L$  $$T$T$lT$ 5h|$GGe u$$nD$xn댋$$DŽ$DŽ$ĤDŽ$$DŽ$(DŽ$,DŽ$0$$$$($,$0$D$4$$D$D$ D$肾$L$T$$$$Ĥø$$1n,$$L$$L$1$$74$$QT$p L$X\$`tOiӨ u5@9Iz2Zp/@ӟ9ajr: $D$`$0$$L$D$ L$ $D$ID$ D$lL$$T$$T$pT$"D$ D$hL$$`ȡ$|$$D$hGe uo$$L$  $$T$T$lT$ ne|$GGe u$n$k틄$k댉t$$$l$,$D$`$0$$L$D$ L$ $D$D$ D$lL$$$$ T$$$T$,$@ӟ$$ \$D$ L$ $D$ƿ$T$T$h\$ \$dl$$L$  $$t$t$lt$ -d|$D$dGD$hGe u$-$j@ӟ\$(|$ $$D$`$0$$L$lD$ L$ $D$Ƚ$L$  $mc|$D$ GD$(Ge u$m$i$$DŽ$DŽ$ĤøpY)q&69-9!$$$t1Wj,$$L$$tL$u-$t$/$tF$xQT$<$IL$Th$$0$$l$D$L$ $L$GD$$L$ L$l$$T$<$T$T$ @ӟ$$\$D$ L$ $D$$T$ T$h\$$l$l$dL$  $$t$t$lt$ Za|$D$hGD$dGe u$$g$$DŽ$DŽ$ĤÁ'>@$9u1$ $DŽ$DŽ$Ĥøϸ'>@릁MMEBl-9T$MME`9$v$$1g$$L$$L$*$$d-$$PY\$D L$|$T$D$ D$lL$$T$|$T$D$0$$\$ND$ L$ $D$躺$T$$\$\$hl$ l$dL$  $$t$t$lt$ !_|$D$dGD$hGe u$$e$$DŽ$DŽ$Ĥøq$$1Nf,$$L$$L$l)$$+$$QT$PXil$L $$\$mD$ D$lL$$$$T$L$T$P$@$$\$-D$L$ $L$$T$ T$h\$$l$l$dL$  $$t$t$lt$ ]|$D$hGD$dGe u$$ d$$DŽ$DŽ$ĤøMMEiSu- 9 $^\D-09$uЋU 9$15d$l$$L$Z'$$)$$$Y\$HhIL$X$l$[D$ D$lL$$$$T$H$T$X$@ӟ$$\$D$ L$ $D$$T$T$h\$ \$dl$$L$  $$t$t$lt$ n[|$D$dGD$hGe u$$a$$DŽ$DŽ$ĤÉ=^4$T$ |L$D$ E D$L$$$$$ĤÉЋ$Ћ$$$T1!b,$$L$$TL$?%$T$'$TI$XP\$8I$$T$D$L$ T$YL$\$D$8$$D$D$L$T$ \$uoD$4T$0\$t$L$  $$T$T$\T$ Y|$D$0GD$4Ge u D$tD$t`DŽ$4DŽ$8DŽ$<DŽ$@$$4$$8$<$@$D$4$4D$D$ D$$L$T$$$$ĤDŽ$DDŽ$HDŽ$LDŽ$P$$D$$H$L$P$D$4$DD$D$ D$S$L$T$$$$Ĥ$^Fe ;al$D$D$(|e $^T$( L$pCYbq)-9D$tiS5 9D$tD$$|$<1^4$L$$L$L$OыD$(3O믍x1%OoxD$`O>L$0yNx/NxD$,NxX1NC$0D$D$D$lD$ \$D$D$]=D$L$ T$0J\ e u BXzXRNxDËD$hBNxL‹D$`-NЋT$`Z'$|$D$4D$PD$0xdD$xMe6Pe D$;A}D$lD$pD$tD$x$HHPLL$lT$pHDP@T$tL$xL$l $D$D$qD$ D$8L$L$h$r$|$|S1\$LKD$8$L$LD$|T$dߥ$-qd l$L$$D$ $Q\YX(@\$T$$l$ D$D$D$;D$ D$$L$L$P$ZPl$L9| rT9k9ZT9BLJHL$D$ $l$&D$D$0L$L$X$Z`\$D- Ʊ,$D$L$0H e uYL$XHL$$H e u/L$PHL$DH|$d e uKxD$PKƍxD$XK뜉$l$c c L$D$ ZD$D$`L$L$($Z`\$<- Ʊ,$D$L$(H e uYL$`HL$$H e u/L$PHL$\$48u<e u1:D$0ƀ,Í $|$z@D$D$ D$$D$(JD$ˍ_ ىL$ D$$؉D$(<{$D$D$D$D$ D$ԈD$L$T$0J e uB$L$0#z8$D$8D$D$ D$SL$0D$ $D$t L$0D$0$ Ze ;avV D$u<L$$jD$tD$D$ ËD$$߈L$ c e ;a]DD$HH9uA11ҋX@L$,T$0\$$D$(D$4D$8D$<D$@0$L$,L$`D$ L$L$4D$80$D$$D$:D$L$ D$t!D$($D$D$,$ËD$($D$D$,$D$,$Àt:t uHD$($kD$D$,$ËD$($D$D$,$ËD$($D$D$,$ËD$($llD$L$$T$D$"L$ D$#D$L$L$D$ 0$D$D$(D$ L$ $D$4 }e ;aH($)D$D$ L$, PPe $D$ H0L$,\ $D$qD$,$D$ H$P(X,jt$9讍 e ;a@D$DHL$,@$~D$ 5 e mL$DHT$HPL$,H L$LID$D$P$ыD$ L$9" L$DQX,l$,qyH9_9W9O|$4t$()։t$$ۇ!T$\$T$$T$ 0$D$\$L$y,D$,L$DAD$(Ae uD$4AD$T@ÍyD$4'L$(\$$D$0T$ 0$|$T$t$ l$t$|$D$0L$(T$ \$$l$,u6D$T@ɸxD$D&yD$H}&D$8D$<L$8T$<$D$8D$蘥D$L$ $L$d } e ;a 4D$T$ \$D$T$JL$l$\$h‘$D$+D$D$ D$L$l$\$hPD$T$$\$`HL$ 0 $襃T$ \$ w $D$'D$ DŽ$DŽ$$$$$D$xD$ L$ $D$Du $D$'D$ $L$'D$ ]e ;aL8D$0D$4L$<%d   d e D$@d L$0D$4L$0QӃ uʀT$D$$L$ $D$T$pD$L$ $D$D$ L$T$$D$L$MD$L$ DŽ$DŽ$$$$D$$L$D$ D$YD$@$L$pL$xD$ L$T$ $D$T$93D$L$T$ $k(s$|$<_9D$H\$DL$xT$t\\$$$T$L$ D$D$Z$H(P$\$D9}D$e ;a0@D$DHuPD$L$D$PD$D$TD$D$XD$ D$\D$D$`D$D$dD$D$hD$D$lD$ V@ËD$L$L$PL$T$TT$\$X\$ l$\l$t$`t$@ 7@ $L$ O R}e ;av5w$D$7D$D$ D$e ;a D$(H(IT$4\$0l$,t$$34$D$l$\$ T$!D$HD$(T$4\$0l$,t$$x$@(9EL$D$8t$tD$L$T$4\$0l$,t$$끋I0PXT$\$  $L$ED$L$tuD$T$4\$0l$,t$$- ÃutL$$R0Xhl$\$  $T$D$L$tu.D$$$D$(D$D$,D$D$0D$ D$4D$ yL$$ $D$D$,D$D$0D$ D$4D$谶L= e ;av2D$ H(P 9|$2D$D$D$e ;avmD$ H(P 9}2HP X(9sET$H(AH(AD$É$D$tD$ D$= ,we ;a D$ H(P 9HPuT$ RLTDD$ T$L$$|$t$D$tL$Xu=L$PAe u.AD$\LÍy.GD$\LËA3$D$D$蓋D$D$,L$L$(T$ T$0\$Tk534$l$l$^D$L$L$$T$ |$41D$0D$4L$(L$8l$,l$u}A!e uAD$Íy $D$D$D$uD$ D$É $D$D$D$SD$ D$Í0$D$> ׳e ;a L$t=L$ Ae uAD$ÍyD$ P1711뛋|$T1BT$LZLtd]D$(L$PT$Lzۗ*l$",-uT$ |$" ׉:ul$"|$ @w>?t׀@u떀]w[e]\z`N…B`?wS,w/#u T$" ׉&,u |$"|$"߀:u|$"T$ ׽ǀ?tڀ]w [tĀ]tɀ{t}t u\$\$, T$#uT$#T$$T$#0T$#uT$#T$$T$# T$#uT$#T$$T$#T$#1҉T$$T$#D$ǂL$fǂL$tƂL$!tfǂƂL$t=ǂt fǂtƂD$"tƂD$\HL$uL$pL$c\$VZ.uh.uh.1ǂƂD$\HÍD$P#wi b [ T M v{e ;amL$ǁǁe 2ǁǁǁe ǁǁǁe ǁǁǁe xǁD$ "usP8X4h0PDX@h<~'q@tfl$\$T$ $D$t@D$ HPPL@HD$T$L$ D$$D$t D$$D$$D$$pTupUu넉l$\$T$ $D$D$t D$ L$>D$$ËP8X4@0D$\$T$ $D$gD$hD$$ÀP8X4h0SPDX@h<8q@t*l$\$T$ $D$ D$$@Tȉl$\$T$ $D$D$t D$ L$D$$À P8X4h0SPDX@h<q@t*l$\$T$ $>D$oD$$@TZȉl$\$T$ $D$1D$t D$ L$D$$Í1訏1薏B1脏1rwse ;aD$ $軵D$tKD$ H(P X9sQ PX i9s9DP Xi9s DH(H(D$D$) "  Dw_e ;aD$}1ɉL$ t 9~]$ƵD$tCD$T$ 9}$D$ D$uD$fǀD$D$uu}vHe ;aD$(D$te$L$L$L$ L$L$$L$ KD$t3D$)L$T$*!ЈƁD$,D$,É$D$ D$t D$|D$,ËD$ju+e ;avOD$$L$L$L$ L$L$$L$ 臷D$tD$fǀD$(D$(*ue ;avD$tH$L$L$L$ L$L$$L$ D$tD$fǀD$(D$(É$D$ D$tD$D$(tee ;a(D$<D$,D$$L$4T$0t$ nt$|$,D$4L$0L$4T$09t$$9wl$  2L$^\$$$D$%+D$trD$ s`0L$, $D$D$t;D$ s)0L$, $D$ٱD$JD$@(Ã7D$@(Ã7D$@(Ë\$$9=0,$tokڕvekЕ uLÀu\$1݃uuуu1뾉$T$L$\$8\$ l$$l$諲D$tD$,L$4T$0*D$@(Íkw Wkw C_u 4-Ç%kҕikƕ[=M[wk:[,]#_~ fǀD$@(É$D$ D$t D$,OD$@(ËD$,=O H qqe ;aI4D$8D$L$HT$D\$@l$<11(T$H\$Dl$@t$<|$8ډƉϋD$8L$HD$|$9d|$ |= tt=$l$\$T$ L$L$諰D$tL$nD$L4ËxH9~t$ ~9Ot5 t$D$taD$L$@9T$<Àu ؉D$녉݃uuԃu1D$L4ÖD$ D$,D$D$,L$L$tL$l$\$T$ L$L$3D$tD$8ƀL$ȉGD$L4× u$$D$tD$8T$D\$@l$ 7 0 ) " KZve ;a ;cD$D$$$L$L$D$D$ fD$D$|D$ZD$$$L$(L$T$,T$\$0\$ D$ D$$$肘D$D$$ƀƀD$L$0T$,\$(t$0|$,T$(\$(͉t$9<3 uou=$\$T$L$ l$l$D$tD$$ƀ1D$4 É$D$tD$$L$0T$,\$(D$4 É$\$T$L$ l$l$KD$tD$$ƀD$4 × u 7—N9L3tL$0u~N9L3ueN9L3tL$0u2N9sbL3uN9sQL3΋L$011111^D$4 D$4 D$4 D$4 G @ 9 2 [We ;a #e ;ab|$T?ƀTL$$$D$$D$FD$ L$L$T$|$$5ZD$TD$XD$\D$`D$D$dT$h$D$xD$D$z$|$  e ujt$$]Z$$Ћe u"|$ 5 1Z$$|Í $D$ D$ D$Wˍ $|$D$$D$W$y=~e D$;A3$T ƀTL$$$D$$D$hED$ L$L$ T$|$05-YD$`D$dD$hD$lD$ D$pT$t$$D$$$|$, e .t$0X$D${$$$$$L$$T$gD$ D$$1oL$($$$T$$\$L$ D$L$T$$$D$D$T$ L$D$D$(HD$$9|e u9|$,5W$$D$$$<ĈÍ $D$,D$D$UU봍 $|$D$0D$9U$:e ;av|D$thL$+uM $D$D$:yD$ } D$Ë`td $D$D$D$D$VD$ D$À-tЀ vD$ :he ;a9uT$8DuT$8/uT$8B D$ G E$|$v 4e ;a)$D$<D$ uaD$81ɉ$L$D$ *D$ L$T$($D$L$D$ D$D$,D$D$0D$D$$Ãu T$81뗃 u T$81뇍^$|$Ge u CDCEK7 u T$81; uT$8J( uT$81D$ G E$|$# l3e ;aPD$`$D$dD$D$hD$+t$D$ D$$|$<1KD$$ 9u}|$<[P|$(t$D$D$É$D$D$D$?D$ D$É$D$D$L<D$D$ÃtNt'uf$D$D$D$FD$ D$É$D$D$D$FD$ D$É$D$D$D$?D$ D$Í0$D$袴 )Fe ;aadD$h$ D$6tPHP Xl$hEE$5e um$E]MUD$pdÍ}m$@ދL$hǁ|$ 1AD$ J Zjl$\$L$JZjl$L$ \$$JL$(|$l e ubt$ ED$hƀA9sP  AD$pdÍ $|$D$ D$BD$pd; d(e $4;A?L|$,@$P$`D$$X$P$P$XڋupƂ@9D@$D$uƄ$\LÄɉD$0tttt ǂ|$D1?D$DL$0Yi ЋQT$H\$Ll$PQYIL$T\$XT$\$T e uht$DCƀA9  AƄ$\LÍ $|$D$DD$@$P{D$,D$8D$<D$@HL$(X \$$@D$ $l$,l$l$8l$ED$ N$P$2D$$tYH PX$PEE&5e u!_DE]UMƄ$\LÍ}_D<؋$PƍC92CDǁFV^$5AL$ $L$($L$$$$$$D$,$D$@L$녉t$4 K $l$\$T$ D$lD$L$T$$Pe ut$4ˉŋ$Po4;Ƅ$\LƄ$\LÉ$D$D$CD$ <$PȍK9KDǀ$1;Ƅ$L$0Q Yi$$$QYI$$$ $T e u$m?4 $|$$D$= K$l$\$T$ L$D$L$T$$Pe uʼn؉9Ƅ$\LË$PƄ$\Lԝ ͝ Ɲ !e ;aQlD$p$ D$L$pk9 TJHL$P @|$5>D$L$L$T$ D$$L$(T$,D$\D$`D$d|$te ut$=D$xlÍ $|$D$D$N;ۃ/&D$p$D$tD$fD$D$ D$xlD$xlR K t e ;axD$|$D$QH PX(!hl$΋HL$׋PT$؋\$|ƃA9L AL$T$l$1ɈL$L$D$L$ǃǃ|$ 17D$ L$L$$\$(t$,l$0T$4L$L$8L$L$t$ e ut$ ;Ƅ$xÍ $|$D$ D$l9؉؋\$|Ή׉ŹL$IƄ$x蝚 ae $;A$$D$FV$k9TJu$16Ƅ$JZ j$$$JZj$$$J(Z$R $$$$ e ur$]:$ƀA9  AƄ$Í $|$$D$7xP$X$h $H$L$dp $x(|$hhP@$ƃA9$l$|T$x@$D$H$L$8P $X(\$D$T@$$\$8$t$<ꋜ$l$8|$@D$T$l$T9{9LDmD$|D$x\ | $\$|$T$ L$8L$t$MD$[$\$T9L$xL \$|ڋR$119\$D$ ,$L$T$/D$@$T$|\$D9$ \9T\$D$  $$L$D$.D$DL$|$ $A$e uuQ $Q($Q,$Q0Ae u-SAD$LAD$HAD$PAƄ$ÍyS&̍y &넉Ɖωы$3$$ D$L$\$ T$l$\$D$@$T$|$3$D$D$D$ T$ll$\$$$$$111111 Ƅ$1111111ɉ$ 1ɉL$41ɉL$,1ɉL$0L$|L$`T$xT$X$\$\1112Ƅ$ÃH $p$t$8x(|$D$0L$,Q Yil$4\$8T$e ;aLD$PL$,1\$ S\$Pl$,؉99YT$ RLlD$ l$L$D$TL$X\$\$L$\$D$tL$luRL$PAe u'\AD$pAD$tAD$xAD$|LÍy\D$|LËD$X 3 $D$D$bD$D$,L$L$(T$ T$0\$d-3,$\$\$0D$L$L$$T$ |$41D$0D$4L$(L$8l$,l$c ;$_ Љ$`$~|$|$de c5<DŽ$DŽ$ D$d$?c ;$_ Љ$`$ |$$e 50<[DŽ$$DŽ$($$ @c ;$,_ Љ$0 $蒇e |$$25`DŽ$@DŽ$D$$<Ac ;$H_ Љ$L`$e |$$5P<iDŽ$\DŽ$`$$XBc ;$d _ ȉ$h`$蠆|$$e 5p<DŽ$xDŽ$|$$tDŽ$DŽ$ $4|$$e q5\DŽ$DŽ$$$B$D$^D$L$ $$`$謅e |$$5<DŽ$DŽ$$$B$D$<D$z]D$L$ $$`$&e |$$!5<vDŽ$DŽ$$$B$D$,D$\D$L$ $$`$蠄e |$$z5<DŽ$DŽ$$$B$D$4D$n\D$L$ $$`$|$|$|e 5<mDŽ$DŽ$D$|$0$ $`ȡ$调 |$Ge UDŽ$ DŽ$$$dtd D$`$1D$ hD$`L$tT$(\$$9l$ R$t$$|$p$L$$l$l-,$D$\$T$ D$L$L$H e uL$pHL$lHaxD$pKyD$l?BJ }Q\$xʉىL$xT$($$$$L$t$\$$1(É`$|$<D$`$|$<D$p`$|$<D$``$|$<D$?" $|$D$y`$|$p<D$`$|$P<D$R $|$`D$`$|$0<D$`$|$<D$y $|$ D$X< < < < < e D$;A DŽ$DŽ$DŽ$DŽ$$   $L$D$ $T$$T$$T$$\$$-XRl$~?$$d -d 9 T$7$$dtd T$L$D$ D$L$Xh @UL$7D0.D $T$1$ $$T$mt$$KL$L$6|$d$2L$6$$$L$<T$D$ D$D$D$D$ D$8L$L$D $D$D$D$ @GUD$L$T$9tM `& $D$UD$ L$8$DŽ$$$ĠË$D$\$D$`0$D$\D$OD$L$ $$$$$$>ĠÃtDt1r$ $wT$D$D$ t $;$뾋$ $8T$D$aD$ t $${htDf$ $ T$D$ D$ t $$($ $ T$D$D$ t $j${tG$ $nT$D$vD$ t $$$ $"T$D$8D$ t $${$ $D$ T$D$ D$$$.$ $D$wT$D$ ZD$ $B$SU1 N1 D$<$D$D$$VD$D$#ܺD$D$$D$$D$  D$$D$(*D$,L$0D$TL$X0$D$TD$tLD$L$ $L$> / ³ e D$;A od @$T)ʉT$, 3 $)ʉT$@LZL$L$L$T$ \$l$,d9\9ML$8$\$0D$\$$D$$D$藻od L$T$ \$$$D$l$,l$t$0t$ T$\$L$f*D$@@D$$L$8T$,)щL$\$0)Ӊ\$ !Ӌ$\$|D$T1D$41D$(D$TC$T$,|$ l$0$D$LD$& ge ;a ,D$0HXPTX\h`94* }9|* L$8Q\$<9al$4D H`H`AHdIHdAǀAHdIHdl$@T$D\$H,Í3$D$4D$L$\$ T$}l$D$\$PD$0L$8e u_L$8Q\$<9l$4D H`AH`\3$D$4D$L$\$ T$z}l$D$\$PD$0L$8봖 t–ux}9|*uaL$8Q\$<9l$4D H`H`3$D$4D$L$\$ T$|l$D$\$PD$0L$8벖u9t*u9L*M99L$8qt$$)!݋\$<9w?|$494*LʋL$8f4TH`H`T$$T$(l$ 3$D$4D$L$\$ t${\$|$D$0L$8T$(l$ t$$z6D$4D$@D$8D$DD$u'{"Vl$ $T$L$D$lL$(QXYTi\q`9 ,3-<n9l3 u/?NL$ $T$D$ D$L$(A$!5e u`5@q i(Q,Y0A+e u-vAYAQD$,$Íyv腹̍y @u뙋D$($''D$D$,$×:: ÇL$(QTYXi`9*-r?i:`,W[N]E{<}3#*&!*!|>'"%@`$D$l%D$D$,$É$D$R%D$D$,$É$D$#D$D$,$É$D$#D$D$,$É$"D$D$,$É$D$!D$D$,$É$D$!D$D$,$ÍED$ $T$L$D$u D$(D$($]D$D$,$É$D$D$,$É$D$ {D$D$,$É$D$ ^D$D$,$É$D$ 1D$D$,$É$D$ D$D$,$É $T$\$ED$ D$uD$(L$ l$RD$($D$2 D$D$,$ÉT$\$ $T$\$ED$ fD$uD$(L$ T$\$l$D$($D$ D$D$,$É$ D$D$,$É$D$D$,$É$D$YD$t D$(D$,$D$,$D$,$D$,$É$[D$D$,$É$D$D$t D$(D$,$          踝se ;a2L$ 1@99TtΉ\$T $9\$TuD롋T\A$-e uc-8pi Y($Y,Q0Ae u-dAYQAD$Íyd*̍y 8p떋\9$:D$: ce ;aL$9<$1p$T$L$+\$l$\$ T$Z9L*L*LT\@$-e -8ph X(P,H0@ e u^ dHXHP1Ʉt+Q9s_ |4$HD$D$ÍxdH뗍x ō8p4]D*1e ^ 臚2e ;aWl|$$DzL$p(\$t9؍]׋9U<|$$1eL$|L$$$L$($T$,$\$0L$4T$8\$* \$(L$$T$ h`DŽ$DŽ$DŽ$$\$T$L$ $l$ D$ D$\$D$D${$$$$L$D$bD$D$D$$8$L$(L$T$ T$\$$\$ l$l$l$l$D$w$8$5L$($ȋL$ $΋L$$$$$$T$$1T$$2$<e $q$8Yd}[YXiTq`9 \5 +CCYdKYdiTqX׋Q`9 luKQ`} $D$қD$tD$($8|$ TƄ$@4Éu막u딃u1|#tBYXiTq`9T5 "BBQdJQdYTiXq`93ÀuKY`} $D$ԚD$tD$($8|$ YƄ$@4É݃u멉u떃u1냋QTYXi`94* D$,D$D$,T$|T$= uYtAd| $Ƅ$@4É $D$D$t $8Ƅ$@4Ö u랖–E9D$|T(„t kU9T(uiU9T(„t 'u7U9T(uU9|D(1111륋D$|1VA$e uj]Q A(y,T$$Q0A+e u3AYQAƄ$@4ÍyƍQ ׉ō]녖 uD$4D$D$4–M9L*t$8L$$8M9XL*M9?L*t$8L$$8_ufM9L*uMM9L*t$8L$$8 L$$8111h1a1 u N9L5t$8N9ZL5N9AL5t$8SuUN9 L5uD$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$8$L$(L$T$ T$\$$\$ $l$$l$r D$ $8$5`膆L$($ȋL$ $΋L$$$$$$$$$$$$$$$$$$$<e u$ׅaf$|$$D$ID$(T$ 7Ƅ$@4Ë$8A$e ur]Q T$(Q(T$ Q,T$$Q0Ae u38|AYQAƄ$@4Íy8|ƍy ]Ƅ$@4Éu u u 1   } v o h a Z S L E > 7 0 Ygte ;a4L$8Qd111ӉʋL$8T$i\qXiTQ`9t$$l$0tnЕ ts $\$T$T$D$ D$L$T$\$8kd}D$ L$(T$,$D$kD$tD$ L$(T$,\$8ND$L4Ël$A$e ul]Q T$A$e urQ T$,Q(T$0Q,T$4Q0Ae u3.AYQAƄ$ĘÍy.iƍy i뇋@@AdHAdAXQTY`9؉A`AdA\QXYTi`l$ $T$D$,D$$L$(|$P5_nL$,L$TL$0L$XL$4L$\D$`T$dD$(D$hD$LL$HT$DT$pL$tD$xD$We D$;Af$l$XuFqdNqdЋQXߋYTi`9 +€D$T|$PQ`QXYTi`9++T$<CCYdKYdiXqTQ`9u,2UQ`QTYXi`9;TZЀ 09CCYdKYdYXiTq`9\5ÀY`҃Ћ\$<\$3$$L$T$l$ \$t$D$l$X$$T$8묀rujT$8Zl$<9$ 13$$L$T$l$ \$`t$D$l$X$$T$8묀t]uul$<\$8$ZvujT$8Zl$<9$ 143$$L$T$l$ \$t$D$l$X$$T$8묀x@l$<\$8$$$L$L$8L$L$BKt볃\D$\G E$|$l D$XG E$|$k ] \ \ \ \ \ e ;aD$ D$7Hu,D$ $D$WD$D$$D$,ÃuT$̍^$A|$Ge u uT$vuT$aT$B SWD$$D$,ËD$$D$D$L$D$ tD$$D$,WD$$D$,ÍH wIu)D$1ɉ$L$ D$D$$D$,Ãu T$1ϋT$1ă u T$1뵃 u T$J륃 u T$1떍^$|$Ge u CCWuH uD$ZD$$D$,Ãu D$^$l|$Ge u sͻ(sͻD$G E$|$h D$G E$|$h D$G E$|$h e ;a9D$ D$HBD$T$,T$u*T$(9ЇÇ9!9 ȈD$0Ãul$(U͍^$|$Ge u ul$(Uvul$(U`ul$(]ULuT$^$胜|$Ge u uT$uT$T$ BD$$D$D$L$D$ t 1D$0ËD$$$D$(D$D$,D$D$ ՍH  D$1ɋT$,T$ u#T$(199!9 ˆT$0Ãu l$(U1ԃ u l$(U1Í^$8|$Ge u CC ul$(U1p ul$(U]\ ul$(U1IuT$1T$1 u T$1 uT$J u T$1^$f|$Ge u CCH} D$ZD$, uD$(Zf.D$0Ãu D$(D$^$˙|$Ge u sͻsͻ>u D$t^$y|$Ge u sͻ^sͻQD$G E$|$d D$G E$|$c D$G E$|$c D$G E$|$c D$G E$|$c D$G E$|$}c 0$D$cc e ;aD$ P H(X$h9$l$L$\$ ыD$L$tm@ $ЋD$L$$YT$D$ L$ D$D$L$T$ Be u JD$$ÍzOD$ @(D$$D$${T 0$D$Ab e ;avH D$$$D$(D$D$,D$D$0D$ D$4D$D$*D$L$D$8L$< !e $<;A%DD$8D$<DŽ$`DŽ$d$`D$$TRD$9V ı$sD$ Ԍd Ќd Pe OH D$0$\He $D$0H e$D$D$( 3 $D$D$D$D$L$L$T$ T$43$D$D$ɨD$ L$L$$T$|$@1D$4$D$$D$$$D$$$$e |$(t$@m$L$P$H\$(k4S-e -\Rk4KDCH e gS@CL\$$PRD$|T.D$($D$$Td  d e $Xd L$8T$,$D$t$D$ t'Ƅ$$$$\$>H$$L$d$$$L$T$$tI$$1| 0 $$T$y`L$ T$$$ 0 $$L$J`L$ T$$$$$$$  f $D$($L$D$ D$.L$L$PT$$$|$L$PO e u/$DŽ$p$$ĤË$f̉A $$@P $ЋD$D$\H$$@L $ЋD$L$0$$$59u4 $D$l$D$ t$$T$h\$l$$ $ЋD$L$$ T$D$6L$ D$D$D$HL$$$蔅|$D$HGe u/$DŽ$p$$ĤË$11$$ $ЋD$L$$ͼT$D$ L$ D$D$D$DL$$$ф|$D$DGe u/$DŽ$p$$ĤË$!̃|$$ $D$D$L$ T$.BJD$h$T$lӉ‹D$\$1ҋ\$ll$h$ŋ$ މӉl$h\$ll$h$$$$P%$0$P  $$T$$4$0\$D$ D$z$D'ġ$YD$L$`$HZ\$|$D9$t$xH $l$T$$$DD$|$HD$x$LD$h$@  $$T$$4$0l$\$ }|$e $0D$hHT$l9~$L$h-e <u.$0$@$9(D$h$T$t`$|$$0D$T$t$멍`$$l$D$T$ L$[\$D$T$HD$hL`$|$$0D$&T$x$ `& $D$D$D$ \$t$D$L$`T$x\$|$ $2D$L$`$8P$DDŽ$HDŽ$L%$$ $ЋD$L$$pT$D$$4$0\$ T$c9T$D$ L$D$ mD$(D$LL$$$$l|$D$LGe u/$DŽ$p$$ĤË$DŽ$$$ĤÍ$|$G)e u. vDŽ$p$$ĤÍ v>ͅ]$$$$L$$$T$\$ D$1D$h$ HT$l9$$L$hT$l-e <$Z$$L$$$T$\$ |$e u$$D$\$T$h\$lF`$|$$D$ ɍ`$|$$D$\`$$l$D$T$ L$\$D$T$HD$h$$ $ЋD$L$$pT$D$$$T$ \$c9T$D$ L$D$ D$(D$@L$$$$}|$D$@Ge u/$DŽ$p$$ĤË$̋$t$p $D$D$ L$$$|1ۋ$D$T8L$p$$$ $D$D$D$ yD$}$$9L$p$)$|e |$$L$hOL$lO e $G$D$\Ge $C$$$$$htd D$$D$4|$ e uB$e $m$$DŽ$DŽ$ĤË$&빍Oω‹$)$$$DŽ$DŽ$Ĥ8 @e D$;A$$$$L$$T$D$L$ `$L$D$ZD$L$T$ $݃\$DDn0$$$L$l$mAD$D$HL$ L$<$$$\$$l$H&D$D$LL$ I T$@JD$LL$@D$D$$ĄË$$$D$l$D$ $ĄÃCw<t1$Ąŀt$׋$u$ 붍^$Nx|$Ge u ͻ$ͻC`t뭋$$$D$l$D$ $ĄÃCsu($!Ȉ$ĄÃu$Ѝ^$\w|$Ge u u$wu$_$ BN$$$D$l$D$ $ĄÍC wKu%$1Ʌ!$ĄÃu$1Ӌ$1Ń u $1볃 u$J렃 u $1뎍^$v|$Ge u CCC u,$ZWf.!$ĄÃu $э^$u|$Ge u sͻ$sͻCwXtB $D$$Ąŀt$$tƄ$ĄË$܃u$̍^$t|$Ge u ͻͻCDt뭃#7D$DG E$|$? D$DG E$|$> D$DG E$|$> D$DG E$|$> D$DG E$|$> e ;a7D$ Bt+toD$D$ Í&D$D$ ÍZD$D$ Ãt+uD$D$ Í7D$D$ ÍD$D$ ÃCt+u&D$D$ ÍʼD$D$ ÍKD$D$ Ãt+ uD$D$ ÍnD$D$ ÍPD$D$ Ãs + uxD$D$ ÍƞD$D$ à t+ufD$D$ ÍD$D$ ÍpD$D$ ÃCt+uD$D$ ÍЕD$D$ ÍmD$D$ Ãt4t&D$D$ ÍmD$D$ ÍD$D$ 莱e ;a$D$(}kD$D$ JL$ _ ȉD$ $D$D$D$D$ D$WD$L$D$,L$0$ȋܾc ؾc 9}sˋ@L$,D$0$, 辰9e ;akD$ 6ZtCt+tD$D$ ÍʼD$D$ ÍsD$D$ (ÍD$D$ Ãt+u㞼D$D$ ÍpD$D$ ÍD$D$ !ÃCt+u]D$D$ Í_D$D$ +ÍD$D$ 2à t+ umD$D$ *Í~sD$D$ (Í>D$D$ %ÃC t+ uE.D$D$ $ÍCD$D$ *Í}D$D$ "Ãt+u۽D$D$ 0ÍD$D$ 2Íi.D$D$ $ÃCt+u?cD$D$ 'ÍD$D$ !ÍڽD$D$ 0Ãt4t0D$D$ ÍD$D$ )ÍpD$D$ #*ue ;aeD$L$9NT$ u D$Ík^wh9 lÇݕt븍k=*s맀h9lÇݕt ru cuiX9s~\uTh9smlÇݕt1(u&X9s<Du 1111e1( ( ( ~( w( 蠬{e ;a>D$L$9'T$ u D$À u u u׀h9lÇݕt륀h9luvh9lÇݕt YuAh9sMlu*h9s:Dt !11111N#' ' ' ' 7e ;a8D$0D$4BD$$J L$RT$,D$DD$H\$D\$$TR\$W*nL$<Wd ? d e D$@d L$0D$4L$0QӃ uʀ\$,$l$$l$L$D$ T$ΞD$,HPXl$99))!͍ +T$|$ L$(p$i|$D$GD$ Ge uD$(D$D|$H08ËD$( D$DD$H08111=d D$@D$@11108& & 褨e ;aRTT$DBD$4J Zj$l$L$ D$D$$L$ L$0T$L$HD$LT$Pp$T$HT$ ED$ L$ $D$i4D$$L$01 \$@ ى‰L$@T$,D$D$L$ $L$-D$(L$H1 \$X ى‰L$XT$8D$TY\$Pil$,$\$l$&D$DT$\$ L$  $\$T$ 訮D$:D$L$D$D$L$TL$ T$PT$\$,\$SD$LƀTL$\ $T$`T$\$0\$l$Tl$ l$Pl$l$,l$(D$L$T$ \$L$D$D$D$ L$T$TSD$8@L$(9111]=d %111B$L$D$8D$ BJ Z$L$D$$D$ L$T$D$YD$T$D$PD$D$,D$%D$L$ L$|$DŽ$DŽ$0$L$|L$V8D$ L$$$<$D$=$D$D$ D$D$L$L$tD$x0$D$tD$7D$ L$ $D$) 讞ye ;aXL$`uXËT$dj9l/CR1e$tD$D$JىL$ T$艤D$L$L$8D$D$\$ L$D$(D$ L$`ى\$ T$$D$D$D$ L$`T$\$ D$\$5T$L$D$ L$`T$dD$\$"T$L$D$ L$dQt ʋL$`T$$8D$OD$ jL$hY/jqt$$?:5 '93ϋKu|T$dBe uX"4$L$gD$B$D$3D$L$ T$h e uBXË|$$׍"롁qSu| `&9u{ unT$dBe uJ"B$*D$K3D$L$ T$h e uBXË|$$蓲׍"脲믋L$d뀉ϾRL$d_L$`T$dD$\$wT$L$D$ L$`T$d\$D$\$L$zD$ ^L$`T$df+ $ Me ;a<e vD$ L$T$T$DL$HD$L$͋8e ;a,D$u c c D$(L$,T$0 Í%$L$L$T$ D$Ѓ u c  c 뽃uȋ c c 11迂:e ;a,D$u c c D$@L$DT$H,Í%$L$ L$T$ D$Ѓ u c  c 뽃uȋ c c 몋L$ T$$D$@T$DD$H,Àe ;a $LD$$D$D$D$ s D$L$tmD$w>u c c D$(L$,T$0 Í%$L$L$T$ D$Ѓ u c  c 뽃uȋ c c 11:e ;a $%D$$D$D$(D$D$ D$L$tmD$w>u c c D$,L$0T$4 Í%$L$NL$T$ D$Ѓ u c  c 뽃uȋ c c 11:e ;aiDD$H$D$LD$D$L$T$ *D$0D$P$D$TD$WD$L$T$ D$4T$,\$\l$XD$0D$@L$u c c D$dL$hT$lDÍ%$L$L$T$ D$(Ѓ u c  c 뽃uȋ c c 몋L$,T$4렍-xe .D$dT$hD$lDD$dT$hL$lD}we ;a4D$<$D$@D$D$L$ T$D$,L$(T$0$)D$8D$D$0D$D$DD$ D$HD$D$D$D$$taw6uc c D$LL$P4Í % $D$D$L$ ؃ uc c Ńűc c 벋D$(L$,먉L$LD$P4s|e ;a$D$0L$,L$ $T$(T$L$D$ D$L$tmD$w>u c c D$8T$L$dD$h@ÉT$dL$h@ze ;a$D$0L$,L$ $T$(T$L$D$ D$L$tmD$w>u c c D$8T$u c c D$HT$LL$P0Í%$L$L$ T$D$(Ѓ u c c 뽃uȋc c 11뤍 xe >v e ;a,$D$0D$D$4D$D$8D$ D$u c c D$HT$LL$P,Í%$L$L$ T$D$(Ѓ u c c 뽃uȋc c 11u"e ;ae vu e 蒓-p舑t %@e $u c e Í=c 赌.uYۓ+{黔+e ;avJD$$L$L$D$D$ L$ $D$D$`D$ D$ote ;av[D$D$L$ $D$/D$ u 1D$ËD$D$D$$D$`D$ se ;avD$D$?se ;avD$D$Ose ;a $93D$D$L$ ʃ[у&ʃуHPX (9tjtY98$)ى!L$)ډT$D$ GzD$L$IȉD$$T$(ù귺D$$D$(É$ ܺL$D$RD$P$ L$D$/D$L$ $ ܺL$D$D$T$ $ L$D$D$L$ $ L$D$身D$T$ ~  q%e ;a4D$@$D$L$L$D$ D$$D$(D$,D$00$L$8L$ D$ L$L$$D$(0$D$D$ D$ L$L$,D$0mȺ$D$D$$D$D$ D$!D$L$L$DD$H4pe ;a<$D$L$ T$D$$D$L$ T$D$ ;$D$8;$D$4  $D$D$D$0 @ $D$D$D$, @ $D$D$D$( @ $D$jD$D$$  $/D$L$H e ujL$HL$8HL$4HL$0L$,HL$(H L$$H$D$D$$ EL$D$D$@D$DD$H<ÍxD$视yD$8蛆yD$4菆ϋD$0脆Q׋D$,vy D$(jy$D$$^hL$ T$D$$D$@D$D$DD$ D$HD$QP~dY 9|)ӉY AP11҅u9 e xp$u+D$$ÍV$|$t$(B$|$GJe ulD$pwl^%D$D$$ ߻L$D$*D$L$ $D$D$eu$D$$ D$$D$$ÃEtL$ $D$}D$$D$euD$$D$$ÃEt.t>D$QP~dY 9|)ӉY AP11҅u9 e xp$u>*D$$ÍV$|$t$.'B$~|$GJe ulD$pwl#D$$D$eu$D$$D$$D$$ÃEt$L$ǖ $L$蹖 $D$論 Oe ;aD$1D$$3D$PЃ vtFtBD$ L$ZP~]j 9|)݉j BP11ۅu9e yq$u (D$ÍV$|$t$%D$ tTCM$|$GJe ulD$ L$pzl`"މ$T$肕 e ;av2 D$.tD$ ËD$$~D$$D$w e ;av[ D$euHD$$D$-u,D$$D$L$ $D$=D$D$ Ã+t݃Et e ;a\D$`$KD$<D$`HL$$+D$-uZD$`$D$D$,$ D$uۋD$,$ D$uƋD$,  D$`H PX+X8(l$99))!, )u< -\$$ -wFD$PCD$TL$XD$<D$@$D$PD$訡D$ L$L$L$ZP~dj 9|)݉j BP11ۅu9e yq$u D$$ÍV$|$t$D$C$ |$GJe ulD$L$pslmދD$$ /ʻL$D$=D$L$ kwkkwk$T$& o*e ;a D$$H+H8L$$D$D$$$D$D$$/D$uۋD$$D$uƋD$-t.tD$$QPY 9|)ӉY AP11҅ e xp$ueH P@\$99$)ى!щL$)؉D$l$ D$L$L$(D$, ÍV$|$t$D$$t`BY$|$GJe ulD$$p"lID$$)| $L$[ ?e ;a|$YLCYL|$@1$Y+Y8\$HY 'AD$LA D$P|$Tt$@$PHt)t$Tl$D$$D$Ѓ|Í|$ht$TA$D$($D$,D$0D$4D$8D$<V$D$hD$gD$L$ D$0L$40$D$(D$D$ L$L$8D$<|ud 0  $D$ݺD$D$ D$0D$D$D$d|ËA<~AHD$LAD$0BDŽ$DŽ$p$$piĄÍzD$0뻍V$|$D$@D$aDŽ$DŽ$p}d t}d $$ iĄÍHtS$$D$L$T$ C$$$$hĄË$$oD$ L$T$B$$$$[hĄË$$ D$L$ T$C$$$$hĄÐhĄe ;alD$tD$xD$|D$p$ sL$D$D$ D$$LD$_?$D$p|$|$, e pt$<S$D$D$D$0L$ T$\$pk$ t$|$HD$Huq e T$,zu.D$0B(t$MJ, 5C1Le uCD$4 M$\$l$t$ L$KD$L$T$\$0S0e uC(ڋ$͉ËD$4j{(x$ÉyX1-DŽ$$$\ĔÃ}D$hD$l $D$pD$lD$L$ D$hL$l$D$7D$hD$D$ D$p$D$/D$L$ p}d e u t}d e Í=t}d =Qe ;av: D$$L$L$D$L$ $D$0D$D$ _e ;aD$H\$k39te1Ʉt[HS9uMH S 9u?HS9u1KSX@9t 1D$É$L$\$D$ 1111щ4$T$l$ L$ D$\${@e ;avD$@ D$he ;aC4D$8L$)e ;av4e vuZD e |e e ;avBD$$L$L$D$L$ $D$D$ MD$ D$e ;aviD$HT$Z*09t11Ʉu 1D$ÃD$B$D$ +D$ ׉,$t$\$L$ D$T${e ;av?,YuD$ L$PQQDY@iq  99$)މۇ!ލL5L$)ډT$D$ D$L$L$T$PZDZ@|$,1L$ L$,rP|$0d\$DL$L$H|$Tt$,-L11뮃"tXD$($L$L$$AgD$D$D$L$L$D$D$P$m 1D$P$j,u -tU.uD$P$gD$Ѓ v D$P$%D$L$P $D$fD$P$D$Ѓ w!D$P$D$P$D$-D$P$ CL$D$ 1[":u [ ]u {u }}D$P$L$D$D$P$L D$L$utrueu juVfalsuGQetރu nullu 9D$P$ CL$D$ 1뻋BHB\Be vu* e '8e [e ;av%D$$D$D$LD$ͅe ;aQjz(+Cz$D$, V $T$t$D$DD$HD$`D$LD$dD$PD$ht$ll$p\$t<ËL$LQ\$P9OD$H<-e u/l$D,D$`T$d\$hD$TD$lD$XD$pD$\D$t<ÉD$Dgɍ$D$HD$L$\$ T$1|D$L$\$QL$L{褧e ;a0HL$LI(Iw1@9[ -C9tL$XQ\$\9RD$T<-e u2l$P,D$lT$p\$tD$`D$xD$dD$|D$h$HÉD$Piƍ$D$TD$L$\$ T$3{D$L$\$QL$XxT$DL$01\$hl$dt$`|$,GL$0T$Dl$d9_D$,\$hl$dt$@ L$4\$Pki5`4$l$l$/yD$D$ L$ L$8T$T$$\$Pks;|$t$l$-`,$L$D$T$ D$PHT$ 9D$4hp\$l$t$`$l$$)͉l$(ۇ!l$8L$)T$T$(T$ J$\eD$D$D$XL$\D$`#PÐ#P萜e D$;A`$D$D$2oD$D$\L$ L$XT$\$l$ 1L$Lqʼnщډˉl$TT$H\$Dt$L$$D |$pt$\'D$p$p$t$X߸`${[|$|$Pe $诸L$DQ\$H9/D$T<-e u l$P,+D$P²`$l$Tl$L$\$ T$oD$L$\$QL$D랍 0$|$$D$WiD$LD$`D$d$@D$$Q2D$L$ D$`L$dE/$D$D$`D$D$ D$cD$L$DŽ$DŽ$DŽ$$$ĴËD$T$D$D$D$H$DŽ$DŽ$ĴD$hD$l$@D$$k1D$ L$L$hD$lE/$D$D$hD$D$ D$}D$L$DŽ$DŽ$DŽ$$$ĴÅtKK}d }d DŽ$DŽ$DŽ$$$ĴÍ$X|$Ge uDDŽ$DŽ$DŽ$p$$ĴÍwe ;a=lD$tD$xD$|DŽ$D$p$ L$D$ D$ D$$LD$D$p$4 t$|$,D$,|$Lt$,D$$D$($D$LD$R.D$L$ D$$L$(櫽$D$-D$$D$D$ D$DD$L$D$tD$xD$|$klËD$p$;D$L$ T$C\$tD$xT$|$0lD$tD$x}d }d D$|$là tD D$p$!D$L$T$ C\$tD$xL$|$lËD$p$D$L$T$ B\$tD$xL$|${lÐqle ;a{lD$tD$xD$|D$p$  L$D$ D$ D$$LD$3D$p$t$|$,²D$, u.D$p$D$L$T$ D$tL$xT$|lÍ|$Lt$,uD$$D$($D$LD$+D$ L$L$$D$(R$D$'D$$D$D$ D$D$L$D$tD$xL$|lD$t}d }d L$xD$|lÐlzee ;aD$D$ D$$D$$ sL$D$D$ D$$LD$$SD$D$L$ $)D$ L$T$t \$[uA e u%D$P(D$D$ D$$ËL$y(D$L$ D$$ÐSe ;aI\D$dD$hD$lD$`$ NL$D$ D$ D$$LD$c $RD$D$0L$L$$D$`$|$t$l\$he u\$\D$D\$pH|$hËD$\訠މ|$L  $\$l\$D$T$ l$n]t$D$T$hD$< BC|$Lx,$L$\L$L$lL$D$ T$D$pD$D$DD$|$t$ l$$T$(\$,D$0|$4 BC,$L$\L$L$lL$D$ T$D$pD$D$DD$|$&T$(l$$|$4t$ D$0\$, B"v Bq BCh Mt$<‰|]s)9Ћ<9t$8T$de 4uT$8\$d뮉É D$d떋|$T_We u$D$x$D$|$Ƅ$tÉ軞Չ$D$|$Ƅ$tø`  e ;aLBD$|$8t$P1L$dL$ L$hL$$D$(D$,D$0D$4 W $L$8L$]D$L$ D$(L$,0$D$ D$D$ L$L$0D$4Ⱥ$D$D$(D$D$ D$)D$L$T$e uJLÍz耝ie ;ae vu e e-Lnp$D$8D$L$ }d e u }d e Í=}d ҜKVe ;aD$$L$L$D$ D$ L$Q$D$D$L$Q$$D$D$L$QD$D$D$> D$ L$H $D$D$ D$ D$莄Ie ;a D$T$9tb1Ʉu;1Ʉt1HDZD8u!HHZH9u@LJL9D$ 111J$ $H$L$TL$D$T$릍J $HL$3L$D$T$|̃Ge ;a<D$(D$,L$@d  d e WD$Dd L$(D$,L$(.QӃ uʀӃBl$H9T$Ljl$LT$HD$0D$4D$8 $D$\$D$L$T$ \$0$Գ\$D$\$H\$ \$L\$T$D$L$D$ L$$D$PL$T<Ël$LT$HiT$;B|$Ge u3pD$P|$T<Í3衙111=d D$D腙D$D111"e ;adDŽ$DŽ$$<ȃL$,#T$hjr}9EB T$$LD$D$,@FujD$h$D$lD$D$pD$D$tD$ D$xD$D$|D$$D$$D$D$ L$$$$dËD$t@L$x $Ѝt$|$PD$lD$8D$pD$D$ L$L$@D$DD$,D$HD$xD$L$D$D$@D$D$ D$`D$D$,L$L$ $"6|$|$(e uKt$P腓L$ T$(J e uD$,Bp$$dÍzD$,gڍV$|$D$PD$;뢸ue ;a:lD$8D$L$,T$0J e uD$4Bp$$tÍzD$4 ڍV$|$D$`D$뢉词T.D$$L$(09A $D$D$D$ -D$L$T$\$$ʃ`&$\$D$ L$d t d e u}d L$8D$t$T$|$ A$Ѝ$T$q$$$$$t@$DŽ$DŽ$ DŽ$$DŽ$( 0 $$L$\D$ L$$$ $$$$$()$D$#$D$D$ D$iD$D$PL$$$(|$$e uZ$TpL$P$J e u%$Bp$$Íz$[jԍV$|$$TD$,m듉1¸$$iD$$ ` $PD$ e u>$$GG e u pCiNj$i빸D$\G E$|$ $T$'D$ Q[e ;a4D$L$L$PL$T$TT$D$ L$@( $ЋD$L$ $D$D$D$0L$ L$,T$T$($L$T$D$L$T$ \$8$\$<\$\$@\$\$D\$ \$H\$T$D$L$D$ L$$t D$XL$\4ËD$L$D$PD$D$TD$D$0D$ D$,D$D$(D$OD$XD$\4Pe D$;AP$$$$$D$PL$(T$T$T$L$.D$ L$@( $ЋD$D$XL$L$,T$(ӃT$L^jyT$Tl$P$\$LT$|l$x~wuB93$5|pC9$aD$\H M$L$L$3"D$D$0L$ T$\Z\$H1 Et$H9}=49׍0Ce \u3ɉ߉dfD$0붉D$0L$t1ҋ\$Ll$|t$xDŽ$DŽ$DŽ$D$l$D$p$D$D$D$x$D$|D$D$LD$$D$ D$D$\$ l$t$D$8PD$0L$t9T$8\$Ll$|t$xыX\$`D$4$$$$DŽ$DŽ$DŽ$DŽ$=0<$$|$4D$ L$$$`&$L$8L$(D$L$ $$Ⱥ$D$$L$D$ D$聴D$D$dL$L$ ge ;avUD$H(P$X h,9w7)!ى $)T$D$XD$H4L$ H4H$H,˖ e ;avQD$H<;uH4AH4H$H,@<À>tu$GD$HuыH4H4e ;a$D$($軨D$L$t@9u*Iu3\$(e uK$Í{0σ$$5D$D$D$,D$ D$0D$D$L$D$L$ 0$D$D$GD$L$ $L$S e ;av# D$$D$L$L$D$ Ve ;a4D$<D$@D$8D$$ WL$虗D$u L$pA<ӋL$p͍y D$h,듉t$DD$T3$l$t$|$ T$|$l$D$TL$pT$H\$4t$D$9)\$(D$|)!Ћq$T$Hi(y 9Jm9el$D|$h 7 $D$\$J3D$HL$pA$D$DA(e D$hA D$(A0 $4D$8H$L$# ‹\$pS8k@sD~9T$"l$d4v||$`|GLTk4[09 GT$dDl\$"\D$p@0@4@8LL$HT$# t tD$xL$pT$t\$8$ L$ND$# tL$HtD$pD$p$ D$L$$$uKD$# u;D$pH t$ )y D$h0)D$\t$D3$|$t$l$ T$|$l$D$\L$pT$H\$(t$Do<~$9)\$0|$|)ۇ!,:y$T$HA(q 9h9`D$Dt$h>$l$\$Z0D$HL$pA$D$DA(e uMD$hA D$0A0 $HD$8$L$pQt P$As3i$݋$69.D$|9"t$<)\$$)!Ћy$;T$Hi(q 99l$Dt$h > $D$\$.D$HL$pA$D$DA(e u6D$hA D$$A0D$<$ $GD$xL$pT$t\$8Ry D$h&ÉD$L|$D3$t$|$l$ T$^t$l$D$LL$pT$H\$$|$D.݉$9)؉D$,t$|)އۇ!Y$4t$Hy i(9wx9|$hl$D  $T$D$-D$HL$pA$D$DA(e u#D$hA D$,A0D$x$rlÍy D$h%։T$X\$D3$|$\$l$ t$Zl$|$D$,L$pT$X\$Dt$HAl芊 胊 | u n g ` Y R K D m e ;avb$`$D$$D$(D$D$,D$D$0D$ D$4D$D$8D$D$l$ 2|$X\!|$X6&|$lt$X)&|$Dt$l&$t$D & ܥ $T$(T$$\$|$  e u L$,7D$,))$6D$ 7 e ]L$(H$ $$L$D$$1} ܥ$D$(D$$D$$$$$$Q(Y,i$r9!ZY(|e uD 롉D$0`$l$T$\$ t$D$L$T$$S,e uC$ʉŋD$0뎍{$ꋄ$H,P(@$D$8T$D$d$D$ B1\$$l$(L$!T$l$r~t$@~t$49u\cfD$"D$d$L$"L$D$D$ <W$hы$|9!L$!T$ $Tы$9L$ t{L$@Yl$49u@F\$0l$09}et$,ϋ il$( L$p1D$$1D$!1D$ 1D$d$D$ jA1L$@$l$4t$,|$t딋L$@l$4늋L$@)q9D L$D$$D$L$T$ \$d$T$L$D$ ;D$@HIT$49Z$؍$1L$@)I9CLL$D$L$Di $5\$$I\$4J$L$tj(l$01D$d$D$ 1@D$@H\$49,k9LL$8$1L$8i T$5J9D L$H$ L$HI$ 50z$$,B9uiL$8Q(u^Q QRQ I$ލC9ufu>I(Iu4M(u-M M!M U$9u6uJ(Iu D$@4D$d$D$ >1Ct$4ֺù듋 L$\$L$\$$$$ $t$h L$L$4L$L$4P$$4=$$*l$hdD$dHX @9)؉!Љ$ )ى$$҆Ë L$X$L$X$$$$$)$DŽ$@DŽ$@JD$xD$|L$x$D$|7$D$D$xD$D$ D$ve$$\$D$L$ T$\$d$T$L$D$ `7V5WEͲu༪9$tfuϸ( 9uI$$$T$D$L$T$ \$d$L$T$D$ 6뷋$$\$D$ L$T$\$d$L$D$T$ 6R$9B$$1K$5P$ e xuA$c$\$ID$ L$T$\$d$L$D$T$ 5 \$TV$|$$D$$\$T띋 L$P$  L$Pq$ $$ $$)sJ`9$^s*9$T$<$$ ̪L$D$*D$ D$$LD$O{uUD$a 7a 0a )b "a Ke D$;AU $D$D$X$$$111/T$vC9uu v9׉ӉϾL$`$l$H$11|$X QIL$T$L$d $sD$L$T$ $$T$L$D$ |D$L$T$$$D$T$L$ U$$D$ D$Xx$ CT$L$l$\t$P9ND$Aj$l$$D$GD$ L$T$T$D$$D$T$L$ D$L$T$$$T$L$D$ bD$CCL$L9$d  \$C$$\$l$T$ 7CL$L9$u Q($$D$ mD$A$H,IT$P9r$\$`$ꋜ$l$HϋL$`9,Um$ C9t$PT$LE$E$hl$\$1/L$B$$D$ $L$BT$PH$T$P1.$$$D$ _1D$T$$D$ CD$T@L$HT$D)9|Ӌ$@(HL$\$1:T$X YIL$\$$ $lD$XP$L$\\$H9|L5$$D$ $$L$CL$D$D$ T$l$\$\$Cyx$$$D$ 0 CT$L$$t$P<11$$ :L$D$V$H P@9wm)ȉ!؉$)ʉ$$ĠË$$$D$KD$ L$T$$$$ĠW e ;aDD$D$,$Q,T$ Y(\$(1t$nD$,T$ \$(9l$L$@D$$Q$ҍ|$0t$,D$<$Q 9uUD$C9u@D$$u. uY,u@(tƄ$DƄ$DƄ$DøƄ$DƄ$De ;a4 $yD$D$,$ 0L$D$gD$|$TL$TL$D $L$@$ $$L$L$8L$D$ D$ L$D$ VL$D$ L$8L$$z=L$,T$0\$4l$($$$$e ;aX$D$4vz&$D$,D$D$ZD$ L$T$\$,l$(1D$L$ T$( e uB뢍z9똋D$$D$D$S }Ge ;avJD$t@D$ D$D$ D$D$D$ $D$D$(|/}e ;a$D$fD$ fD$ D$8D$D$(HL$ L$ $L$,L$L$0L$L$4L$ D$L$T$t D$aYe ;a8D$DL$<QX $T$@T$D$D$D$'L$ L$4T$T$,\$e ;a"<^ t(D$LT$H!م ˄uT$P<ËT$HL$@L$$L$DL$(D$,D$0D$4D$8 `3 $T$D$D$ L$D$,L$00$L$$L$rD$ L$L$4D$8ϼ$D$ D$,D$D$ D$D$L$D$L$ 0$D$D$D$ L$ $D$ c=e ;a8BD$$J L$Z\$ R$\$L$D$L$ T$D$$t!HD$D$ L$4y$114Pe ;a (D$HL$D $D$&&D$D$ D$L$ $D$̀D$D$L$L$ T$ T$0$D$D$$ " $L$L$T$D$ AD$L$@|$$Ge uNtDD$tL$ L$`D$d|$hD$D$l(ËD$,L$0D$`L$d|$hD$D$l(1븉K<4e ;avNBL$YT$\$ `$D$D|$e u D$ËD$RK;3e ;av-BL$IT$L$ ` $D$G2e ;avfe vu蚲 e cGZ-OX ~G$$L-*4谭e 2e ;av+D$$D$D$D$?D$ D$2e ;av,D$D$D$$D$opD$ D$]2e ;avBD$$L$L$D$蟺D$ L$ $D$rD$D$1e ;avVD$T$9u?JX9u1H @Z R9t 1D$É$D$\$oD$ 111e ;avLYuID$t3HX@ $L$\$D$ ݃D$L$D$ L$$$ 1뛍|$9;u#e ;ao`D$@D$DD$HD$LD$PD$TD$XD$\ ǨL$P ǨL$XL$d d  d e D$hd L$HD$LL$HQӃ uʀT$$D$8L$4 $D$T$1D$D$0L$ L$ 1\$,SD$0L$ 3T$,\Pk5d td 5e -d \$@l$D\$@s u΀$l$t$菶D$D$v.qe ;a0D$4$D$8D$CD$ L$t=Y~f-Ǩ9Lu Ǩ9tZ$|$Ge u*|D$TD$XpD$\|$`0Í|"EщT$,D$<@PL$@ $ЋD$D$(L$DIPT$H$ыD$($D$LD$D$PD$ T$,ЋD$L$T$\$\$TT$XL$\D$`0ú+L$< $L$@L$L$DL$L$HL$ L$LL$L$PL$ыD$ L$\$l$$\$TL$XD$\l$`0ɸ,Ae ;av`*$mD$ 8L$HL$H e uL$ H @L$D$ÍxD$ C9,e ;avY@+$D$ @8L$H e uL$ H L$D$ÍxD$ IC+e ;av@D$@MD$+e ;a4\D$`H0$L$L$:D$ D$,L$L$T$T$ \$`+l$0st$(1zًT$ \$`l$0t$(9|$$D@L$4D$8D$<D$@0$L$4L$SD$L$ D$t$8lUe ,ƅu]t$LL$P|$T4ɉ=߉T$(\$00$T$8T$D$l$ L${t$D$l$HD$ D$4u> u> / u> dl$(=@ /$L$\$論D$ L$@( $ЋD$L$@P $ЋD$D$(D$P$L$TL$T$8T$pD$ D$0L$P $T$TT$\$8\$pD$ 3 $T$0T$D$D$D$ L$ L$ uY$$$T$$T$ ȈD$ SjDŽ$DŽ$ČÃu 럍^$y|$Ge u @ 0u Mu <uA+>  u>1ɋ$$$T$$T$ ȈD$ Siu1뺃 u1뮍^$舱|$Ge u C4C$ u 1` u IQ u1C >  uEZ$$$D$$D$Wf. L$ mhu븍^$诰|$Ge u sͻ@sͻ"0\$(L$HT$Du@ =$D$T$D$X$$$D$$D$SwD$ D$$L$L$@T$D$T$HT$T$(T$'wD$ L$T$$tRL$RD$L$ $$Ⱥ$D$$L$D$ D$!D$L$$$D$L$D$@D$ D$`D$D$dD$D$hD$D$HD$ D$ L$$D$8L$lT$<\$4Cl$(t$T|$PʼnЉl$(\$4D$^ZT\$Xe u$Yϋ$جF$0$L$t$l$ \$iD$L$T$$Se uC ڋ$Ή$a{ j݋$$P$T$H$LDŽ$DŽ$DŽ$DŽ$4$$PL$-D$L$ $$0$$HL$,D$L$ $$׶$D$$L$D$ D$`\$l$$$508DŽ$DŽ$ĨÉ$D$pL$t$S|$D$pGD$tGe u$$0$$ĨË$׉$$$0$D$l$(fD$ $L$L$TT$T$P$1胫  $$l$$t$n$L$PT$T$$p$L$PT$TL$P$k509Yum94$\$PT$TT2 ȋe u)뉉ωک{$$-0,$D$L$T$ \$fD$L$T$YL$P$$z$$$L$T$u#$$`$$d$$T$PT$$T$ĝT$ D$D$L$$X$\DŽ$tDŽ$xDŽ$|DŽ$0$$`L$)D$ L$$t$x0$$XL$)D$ L$$|$y8$D$$tD$D$ D$D$L$$$$T$$T$L$ D$hL$D$T$$$$\$h$\$h$$$D$D$HD$0$$$L$L$hL$$L$$L$$L$ nD$$L$ u$L$pT$tÉȉщ+$$T$pT$T$tT$L$ D$gT$L$D$뾋$$ $$$$T$h$DŽ$DŽ$DŽ$DŽ$0$$ \$'D$ L$$$0$$L$~'D$ L$$$׶$D$$L$D$ D$T$\$=$$$$,1  $$T$$,\$j$,$rl$,$Q$I$$L$T$D$L$ 09Hu$L$$D$L$hL$ jD$l$$$L$$T$$\$ $l$$t$D$ L$T$$$$uD$pL$t$߉ 7$$$$$t$L111a=d c 111F$L$hىЋ$-$$@$$DD$x@L$ $ЋD$L$@P $ЋD$D$|DŽ$DŽ$DŽ$DŽ$ 0 $$@L$$D$L$ $$ V$D$|D$#D$ L$$$zϽ$D$0$D$D$ D$D$L$$$ĨÉ$t$'D$  $t$'D$  0$D$   :e ;aLD$DD$HBD$8JL$@1ҋ\$Pl$Tt$d|$`T$4B߉É͋D$8L$@9T$4ыH$L$\$l$ D$XD$L$\L$|$t$#\D$$L$(T$,\$  d td e urd \$DD$HL$DtRQՃ uʀŅu 115l$<\$0 $D$T$D$ L$\$0l$<111뼍=d [뇉111D$hD$lL$pT$tLÉ|$ht$lD$pD$tL]e ;a<4BJT$8t$D$@D$HD$DD$LD$PD$T4ËT$<uӋT$@09T$DZu`$HD$D$(D$,D$0@$D$(D$!D$L$ D$HL$LD$PD$T4É$\$L$D$ (}D$L$T$L$D$ T$$@$D$D$z!D$L$ D$HL$LD$PD$T4É$\$'D$` 虇e ;aM(D$,@PL$0 $ЋD$yD$ L$$L$ \$49t$D$$QYi 1~#9<99$)ۇ݉!\$)ʉT$D$ Zxtqd L$T$$T$L$|D$fD$ +uQ@$9-D$ Pi: e u$H$Íx$蚄݃-t$D$uD$ $TD$tQ@$,D$ f: e u$H$Íx$DŽ$DŽ$&$D$ D$D$ L$$$$${WD$D$$D$ D$D$ D$$Ë$ $D$g@$+D$ i: e u$H$Íx$*݉ @$f+D$ h: e u$H$Íx$ǂݍ$L$D$)D$ @$*D$ h: e u$H$Íx$Kݍ @ $D$D$譨D$ @$n*D$ Ph: e u$H$Íx$ρݍ辺$L$D$1D$ &@$)D$ h: e u$H$Íx$SݍP$L$D$赧D$ -@$v)D$ Pg: e u$H$Íx$׀݉$;$H$uQ@$)D$ Pe: e u$H$Íx$pݍ@$(D$ e: e u$H$Íx$݃#'tZ,@$V(D$ g: e u$H$Íx$ݍ@$(D$ g: e u$H$Íx$fݍ@$'D$ e: e u($H $D$D$$Íx$‰ȉɃ[.=ta[qH$AH$ @ $('D$ Pf: e u$H$Íx$~ݍ@$&D$ e: e u$H$Íx$8~݉$D$D$D$ D$D$rD$$Ã_]tM_m$-D$D$#D$ D$D$D$$ËH$IH$ @ $%D$ f: e u$H$Íx$A}݃{tZ}@$%D$ g: e u$H$Íx$|ݍ@$0%D$ f: e u$H$Íx$|s94        dQe ;a8D$<PX9 P0BP0@4BtHAHH PXh99~$)ىى!ˍ L$)l$D$ nD$L$L$ |$$1w|D$|$D$$Ge u:$DŽ$DŽ$p$$Ë$V ?" 6"$$D$D$4D$1D$ D$DD$L$$jr9|; u(j0Ej0B4*E*PZCZDj4Ej4q 9/U9 P0BP0@4BtHAH111PD$L$D$@D$D$%J$$D$D$D$L$$jr9|; u(j0Ej0B4*E*=ZCZ1j4Ej449m$$D$D$4D$5D$ D$=D$L$$jr9|; u(j0Ej0B4*E*ZCZj4Ej4뿃tu9 P0BP0@4BtHAH111PD$P$D$DD$D$C$$D$D$8D$=D$,HT$\$$T$8$L$,(px9l$D,$D$tY$PX9|; u(P0BP0@4B5HAH)P4BP4E 뿍$2|$Ge u9KDŽ$DŽ$p$$ÍKyM,$T$D$D$ D$L$uC$D$D$A$$D$D$4D$;L$D$h$VD$D$$D$ D$8D$M;D$$L$L$ $ |$D$ Ge u:$DŽ$DŽ$p$$Ë$QLP4BP4_ :9$$D$D$4D$7D$ D$}:D$L$$jr9|; u(j0Ej0B4*E*&ZCZj4Ej4$\P,P4BP4b= =$PX9jM$ 9|u ubP0BP0@4BtHAH$l$l$?$$D$D$4D$P9D$L$-P4BP4 녃 u9rDŽ$DŽ$&$l$D$ L$$$$$D$$D$D$ D$贚D$L$DŽ$DŽ$$$9$),2$L$D$JpD$ f$$D$4$DŽ$DŽ$Ë$$L$T$oD$ $$輸$ $$蓸$$脸$$L$D$noD$ |$         ݬ ֬ Ϭ Ȭ  躬 賬 謬 襬 螬 藬 萬 艬 肭 { t m 0e ;a`D$d$[D$dH PX(u999D$($)!͍ +L$)‰T$t$ :D$L$11L$$\$d$T$L$D$ D$ 6D$L$T$\$aL$H|$L1HL$dY(\$LY,\$PD$T\$H\$XT$\QZi ȋI9ZXe <t$LLHHH0H(H4H,$L$$L$莶D$dHHH0H(H4H, @ $D$ e: e uL$dHD$h`ÍxD$dGF$|$D$LD$ID$d`$L$T$l$ \$D$L$T$\$dS e uCʉ{E@$ЋD$d$D$ D$D$D$D$h`ÈD$#D$d$D$d$D$#$L$D$kD$ h脪 -e ;a PD$TPX9 P0BP0@4BtHAHP Xh9q[9 P0BP0@4BtHAHH PXhB9:92$)ى!ˍ L$)ʼnl$t$ _7D$L$L$ |$<1ED$TH(L$$|$D$(D$AD$T뉍$\$L$l$ T$}D$L$T$\$TS e uCËD$T!{Z>P4BP4Ve 1^,P4BP4K X h<949,$)Ӊ!T$)L$t$ 1D$L$L$ |$<1>L$TY(\$HHH0H(H4H, @ $\D$ Pe: e uL$THD$XPÍxD$T8$|$D$(D$;D$T뉍$\$L$l$ T$wD$L$T$\$TS e uCËD$T!{T8Y4CY4V%T0$|$D$nD$D$J$D$ D$D$~D$$Ét51 * #          ݈ ։ ψ Ȉ  躈 賉 謈 `e ;av< D$D$Pe:D$D$D$D$ ы$u } e ;av@ ^$D$Ee L$u tqd Í=tqd # e ;a)4D$8$D${$$$D$$D$HD$ D$,t$$1D$, 9$$$D$D$L$ $$DŽ$DŽ$ĠË$$$D$$D$nD$L$ L$@D$D0$D$@D$CD$ L$$$DŽ$DŽ$ĠË$$$D$$D$$D$ $D$$D$D$ L$$T$\$$$$$ĠË$$$D$$D$$D$ $D$$D$AD$ L$T$\$(\$4l$$l$,T$dL$hD$l+$D$dD$蓁D$ L$$$D$,$D$4$ĠË$$$D$$D$$D$ $D$$D$D$L$ T$@׸$$$$ĠË$$$D$$D$@D$L$ T$T$4\$\$,l$L$pD$tl$x$D$pD$肀D$ L$$$D$,$D$4$ĠË$@($ $ЋD$D$,L$L$4$$$T$$T$9$$D$,D$D$4D$UD$L$ T$$\$$$$$ĠËD$0G E$|$9q D$0G E$|$q D$0G E$|$q $L$'D$k{ 4e ;avX,|$1zL$0L$ <L$$D$(L$ $L$4L$L$8L$L$ T$L$D$L$$$$$$$$$Ãt/#0$$LL$)nD$ T$$P$L $D$D$@ `D$$L$$D$ B$D$JmD$L$ $uf$$$D$$D$$D$ @)D$L$T$$$$$$$$Ë$P$L $D$D$ D$ @rkD$L$$T$$\$- ',$\$D$^lD$L$ $uz$$$D$$D$$D$ T(D$L$T$$$$$$$$É$$$$$D$$D$ sD$L$ $$$T$L$D$ c4D$L$$$$$$$$$1$$$$$$DŽ$DŽ$111Ƌ$$$L$gD$$L$ $T$$$$|nD$$L$$1T$|$$$kL$4$ՋD$L$$$$T$T$|T$L$ D$nD$L$T$$$$l$$t$T$ L$D$$D$$D$$D$ N$P$$9L$ ЋY$ $DŽ$(DŽ$,$($,$,$$(t$D$D$ nD$$L$$$Z($,$Ӌ$$$L$ $L$KD$L$$T$ \$l$$$$$$0$$40$$0L$hD$ L$tod t d e uGd $$$tQӃ ʀ111=d l111$$$$$D$$D$,oD$L$ $$$T$L$D$ 0D$L$$$$$$$$$Ë$$$!$$$D$$D$@׸D$ $D$W&D$ L$$T$\$l$$$$$$tJ xe ;a\@D$H$L$LL$T$TT$T$ aD$D$y$ $$$9$$$L$T$LT$MD$ L$@$$T$$\$ $D$ $$$L$^D$L$ T$$L$D$\D$ $L$L$|$$$\$l$Ll$$t$ $|$bD$L$L$x\$|k8T$,D$8$Kى !T$tqt$pω ҉T$l!ىL$ht$, !։! ދL$hL$lы\$p ى!։҃!‹D$t! Ӈ ‹D$,9T$89 „$$ $ЋD$L$$ $$$1$$$$$$0$$ D$R]D$L$ $$&$D$$D$D$ D${,D$L$DŽ$DŽ$DŽ$$$ĐË$$$D$D$LD$$D$ $D$`D$L$T$$$$DŽ$DŽ$ĐÉ\$|^$蕃|$Ge u GGu _^$C|$Ge u zu  u uX$$ $ЋD$L$$($,$1:$$$$ $$0$$(D$ [D$ L$$$mM$D$$D$D$ D$6*D$L$DŽ$DŽ$DŽ$$$ĐÉ$$D$L$ D$ nD$L$$$D$L$FD$ L$$L$`WD$L$T$\$ ID$`$$$ $ЋD$L$$0$4D$`H$$p1$$p$$t$x$| 0 $$0L$gYL$ T$$$$$$$  $D$$pL$D$ D$t(L$T$DŽ$DŽ$DŽ$$$ĐÉy$T$\$)XD$ L$d td e um d $$$tFPӃ uʀ$$$DŽ$DŽ$Đ111ƍ=d ‰111뫋L$LM115111=d $|$p111H$d  d e o$d $$$8Z݃ uˀʼn$$\$D$D$\$ED$ L$@$$T$$\$ $D$ `&$Df$$ $$$\$l$Dl$L$ D$kZD$L$D$|!ʅ „$$$L$UD$L$ T$$L$D$SD$D$|L$ $$$$\$l$Dl$$t$ $|$YD$L$D$x k1ɋT$|ZD$0L$4$ډT$dZۉΉى ҉T$t!փ ! ! !ى!׋L$dT$0t$t!!! ‹D$499 „$$ $ЋD$L$$$ $1$$$$$$0$$D$jTD$ L$$$&$D$$D$D$ D$#D$L$DŽ$DŽ$DŽ$$$ĐË$$$D$D$DD$$D$ $D$WD$L$T$$$$DŽ$DŽ$ĐÉT$|^$z|$Ge u YY xu 1 u 1{^$Oz|$Ge u CEC5 u 1- u I u1$$ $ЋD$L$$$$1O$$$$$$0$$D$"RD$ L$$$c$D$($D$D$ D$K!D$L$DŽ$DŽ$DŽ$$$ĐÃu 8^$x|$Ge u @u u uA11i$$ $ЋD$L$$$$1$$$$$$0$$D$PD$ L$$$mM$D$$D$D$ D$D$L$DŽ$DŽ$DŽ$$$ĐÉ111=d $${111$HP$$ыD$$tI$$P1w$$P$$T$X$\$$`$$d V $T$WNL$ T$$h$l  $D$$PL$D$ D$`L$T$DŽ$DŽ$DŽ$$$ĐÍH$d  d e $d $$$oZ݃ uˀʼn\$@$$$D$\$uTRUETuTrueAS=true+AtjuFALSuVQEXuFalsu5Qe<=falsAeփ뵉 $D$PT$D$ KD$D$ L$4 D$ L$4S $D$OT$D$ D$D$ L$4yD$ L$4u1u  u F1t*u Tt҃ufutt͉ $D$$T$D$ jD$D$$L$0}D$$L$0}>uTRUETuTrueAS=true+AtjuFALSuVQEuFalsu5Qe=falsAeփ뵉 $D$PT$D$ rD$D$$L$0 D$$L$0S $D$OT$D$ /D$D$$L$0D$D$$L$L$ T$ T$00$D$D$=D$ D$,L$L$T$T$ $*D$L$@HL$DH e L$$P e u$PF%x‹$nD$D  $D$$ e $H$H e uO$H$݈X$݈X݋l$D\$TkEhkh$Fjx$ n릍x$mp12!  CVe ;avH D$$$D$(D$D$,D$D$ D$D$D$0D$D$4D$ Ue ;avz$D$,$D$0D$D$D$ JD$L$T$\$($D$L$T$ D$4D$D$8D$D$17111L$!AMe ;avoD$ $D$$D$GTD$L$ T$\$l$tD$(\$,l$0É$L$T${D$ L$T$D$(L$,T$0Lue ;a,D$0HA_B>fu*;9u D$8D$4D$fU 399L$4$D$L$D$ L$T$urD$D$ D$0D$D$4D$ n$D$D$D$D$ D$|D$L$D$8D$<L$@D$D,Ë@$ЋD$L$L$$D$(0$D$$D$D$ L$L$8D$f?w=.1u-`397?u '9!L$4u?߁>°`B9T$4tZAuÍ &9uA u '$L$L$D$L$ L$8D$d \$tD$xL$ttQӃ ʀ111=d Y111DŽ$DŽ$$$ĜÉ$L$D$ID$D$hL$ L$H$ D$L$H e u8L$hH F$$DŽ$DŽ$ĜÍxD$hQX뽋D$XL$011xD$L$L$PL$T$$T$D$ #D$L$T$$L$D$wD$ L$d td e uR d D$|$D$|t1PӃ uʀ$L$T$L$T$ 111ۍ=d ‰kW111111 =d $BW$111q $L$'D$ ?e ;axD$`D$dL$|d } d e R$d L$`D$dT$`$Z݃ uˀʼnރu< $l$cD$L$ T$\$$$$$xÃt $l$D$L$ T$\$uqL$LT$$$8D$L$$ e u5L$LH F$$DŽ$DŽ$xÍxD$LUDŽ$DŽ$$$xÉt$X0CX0@4CtPBPXh9|T땋X4CX4T먋PXh 0~999D$$)ۇ!\$)‰T$L$ D$L$t51u D$ <~d b ; $ _ ȉD$ D$L$ (d e  ,d 0$(D$D$L$ d e  d B$ 0L$D$L$ d e Q d B$8D$rD$L$ d e  d  '$ @L$8D$L$ 0d e  4d  '$ HL$D$L$ 8d e m Yu;D$t%H$L$軎D$L$ D$L$z 멍|$9;u#e ;avBD$$L$L$8D$L$ $D$D$D$ D$e ;avgD$H\$k39t/1Ʉt%KP8uK @ 8D$11$t$L$5L$ D$\$e ;avYD$$L$L$:D$L$Q$D$D$8D$ L$ $D$7D$D$e ;aD$H\$+s9tn1ɄtdKP9uVK P 8uFH S 8t1KSX@9t 1D$É$T$\$3D$ 1111щ$L$t$@L$ D$\$r7e ;av D$$L$L$w6D$L$Q$D$`6D$L$Q$D$I6D$L$Q$D$26D$L$ $D$6D$D$ ee ;a=D$H\$k391ɄH Pks 91ɄHPks9tt1ɄtjHSkp9t;1Ʉt1H$S$[ @ 9t 1D$É$D$T$_2D$ 1݉,$t$T$D2L$ D$\$1뤉,$T$t$!2L$ D$\$l1e,$T$t$1L$ D$\$)1"4$T$l$1L$ D$\$e ;avxD$$L$L$G7D$L$Q$D$D${D$ L$Q $D$D$L$4 $D$D$ {D$ D$!le ;aD$H\$k39t}1ɄtsKP8ucH S 8u11Ʉu 1D$ÍK4L$4$D$ 0D$ ׍H $K L$kL$D$\$11먉$L$l$=L$ D$\$c=(e ;avBD$$L$L$2D$L$ $D$D$hzD$ D$e ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$x/L$ D$T$de ;av7 Yu4D$t$D$L$L$D$ s 밍|$9;uĉ#e ;avBD$$L$L$D$ OyD$ L$ $D$1D$D$e ;avdD$T$9uMJX9u?HZ9u1H@ ZR 9t 1D$É$D$\$=.D$ 111%e ;av1Yu.t$tS D$D$ q 붍|$9;uʉ#e ;av, Yu)D$@ $D$D$D$ }뻍|$9;uω#e ;av9Yu6t$ t 谇D$L$L$$D$(q 뮍|$ 9;u‰#e ;av+ Yu(D$L$$L$PD$D$$ 뼍|$9;uЉ#e ;avpD$$L$L$w/D$L$Q$D$`/D$L$Q$D$D$vD$ L$ $D$*/D$D$)te ;aD$H\$k391ɄH Pks 9tb1Ʉu;1Ʉt1H@S[9t 1D$É$D$\$+D$ 1ݍHL$K $4L$D$\$릉,$T$t$a+L$ D$\$1z4$T$l$;+L$ D$\$>$e ;avxD$$L$L$1D$L$Q$D$-D$L$Q$D$D$1uD$ L$ $D$D$uD$ D$le ;aD$H\$k391ɄtzK P hs9tK1ɄtAKP8u1KP8u!KP9u@K9D$1111,$t$T$)L$ D$\$1딉$L$l$Y5L$ D$\$\e ;av81L$ D$ T$‰$L$ /L$D$ @|ۉL$1e ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$o5D$ uD$ D$ ze ;av81L$ D$ T$‰$L$L+L$D$ @|ۉL$Ae ;avkD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$'D$ uD$ D$ ye ;av=D$D$ !;D$D$D$ D$$D$D$}Le ;av D$@(D$e ;avD$@L$D$ e ;av) D$H@I$ыD$L$D$L$ e ;av) D$H@I$ыD$L$D$L$ Pe ;a,D$0@L$4 $ЋD$L$L$D$ D$$D$(0$D$D$qD$ L$L$$D$( +$D$D$$D$D$ D$ND$L$L$8D$<,Ee ;a D$t3Hbqu9umT$tSiSu 9u:T$tL$D$L$ É $T$RD$$DL$кÉ$)L$뵺Le ;a;\b$D$ |$,1$L$`L$L$,L$" D$,$D$,L$0PY\$ L$$T$D$ L$T$D$L$$Zbqz-9bt$iS 9t$tA,$D$ D$D$L$ e u L$H3xD$"$t$VQD$$D$D$(  $T$ T$\$$\$\$\$ D$ e u T$(PxD$(: 14$- 9u+ $T$ND$D$0$PL$0ȉ- 5몍- 5كhq e ;a`D$dD$HL$hL$LD$PD$TD$XD$\0T$P\$T$\$H\$zD$L$ D$XL$\qd $D$PD$D$D$ ]D$h1ɄUL$dD$L$,1҄^!1҄ $D$HD$L$T$ \$D$4L$$D$@D$D0D$@D$Dqd $D$@D$D$D$ D$$t@D$8D$<D$8D$4D$<qd $D$8D$D$D$ QD$lD$p`É$T$!D$L$ D$lL$p`É $D$D$ L$L$lD$p`ÉL$0D$ $D$D$;T$ D$ L$0 $D$T$D$ D$+"L$9D$(H\$,ى $T$gD$L$ $D$L$D$L$()ȉ!ȋL$,ȉD$ T$D$L$ $D$D$cT$ D$L$,$L$T$hro$D$L$BT$dЉD$ L$ L$D$^D$d$ }L$D$L$ D$h&[ [ \e ;a$D$(@2D$L$ $D$D$0HT$(ЉD$D$,HD$ L$D$L$L$4D$8D$4D$8ÉD$4T$8D$4D$8ÍD$4D$$D$8le ;a( D$0L$,T$4\$$t$Ft$,|$4L$$\$$l$09D$k3t$ l$ $D$T$D$L$$L$$L$(L$QD$L$PpL$\$09hbq59u\9+T$D$$$T$4)ʉډ!ыT$,щL$)\$ t$D$L$L$8D$< ÁiSux- 9ue$T$ 0D$L$T$09\$$$D$D$4)ȉ؉!D$,L$)T$ t$DL$D$u11l- 5m- 5։D$8T$< D$8D$< ÍD$8D$(D$< b@ [@ T@ }e ;a D$,L$0T$(\$$l$4%|$w|$,D$0L$(\$$l$4L$0T$(9t$$l$T$t$ L$D$tvt+Hbqua9tiSu 9zD$$HD$ L$D$($D$D$D$0D$D$L$D$8L$< ÍD$8D$< D$8D$< ? 9e ;aF,D$@HY)"9$D$DD$-D$D$(L$8T$<\$4l$0)|$ w|$8D$°.Ө u`@9uVD$$D$$D$n*D$ L$T$L$4D$8T$<@$D$4D$@WD$ L$L$dD$hTÁ;9u3D$$D$$D$&D$ ;L$d _ ȉD$hTÁ.uL B9uBD$$D$$D$'D$B$D$UD$L$ L$dD$hTËD$$L$_.띁juPy9uFD$$D$$D$&D$L$ y$D$L$6UD$L$ L$dD$hTÁ?uo '9uFD$$D$$D$'D$L$  '$D$L$TD$L$ L$dD$hTÁ>°/ `B9>°߁'AuH&9u>D$$D$$D$!'D$ `& $D$SD$L$ D$dL$hTÁDup9t' `'9tD$$D$$D$&%t$|$@G$D$@D$RD$ L$L$dD$hTÁ'똁\uX09uND$$D$$D$&D$ L$L$,D$00$D$,D$SD$L$ D$dL$hTÁ΀u&9qS `&9D$rD$dD$hT{e ;a,$z|$Ge  |$G, e WGкG($XzD$ `T$J e Be L$yT|$ $QTe $D$HXЄe $D$H\賄e $XD$H`薄e $(D$Hdye $D$Hh\e $D$Hl@pL$0 $L$4L$L$8L$D$ L$D$L$D$$L$(T$$teCP$ЋD$uBD$$D$D$$e L$uD$HTD$<,Ë|$ iD$D$<,11D$<,ËT$zl7,T$zh"T$zdT$z`T$z\lT$zX<zO(ύGкke ;av5qd $D$D$D$D$D$ L$D$ L$$贷e ;avGD$$D$D$D$ D$D$ L$$L$k"D$L$ D$$L$(Re ;av@D$$D$D$D$ D$D$ L$$L$D$D$$e ;av?D$$D$D$D$ D$?D$ L$$L$k!D$D$$蚶e ;av?D$$D$D$D$ D$D$ L$$L$ D$D$$:e ;avGD$$D$D$D$ D$D$ L$$L$ D$ L$L$$D$(ҵe ;avCD$$D$D$D$ D$D$ L$$L${D$D$$ve ;av\0|$@1L$4 $L$8L$L$D$ L$$$ĴÃu booltnu =int8bD$4@L$P $ЋD$L$$$0$$D$>D$ L$$$ĴËD$4@L$P $ЋD$L$L$\D$`0$D$\D$>D$ L$ $D$D$ ;$ _ ȉ$Ĵà D$8L$X@}Fuint1u5Q6X=int3A25uint6u Q4  $ S7L$D$$D$ ~D$4@L$P $ЋD$L$1҄ HȃJ9x )ʉ!ʍ 1ɄtvKG 9? $L$t D$L$T$ $$$@$$D$Z=D$ L$$$ĴÉ뙉D$H\$8 $:D$l$ L$ D$H\$8R1I‰D$ L$D $0D$D$T$ D$ L$D $D$#T$D$ ED$D$8L$XD$8L$X $D$ȯT$D$ D$ D$8L$XD$8L$XDŽ$DŽ$ĴË$Q\T$ $T$LT$D$D$,D$ vD$DŽ$DŽ$ĴÉ$$ĴË$Q`T$ $T$LT$D$\$,\$ D$u D$(fDŽ$DŽ$ĴÉ$$ĴË$QTT$ $T$LT$D$\$,\$ D$u D$(DŽ$DŽ$ĴÉ$$ĴË$Qh"\$T$ $T$LT$D$\$,\$ jD$u D$(DŽ$DŽ$ĴË$ $D$T$D$L$T$ u D$(T$lL$p0$D$lD$9D$ L$$$ĴÉ $$D$$T$D$L$ $$L$D$PD$L$T$ ucD$( $$ $T$LT$D$\$,\$ D$uD$(DŽ$DŽ$ĴÉT$tL$x0$D$tD$8D$ L$$$ĴË$Qd`\$T$ $T$LT$D$l$,l$ D$u D$(DŽ$DŽ$ĴÉL$TD$0P $D$u D$(D$0HT$T$ыD$L$finQtD$0@L$T $ЋD$L$$$0$$D$7D$L$ $L$ D$ `& $D$6D$ L$$$ĴÃu boolthu =int8YD$0@L$T $ЋD$L$L$|$0$D$|D$6D$ L$$$ĴËD$0@L$T $ЋD$L$$$0$$D$6D$ L$ $D$D$ ;$ _ ȉ$Ĵà D$8L$X@}Fuint1u5Q6L=int3A2)uint6u Q4  $ S7L$D$&D$ {D$0@L$T $ЋD$L$1҄HȃJ9)ʉ!ʍ 1ɄtvK^9V$L$vD$L$ T$$$$@$$D$\5D$ L$$$ĴÉ뙉D$<\$8 $:D$l$ L$ D$<\$8R1I‰D$$L$@ $0D$D$T$ D$$L$@ $D$#T$D$ GD$D$8L$XD$8L$X $D$ȯT$D$ D$ D$8L$XD$8L$X$QXT$ $T$LT$D$\$,\$ D$DŽ$DŽ$ĴÉ$$ĴÉD$LL$,T$($Hl $I2D$$ $T$LT$T$(T$T$,T$ D$ D$qDŽ$DŽ$Ĵ      "e D$;A$/$Y|$$Ge M$|$ GG G $gYD$D$ 3 $D$D$QlD$L$ L$T$|$$1蹱L$L$$\$(T$, p L$0L$ L$4D$HD$L e uy|$t$$|$P`|$PWD$P,L$L$`L$P $L$ T$\$l$t$$$$$$ĘÍ $D$D$L$$L$1o$ޯ$+XD$$DŽ$DŽ$DŽ$DŽ$Ęe ;avDD$$D$ D$wD$L$ T$$D$L$[D$ D$$襗e ;av D$@H耗e ;av&L$e uD$ALÍyLD$躮3e ;avGD$$$D$(D$觝D$L$ T$$T$T$T$ T$D$ L$ Җe ;apD$x$D$|D$CD$ D$|L$L$x$9'D$t$$L$T$ID$ L$T$|9D$tHlL$ " $\$x\$T$ pD$tpËD$tHTL$  $T$xT$\$|\$ :D$HT$D$tH`L$  $T$xT$\$|\$ D$HT$D$tH\L$  $T$xT$\$|\$ 輢D$HT$,D$tHXL$  $T$xT$\$|\$ }D$T$@u`D$t@lD$"$D$xD$D$|D$ ¥|$$Ge u$$PL$D$(D$tHXL$  $T$xT$\$|\$ ڨD$tHXL$  $$L$$T$ +D$L$ e u L$(H xD$(迫L$0D$ D$tH\L$  $T$xT$\$|\$ ID$tH\L$  $$T$$\$ 蚤D$L$  e u L$0HTxD$0.CL$4D$D$tH`L$  $T$xT$\$|\$ 踧D$tH`L$  $$T$$\$ D$L$ e u L$4HxD$4蝪sL$,D$$D$tHTL$  $T$xT$\$|\$ 'D$tHTL$  $$T$$\$ xD$L$$ e u L$,HxD$, L$x $D$T$sD$ D$xD$HD$|D$L$D$@$L$DT$t$D$L$ D$L$ L$8D$<|$P1艪0D$P L$T$L$HL$}*D$L$ D$XL$\0$L$@L$W*D$ L$L$`D$d0$D$8D$1*D$ L$L$hD$lqd $D$PD$D$D$  ?T$| $$T$D$FD$ $(Se ;a?PD$THlL$ " $L$XL$T$\T$ D$L$PT$D$L$XL$(L$\L$,D$ T$$|$01 0L$0 \$4 $\$(\$ )L$T$ L$8T$< 0L$@(T$D $L$ L$(L$ T$T$HL$L qd $L$0L$D$D$ 诇L$T $L$L$L$L$L$ T$L$`T$dPËD$XD$`D$\D$dPƏe ;avUD$$L$ L$L$$L$oD$ L$T$RTT$$D$L$ 覜D$D$(Te ;a`0D$8$D$D$L$T$Y9\$$D$(T$LI$L$D$L$ T$$|~D$,L$ D$4@\$D$(D$T$D$D$ KD$  $D$D$,D$D$ D$ ՞D$L$@ e u L$DH0ÍxD$Dj   Սe ;a`0D$8$D$D$L$T$\$ UL$0T$$D$h$=D$L$$L$ظc c ܸc D$T$ L$蓭D$D$0D$DL$$L$HD$TD$XD$\D$`0T$T\$X$T$DT$#D$L$ D$\L$`qd $D$TD$D$D$ 茂D$hHP $T$L$0L$L$$L$ D$L$T$\$l$ D$8L$(T$,YU$D$4 z $dJ|$D$(GD$,Ge D$8G GGD$h$ L$|$L$4L$ w D$L$u; e uD$4L$hATD$lD$pdËL$hyTD$4bډD$lL$pdËD$8Kh\$ll$pdËD$h$;D$L$L$LD$P$D$LD$h%D$ L$L$lD$pdÉ\$lD$pdce ;aHD$8D$<0D$8D$<qd $D$8D$D$D$ 荀D$L$;D$L$T$\$ qD$$L$0D$L$:D$L$ $D$ܸc c ظc T$D$ L$蓪D$D$LHP $T$L$0L$L$$L$ `D$L$T$\$l$ D$4L$(T$,z$G|$D$(GD$,Ge uID$4G GGD$L$D$|$ D$ L$D$PL$THËD$4,벉\$Pl$THËD$L$9D$L$D$@L$D$D$@D$L#D$L$ D$PL$THÉ\$PT$THGe ;av^QD$ e $u3PTT$ $D$ D$D$$D$DD$L$L$(D$,ÍxTTˆe ;avofQ$D$L$ $T$$T$T$(T$D$ D$L$t D$,L$0ËD$ $D$D$#D$L$ D$,L$0:ue ;avz D$HTt?D$$褡D$@TD$D$$D$D$D$ Pe $u D$HT릋T$zT(蟅je ;avLD$$8D$L$ t L$ D$$ËD$$D$ VD$L$L$ D$$-e ;avLD$$7D$L$ t L$ D$$ËD$$D$ D$L$L$ D$$轄e ;av8D$$D$ D$D$$D$D$ D$L$D$(L$,ae ;av8D$$D$ D$D$$D$D$ *D$L$D$(L$,e ;a\D$TD$X0D$T L$X qd $L$TL$D$D$ -{D$d$L$hL$pD$L$ @D$($IL$$L$c ܸc -ظc l$\$ T$DD$D$`HT[L$lAPXR,l$dl$l$hl$L$ D$$ҋD$L$T$\$ t T$p\$t\ËT$`$D$L$D$(D$ D$$D$x D$L$D$pL$t\ËD$d$L$hL$ D$L$$L$'D$tD$`?D$dD$,D$hD$0D$4D$80$D$,D$D$L$ D$4L$8<$D$.D$4D$D$ D$D$L$D$pL$t\xLe $u D$`HTT$`zTrD$(D$D$L$dA A$e _A$e zt6Jt$Hh@ 9j $)ʼnۇ!$)L$T$D$ D$L$e \$$ZtC$C 0 $D$D$*QD$ D$|L$T$T$0$k$s [\$t$l$0$D$T$L$ 谚1L$@AL$09D$@L$|Z\$4$$ut4$T$\$DD$D$ L$ L$h$$T$4T$T$D$ qD$L$T$Z9D$t\$D$XHL$$P T$ 1l$]D$XL$$T$ 9}D\$ً*R$l$T$D$L$ tL$\D$`D$dD$hTD$,D$0D$(D$@$D$ L$L$,D$0$D$D$,D$D$ D$D$L$D$4D$8D$<D$@T$XZ(R,\$4T$8D$wD$,WN\$D$,$L$<~D$ t~D$0$D$ D$"D$L$ $9t $$$D$L$}D$ t L$u $뿋$$̖ĈËL$$$$$D$L$}D$ t/L$tL$$$B$L$$$JĈÃuoD$DL$HtMt@D$4D$8D$4L$8$D$D$4D$D$ D$<$$֕Ĉ >Ce ;aH\$D$4L$T$t9tRD$TD$XT$TL$XD$T$D$D$6=D$4D$$ EL$踽D$`$D$ L$T$\$tUt@D$LD$PD$L\$P"$D$ D$LD$D$ D$;\ÉL$8T$( $T$' D$ D$,L$L$< $D$)D$D$@L$ L$00$=D$D$DL$8 $T$(T$*D$ L$|$DGe w$D$D$H$D$̒D$DD$ D$4D$L$HL$ T$8T$T$(T$T$S%;pe ;a(6G GGD$,H`L$ $ L$|$诺D$$D$0$L$$L$裞D$$HL$T$ @D$z$|$D$GD$Ge u D$ aD$ mRS:.e ;ae vu e kS?$5V ku {薶|Zw<]h_/ru5kae :9e ;av9(Yu6t$,t WfD$$L$ L$0D$4(跻 9뮍|$,9;u‰#e ;av9(Yu6t$,t VPfD$$L$ L$0D$4(W P9뮍|$,9;u‰#e ;av9(Yu6t$,t UVeD$$L$ L$0D$4( 8뮍|$,9;u‰#e ;av9(Yu6t$,t UeD$$L$ L$0D$4(藺 8뮍|$,9;u‰#e ;av: D$$L$L$GyD$L$ $D$0yD$D$ /8e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$uD$ 1݉4$T$l$uL$ D$\$7qe ;avLYuID$t3H P@$D$T$L$ bD$L$D$ L$$4 -7뛍|$9;u#e ;av>Yu;D$t%@ $D$k]D$L$ D$L$¸ 6멍|$9;u#e ;av>Yu;D$t%@ $D$+ND$L$ D$L$R K6멍|$9;u#e ;av>Yu;D$t%H$L$`D$L$ D$L$ 5멍|$9;u#e ;av>Yu;D$t%H$L$_D$L$ D$L$r k5멍|$9;u#e ;av>Yu;D$t%H$L$[_D$L$ D$L$ 4멍|$9;u#e ;avh D$$L$L$uD$L$Q$D$uD$L$Q$D$yuD$L$ $D$buD$D$ a4|e ;aD$H\$k391ɄH Pks 9tt1ɄtjHPks9t;1Ʉt1HS[@9t 1D$É$D$T$qD$ 1݉,$T$t$qL$ D$\$1뤉,$T$t$qL$ D$\$l1e4$T$l$VqL$ D$\$)?3e ;av0Yu-D$ t$ID$D$ 2뷍|$ 9;uˉ#e ;av7 Yu4D$t$ID$L$D$L$ 艴 2밍|$9;uĉ#e ;av7 Yu4D$t$bID$L$D$L$ ) "2밍|$9;uĉ#e ;av7 Yu4D$t$RID$L$D$L$ ɳ 1밍|$9;uĉ#e ;av/Yu,D$ t$D$D$Gq j1븍|$ 9;ủ#e ;av81L$ D$ T$‰$L$uL$D$ @|ۉL$1e ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$?zD$ uD$ D$ o0ze ;aD$(uR$|$G e u"<D$,pD$0|$4Í<oGٍ$D$D$L$ L$  $L$$L$L$(L$ e vuz e T@"Z8e #e ;av: D$$L$L$dD$L$ $D$dD$D$ #e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$5aD$ 1݉4$T$l$aL$ D$\$#qe ;aHD$L$D$PD$D$-1D$ +D$-1L$i-1х…!Ӆ ӄt1ɉD$LL$PT$XËl$TÇ!ޅ ޖ2ʚ;1ۉT$0\$4aD$D$, $L$(T$0$\$4\$D$ʚ;D$ ~D$D$L$L$T$0$T$4T$D$ʚ;D$ D$D$$L$L$ T$$T$T$vD$D$@D$ $D$$D$VD$D$8`$\D$@L$(H T$,PD$8 @^L$@XHL$D$T$XD$$脆 he ;a0e v0u e b/x2$D$"lD$ L$ }d e ux}d |$m't$b'D$L$ $D$D$-1D$ KD$-1L$e i-1Љe e 0Í=}d "! e ;av3 Yu0D$t$D$D$ M F 봍|$9;uȉ#e ;av7 Yu4D$t$D$L$L$D$  밍|$9;uĉ#e ;avJD$$L$L$D$D$ L$ $D$D$hD$ D$oe ;av@D$T$8t 1D$ÃD$B$D$hFD$ e ;aD$$L$L$D$ KD$ L$Q $D$D$,D$ L$Q$$D$ID$L$Q,$D$ID$L$Q4$D$ID$L$Q<$D$pID$L$D $D$D$(豏D$ D$ e ;aD$T$9JX9HZ81Ʉt@$J$f.ukzi@,J,f.uUzS@4J4f.u?z=@<JS e |u DD$(D$@D$DD$H89݉D$4@$l$\$T$ t$D$L$T$\$<e uŋD$4ʉىixD$$yD$<ȋL$<ω$l$\$L$ t$nD$L$T$\$<e uڋ|$$ˉŋD$(X:/$l$\$L$ t$D$L$T$\$<e uCxڋ|$$ˉŋD$({xD$@\$DT$H8ÉL$@D$DD$H8ù $D$ D$L$T$ T$ \$T$Z*r R9)!T$,)\$0|$4L$8D$<$Í 9ul‰T$ L$uG\$(k8[<5 9D$$SD$ L$T$\$KC e uSD$ L$X{i¸덍 ͱ$谦D$  T$(J8e uBT$0l$899l$8\$T;$L$t$pD$0L$\AD$8Ae u;D$TAD$,T$49)‹\$ )É!؋\$DÉȉ։ى_|$LD$T 뽉|$83$\$|$l$ T$جl$\$D$\L$DT$0t$,|$8,D$<ƋD$<ʉ|$d91L$HL$h9!|$( ;L$899l$4t$P$D$`D$|$CD$8L$\AD$4A e u\$@lt$(u-e <˅uL$8؉ӉD$80$l$@l$L$T$ D$薥\$D$T$@L$ 둋L$8 $D$D$ \$$$$L M e ;av* e u Uud Í=ud Ue ;av}D$$D$ D$D$L$T$ \$uFA$ЋD$td d D$$L$(éItD$$D$(ÉD$$\$(ge ;a@D$0D$4D$8D$D$D$fD$$\$fD$<T$4D$D$D$$D$KD$ t uLËD$P@P$(u _Je ;ap L$9D$u|Hun writu`JetNHP u? f|1t,H@t@ 9u  D$ 11111111۸t>e ;ae vuH e rE͹XCCN:!$D$"+D$L$ d e u d e Í= d D8e ;avD$D$D$te ;avD$D$D$'yRe ;avD$D$D$D$ ye ;avD$D$D$te ;avD$D$D$D$ te ;avD$D$D$D$ tje ;avD$D$D$D$ /s*e ;avD$D$D$D$ re ;avD$D$D$D$ /e ;avD$D$D$ D$?je ;avD$D$D$D$o*e ;avD$D$D$we ;avD$D$D$D$ O~e ;av'D$D$D$D$D$re ;av'D$D$D$D$ D$$鷀2e ;av7D$D$D$ D$D$D$D$g^e ;av7D$D$D$ D$D$D$D$^e ;av/D$D$D$D$D$D$ _Je ;avD$D$D$D$ / e ;avD$D$D$D$ ?e ;avD$D$D$D$ Oe ;av/D$D$D$D$ D$D$:e ;avD$D$D$D$ e ;avD$D$D$D$ߘe ;av'D$D$D$D$D$闁re ;av'D$D$D$D$ D$$駃2e ;av'D$D$D$D$D$we ;avB$7e ;av: D$$L$L$D$L$ $D$@D$D$ oe ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$ D$ 1݉4$T$l$L$ D$\$qe ;av#Yu D$ $mD$D$č|$ 9;u؉#e ;av"YuD$ $(qD$D$Gō|$ 9;uى#e ;av* Yu'D$$qD$L$L$ D$$ 뽍|$9;uщ#e ;av#Yu D$ $XlD$D$覿č|$ 9;u؉#e ;av* Yu'D$$HlD$L$L$ D$$ O뽍|$9;uщ#e ;av* Yu'D$$HlD$L$L$ D$$ 뽍|$9;uщ#e ;av* Yu'D$$jD$L$L$ D$$ 课뽍|$9;uщ#e ;av* Yu'D$$jD$L$L$ D$$ _뽍|$9;uщ#e ;avBD$$L$L$D$FD$ L$ $D$D$D$e ;avwD$T$9u`JX9uRJX9uDH Z 9t1JRX@9t 1D$É$L$\$.D$ 1111bme ;av* Yu'D$$訚D$L$L$(D$, 뽍|$9;uщ#e ;av2Yu/D$$D$,D$蠉D$ L$L$0D$4跼뵍|$9;uɉ#e ;av:Yu7D$$D$0D$D$4D$訐D$L$ L$8D$<O뭍|$9;u#e ;av"YuD$ $蘠D$D$$ō|$ 9;uى#e ;av* Yu'D$$XtD$L$L$(D$, 读뽍|$9;uщ#e ;avJYuGD$ $D$8D$D$D$L$D$ D$(L$0D$411ƋT$ we ;av$D$$D$D$D$D$ 5e ;av#D$$D$D$D$D$ e ;av+D$$D$ D$GD$ L$L$$D$(讲e ;av'D$$D$ D$D$D$$be ;av?D$t't L$L$ D$D$ D$ËT$ e ;a\D$`H>°~.8;9zT$du(tPD$tL$x\Í辺.2B9ujD$HD$HD$l~HL$hD$DD$D@~'A$D$fT$ D$蘉D$L$mD$D֋T$HL$h봁~.8u 9JjtSD$TD$XD$TT$X$D$D$TD$D$ D$D$L$$\$l$L$ L$D$rW~.8GT$dT$d.1_B>f39T$duHD$(D$( D$l~*D$hˉ $D$D$D$ L$D$(ց.1 `39uL ZD$D$ D$l~#D$h $\$D$该D$ L$D$ݻ뭋T$d:.1T$d{? '9T$dZ*uAD$0D$0 D$l~#D$h,$\$D$0L$D$ %D$0݁>° `B9uxD$PD$PD$l~LL$hD$LD$L ~+AZ$D$fT$ D$̆L$D$D$LҋT$PL$hW뇋T$d>°T$dQw'A&9T$duDD$4D$4 D$l~&D$h$\$D$D$ L$D$4ځ' `'9uP D$<D$< D$l~)D$hɉ $L$D$藤D$ L$D$<׹묋T$d?'̋T$d|=J 39T$duED$ D$ D$l~'D$h$D$D$D$ L$D$ فw 29uM D$,D$, D$l~'D$h $D$D$虢D$ L$D$,ٹ뮋T$dAwՋT$d낁΀\09T$dZ*u ى=΀ &9uP D$8D$8 D$l~)D$hɉ $L$D$D$ L$D$8׹묋T$du΀T$dw29T$duHD$$D$$ D$l~*D$hˉ $D$D$DD$ L$ID$$ցqS `&9uL D$@D$@ D$l~&D$h $L$D$D$ L$D$@ڹ믋T$d?T$d냋T$dFAe ;a ̶$D$.Qe L$u| od <$D$'e L$uC od w$D$Qe L$u od Í=od =od 봍=od xp+e ;ahD$l$D$pD$D$tD$K/D$L$T$\$ &$T$wD$L$ T$\$D$HL$\P $ҋD$ 3 $D${D$ D$XL$L$@T$T$D$L$T$D$L$>D$H@D$D$D$ L$XL$T$@T$\$D\$l$xl$l$|l$ $l$$D$(D$,D$0l$\,$ЋD$4L$8T$@ \$Tl$D9wit$X=95l$Pt$d$D$L$UD$d$D$T$D$P$DŽ$DŽ$hÉD$`L$L3$D$XD$T$l$ \${t$l$D$`L$LT$@\$TTDŽ$DŽ$DŽ$$$hDŽ$DŽ$DŽ$$$hDŽ$DŽ$DŽ$$$h# 讦Ie ;aPD$T$D$XD$D$\D$,D$ L$T$\$$L$D$ L$T$\$gD$LL$HQ$ҋD$L$d)\$h9~9oT$HRD$D$D$ l$`l$D$\$)É!D$L$ t$$D$(D$,D$0D$L$ҋD$4L$8T$<\$@l$Dt$D$lD$pD$t\$xl$|PÉD$lL$pT$tD$xD$|PÍ$d|$Ge u2*D$lD$pD$tpD$x|$|PÍ*JD$lD$pD$tT$x\$|PD$lD$pD$tT$x\$|PK! D! me ;a'e vu# 'e X 蹞 [6 g.xNiTO8 mu'e 訣Ce ;av7 Yu4D$tH$L$D$D$ Y% R밍|$9;uĉ#e ;avJYuGD$t1H$L$D$L$D$D$ L$(D$,$ ߢ띍|$9;u#e ;avFYuCD$t-H$L$D$L$ T$T$L$ D$$z$ s롍|$9;u#e ;avNYuKD$t5H$L$D$L$T$ \$\$ T$$L$(D$,$ 뙍|$9;u#e ;av:Yu7D$t!H$L$ D$D$# 菡뭍|$9;u#e ;av6 Yu3D$tH$L$D$D$ :# 3뱍|$9;uʼn#e ;av>Yu;D$t%H$L$D$ L$L$D$" ˠ멍|$9;u#e ;av7 Yu4D$tH$L$ D$D$ i" b밍|$9;uĉ#e ;av>Yu;D$t%H$L$D$L$ D$L$" 멍|$9;u#e ;avGYuDD$t.H$L$+D$L$ T$T$L$ D$$! 肟렍|$9;u#e ;aD$ D$D$$D$D$tf D$ @(L$ $ЋD$L$D$L$ QP$ҋD$tϋD$ HPT$$ыD$uD$ D$(D$D$,11봍0$D$k) 贞?e ;aNDD$LD$D$dt$T|$PT$\\$`9t$D$l$sL$`T$<\$@뾋$|9w$$$p| u n g  萋;e ;av/e vu  e uȍz|$(c )Dž|D$(9L$8)!l$0 $)D$\$ c c c \$ L$D$D$tL$4T$ \$$l$1;L$4T$ \$$l$t$ t8؇ߕ 1'u"t<=̳c |$(9|C9L$8)щ! $L$(L$l$ гc -̳c 5ȳc t$ l$L$1D$tD$0L$4T$ l$\$$TD$0L$4T$ \$$l$t$`>*tK D$<,Åuu D$<,11  |e ;av% D$$͂D$L$L$D$ |e ;a\D$`H(L$ " $T$dT$\$h\$ D$@\D$h$ L$`Q(L$d $D$T$D$ oD$D$TL$L$($L$T$D$ eD$8@L$(9)!ȋL$Tȅ <E1҄D$(L$TT$`Z$\$"$L$D$ (D$@D$`HAH D$`HAHH $sD$L$$T$TT$\$(\$-<l$ D$D$L$8D$D$XL$ L$,T$`Z$\$"$D$L$ 臄D$@lD$,L$XD$(L$TT$`Z(\$"$l$dl$t$ht$ |$D$(G e L$TT$`Z$\$"$L$D$ ߊ|$D$hG e lL$dD$` $ eܺL$D$PD$` $L$TL$T$(T$2D$` $ L$D$$D$dD$D$hD$VD$ L$T$P$\$`\$D$L$ T$(D$` $ L$D$訅D$`H0QX,h49:QP0Tl$(*e <˅uD$TD$ll$p\ËD$Tl0$\$L$l$ T$D$LH@P<\$,9L$PtI $D$TD$2D$L$ D$0L$4D$LHWD$|DŽ$pÉL$(t$8l$$\$4D$0T$ D$t $D$ =WD$$uzD$t $L$8L$L$(L$wYD$t $ L$D$WYD$t$L$PT$TL$T$[D$t $D$"VD$0T$ L$t $T$4T$D$D$tT$\$ $\$T$XD$t $D$:rV8D$t $ L$D$XD$xHT$L$L$t $D$t $D$"VD$x.1}c0$t$T$l$ \$J D$L$T$\$tS4e uC,ʉƉ`{,'c‹D$8c߉c)\$,|$(D$4ਫ$D$KQD$x$DŽ$DŽ$t9t hD$($D$$D$\$L$ D$x?\$ T$4$l$L$ƄL$ D$xT$\$ K$D$D$D$ D$D$L$$$t0 YFe ;apLD$8D$pe ;aD$ L$$T$($L$\$YT$L$D$ ӃT$jw2uÀtƒtD$,L$0\$4Éu )ƒ׍^$|$Ge u ͻ=ͻbU0jwt볃uQD$,L$0\$4ËD$G E$|$G =e D$;ADŽ$DŽ$DŽ$DŽ$$$$QT$L1C$9Ziq9ik,|5D.uЉ\$4|$\l$|t$H<$$D$$L$$T$ kD$D$xL$L$tT$T$D\$|l$Htw $D$T$D$D$DL$L$xT$ T$t$L$D$:D$ L$OP~.859iq9\09A u-$$L$D$5H$T$L\$4D$DL$xl$t$$l$L$D$ D$\D$D$D$L$u$T$L\$4F$$ĘùV0z$ $|$t$l$ .C$T$L\$40 AD$L(T T$D$L$ $$D$L$LD$|L$HT$\ D($9~Ol$Dtgtb$,$)ȉ؉! D$)T$t$ oD$L$uD$DL$xl$t]$$ĘÉl$@}w6uƀtl$x}Ç߃u[l$xul$x}Ç߃Ӎ^$Z|$Ge u ͻͻP }dt뭉$$ĘÉЋL$xl$tlD$L(T T$D$L$ $$D$L$D$t$D$xD$D$DD$D$D$DL$L$xT$ T$tÃD$@$L$\$$D$ u$T$L\$4T$$D$A$ $ L$D$DD$@Pq D$t$D$xD$D$DD$D$ D$XL$L$0$L$̝T$D$ ~ D$L$0Q9 T$X\-uSu7$ $ L$D$C$T$L\$4P$ $D$ ^A뱍M$D$#D$D$ D$D$L$$$ĘÈD$,\$/$$T$L$PCD$,\$/(D$t$D$xD$D$DD$jD$D$D$.\$-uJ$L$\$ D$ L$@( $ЋD$L$@P $ЋD$uL$xT$t\$D+$$$D$$D$誼D$ L$t@DŽ$DŽ$$$>$D$%$D$D$ D$6D$L$$$ĘÉ$$ĘÃC7 # 5Ct$`D(L$T T$L$D$ $$ D$L$D$D`T $XD$D$pL$t $L$xL$L$DL$D$L$T$ ÃD$D kP=Pv$T$L\$4 1ɋT$p$D$D$@D$ L$D$ .D$ L$T$P$$l$T$L$ D$T$`ЋD$L$f$$ĘÃu 1l u 1]^$|$Ge u CCJ u 1 u Q1T$p$D$D$@L$ D$D$ +D$ L$T$P$$l$T$L$ D$T$`ЋD$L$B$$ĘÃu i^$|$Ge u yIu u uA $L$\$eD$ tbPL$pP$$l$L$D$ D$@T$`ЋD$L$C$$ĘË辺-쾺L$pA됍h,$L$\$D$L$ $L$D$9D$L$T$ P$$l$T$L$ D$T$`ЋD$L$$$ĘÉ$L$\$uD$L$ 9ubHX<-P,$$t$D$\$ L$T$`ЋD$L$u $$Ęù땃 ZD$P$L$\$ٶD$ L$@ $ЋD$L$p $D$D$@D$PD$ D$gD$D$D$(L$$T$ P$$l$T$L$ D$T$`ЋD$L$$$ĘÃu 6^$|$Ge u sͻsͻZFL$t $T$xT$D$ bD$L$T$ ,`D$@L$lT$h$L$D$蒵D$ L$ yd yd @@\$T$ $D$ D$h$D$lD$D$@D$5D$L$  $L$D$wD$ L$@ $ЋD$L$T$\$l$ u]P$$L$\$T$ l$T$`ӋD$L$u$T$L\$4$$ĘÉ$$ĘÍ^$O|$Ge u XbXDRL$t $T$xT$D$5D$ L$@@ yd yd \$T$ $D$ u D$D^D$t$D$xD$D$DD$ӊD$L$  $L$D$D$ L$@ $ЋD$L$T$ \$l$u] P $$\$D$l$ T$T$`ЋD$L$u$T$L\$41$$ĘÉ$$ĘÍ^$|$Ge u XX`C $$ĘÍ5C$$D$D$D$ $$D$L$$$ĘËD$@G E$|$ D$DG E$|$ӵ D$DG E$|$踵 D$DG E$|$蝵 G E$|$肵 G E$|$g 耦 y 0$D$? X *e ;av=D$ $D$D$D$ U2D$L$D$$L$(*e ;aD$ Hu HL$$}PJPP @ P!u~@!PXTP~I1+T$P XT$\$ $5D$PD$ L$$X9|΅~ HAH@ Å\$T$ $5D$ L$$됋 $D$ =3D$ L$$j@ Ã)e ;a)$D$,L$(T$01l$]l$,t$(|$0\$9}Iiq9}?9<؋9lum9u$t$|$vfD$ uD$(HIT$\$ K\$l$(9|PXh9soL$ ˋk$D$D$\$ l$PD$L$tL$8D$<$ËH |9wPD$8D$<$衤 蚣 蓣 'e ;aH|$,@L$TT$L\$P1l$$El$Tt$LL$P\$P9}]|$,Ÿ?|$,?Cl$$HL$8D$4$D$,D$%D$ L$tL$\D$`HËB,l$$r z999|$(t$ )Ɖۇ!D$L$l$ 0$\$L$D$XD$GCD$$L$LAD$ A e uD$(AD$\D$`HÍyD$(=މD$ 0 $|$D$t$ l$t$|$D$ L$TT$L\$Pl$$ʢ á %7e ;avYD$ @$ыD$L$$%T$D$D$ L$+D$L$D$$L$(p%e ;aD$ D$?HwwuD$!L$$ÃuT$ٍ^$|$Ge u  <uT$놃uT$qT$ BcD$$ËD$$D$D$L$XD$ D$$ÍH w<uD$1Ʌ!L$$Ãu T$1܋T$1у u T$1ƒ u T$J벃 u T$1룍^$|$Ge u CC:H u#D$ZWf.!L$$Ãu D$ڍ^$|$Ge u sͻ2sͻw:"u)D$$D$D$L$lD$ D$$ÃQPw0t 1D$$tD$D$uL$ ō^$1|$Ge u ͻGͻ9:Put볃%uJ D$G E$|$肬 D$G E$|$g D$G E$|$L D$G E$|$1 z!e ;av;D$$D$ D$D$$D$D$ 'D$L$D$(L$,!e ;aH$D$D$ L$,!d   d e D$0d L$D$ L$QӃ uʀӃtJ$Q|$Ge uGļpD$8|$<$ÍGļ7 $D$\$rD$L$T$ \$($T$L$D$ D$4D$yD$L$D$8L$<$111Q=d D$0K7D$0 111)e ;avD$D$ D$D$xe ;a4D$8D$,D$ e u333e ;aK\111D$(L$,T$0\$D$LtDŽ$DŽ$$$D$$D$$D$ QD$L$L$ D$$h$$D$D$LD$낋$h$$T$L$菏D$ L$@( $ЋD$L$@P $ЋD$7$$T$$X$$\$$TD$D$ L$d t d e und $<$@$<tGQӃ uʀ$h$$\$\$L\$L$ D$T$#~c111ō=d 111$$D$$D$$D$ D$L$L$ D$$|$$D$D$\D$b$$`$$d$$h$$`L$ʟD$ L$d t d e und $$$($$tGQӃ uʀ$|$$\$\$\\$L$ D$T$|111ō=d 111밉$$ÉT$@$$p4$l$T$%9D$L$T$ `tD$@$$p͉։$$$$L$D$舌D$ L$@@yd yd T$\$ $D$ t$$$D$$D$&cD$ L$$D$L$hD$ L$@$T$$\$$l$ $ЋD$L$u 111$$Í^$}|$Ge u X X $$$L$T$]D$ L$@@yd yd T$\$ $D$ u"D$L$T$<$$T$$$D$D$OD$ $$ $$T$\$8\$tD$ L$@( $ЋD$L$$L$݄D$L$ T$DŽ$lDŽ$pDŽ$t$l$p$t$$$L$T$8T$$l\$ D$D$NzD$ L$T$$$$l$t$8t$T$ L$D$4c$$$L$T$8T$$\$ FD$L$T$$$T$D$L$ $D$D$L$t^$$$$$D$D$8D$$D$ g$$$$DŽ$DŽ$É$L$D$D$L$T$ `tD$8$$6$$$$L$D$WrD$ L$@@yd yd \$T$ $D$ t$$$D$$D$HD$L$ $L$D$7D$L$ $$L$D$D$L$ $$Í^$m|$Ge u XX$L$D$[qD$ L$@@yd yd \$T$ $D$ uD$8$$$$$D$D$8D$GD$L$ $L$D$"D$L$ $$L$D$D$L$ $$É$L$D$D$L$T$  `tD$8`$$$$$$L$D$*pD$ L$@@ yd $yd T$\$ $D$ u D$8`됋$$$D$$D$FD$ L$ನ$D$L$D$ L$$$D$L$$D$ D$L$$$Í^$*|$Ge u XXz$L$D$oD$ L$@@ yd $yd T$\$ $D$ uD$8$$m$$$D$D$8D$ED$ L$ನ$D$L$D$ L$$$D$L$$D$ D$L$$$Í^$|$Ge u XXzÃH$$$t$L$D$mD$ L$@( $ЋD$L$ $D$~D$L$ T$$t$$l$$t$T$ L$D$\$$$tI$^$|$Ge u ͻͻwÀt,$ $$҉$^$腥|$Ge u ͻ9ͻ)$ $$€t'$Ã/Ӌ$q$׋$)Ã̉Ӌ$$>$$(;D$ L$T$\$$T$l 5$藤D$$$1L$l 59$$$$ e u+$$L$l9F$ 5$$D$$L$}D$l 59и뷍$gp$$G E$|$kn G E$|$Pn G E$|$5n G E$|$n $G E$|$m $G E$|$m _ _ _ _ ^ ^ ^ qe ;a HD$Ty P/ D$L$T$PT$L$e5D$L$T$ D$ T$4L$8ÃOuD$dD$hHÃND$\$L$XL$D$D$`D$ D$L$ $D$ D$ D$(L$L$@ uF0u;111҅u%L$4 $L$8L$L$ L$D$ 7YKL$dT$hHÃu1u 11볃uFt .$S|$G e uq L$(O e uBL$@OLd Hd O e uG1 P 8OOω‹D$@q믍 bt9uT7uf5t$ $D$$T$D$ 7D$D$(L$@D$(L$@}?uTRUEuTruetruetkuFALSuWQEuFalsu6QeTfalsFQe4Ճ봉 $D$PT$D$ =D$D$(L$@D$(L$@R $D$OT$D$ D$D$(L$@AD$(L$@$L$\$D$ VD$dD$hHÃD$\$L$XL$D$D$`D$ DD$L$ $D$D$ D$0L$L$DT$4$\$8\$l$ l$eD$ L$@ $ЋD$L$D $L$0L$D$ D$ @uD$L$T$\$u)T$4$T$8T$T$ T$D$ L$Y\$dT$hHÉ$L$\$D$ D$XD$dD$hHËD$L$D$PD$D$TD$dD$ L$ $ЋD$L$$T$D$D$ L$vD$D$$L$L$<$8|$D$$Ge uD$<pD$d|$hHËD$<3hD$\$L$XL$D$D$`D$ _D$L$$L$D$D$DL$ L$0T$4$\$8\$l$ l$cD$ L$@ $ЋD$L$D $L$0L$D$ D$ +kD$L$T$\$u)D$4$D$8D$D$ D$L$ T$[\$dD$hHÉ$L$\$D$ D$ZD$dD$hHÃD$\$L$XL$D$D$`D$ 6D$L$ $D$D$ D$0L$L$DT$4$\$8\$l$ l$bD$ L$@ $ЋD$L$D $L$0L$D$eD$L$u!D$4$D$8D$D$ D$RUL$dD$hHÉ$L$\$WD$ (UD$dD$hHÃuUD$\t)l$Xt$`$L$\$l$ D$t$RG$耚l$L$8T$4\$ 11뻃$D$XD$D$\D$D$`D$ D$L$L$ D$D$4$D$8D$D$ D$ZD$Pƒ]T$L$D$L$aD$ L$@( $ЋD$L$ $D$"rD$L$ T$\$L$l$Pl$t$Tt$T$ L$D$>PL$TD$PpD$,^$X|$Ge u ͻͻȋT$LL$PD$,G E$|$c (e ;aitD$|HL$@$$$1F|$|$$9xX9k,D$HDtD$9|t$8\$<|$PDLt-]}9tL$@됉 $\$D$SD$ n$L$PT$<$1,t$4n$|$PD$<$T$<$9}bW4>v\$L 9? Y 9ul$4<$L$t$D$ uL$@$$t$8l$9lt $_\$L_ 9\ l$9~Ëkw O9tL$@‰t$8k$L$l$.D$ u$$ƋD$T ?$|JЉ$D1$| $>5L$ T$\$l$t$$D$H$L$P$|$!$|$#D$L$y=$| u J$P$L$T$XD$PP\$T9t$΋ e @|u$D蠩3$T$\\$X$|$$DD$苦$|T$\\$X$  $$l$D$\$ T$K`l$D$\$PD$P$|O@$KD$@# e uy  $|Pe u=DŽ$DŽ$$$xË$袢뻉Ǎ 蓢{$|$}$|$D$t.$ZD$L$$T$X$|5$|DŽ$DŽ$$$xË$|DŽ$DŽ$$$xË$|t7DŽ$DŽ$$$xÍ@$ID$@" e uI $|Pe u k$ Ǎ뮋$|1$|ƁT$`\$d-e $$$\1股$\$`$d$h$$lL$P$pL$T$t 5 $$\L$L$ T$$$DŽ$DŽ$xÍ$$ן͉7T$`\$d$$$|$D$L$>u @$GD$@ e uy $|Pe u=DŽ$DŽ$$$xË$뻉Ǎڞ{$|DŽ$DŽ$$$xË$|DŽ$DŽ$$$xË$|t7DŽ$DŽ$$$xÍ@$aFD$@ e uI P$|Pe u k$襝ǍP薝뮉 $.D$ L$T$L$,T$h$|$^$|H0$@4@<ƀ1 $|ʈT$($D$L$/D$+$$D$(?L$+>u$|Q=D$@L$t $D$ƺT$D$ GD$tD$dT$x\$,l$Ht$h$|HH P$`$L$T$7 $|PL$ \$l$t,$t$@t$L$\$ ыD$L$T$\$@T$pD$t$D$@$C$DŽ$DŽ$DŽ$DŽ$ 0 $$L$3D$L$ $$$$D$p$p$D$$D$D$ D$CD$L$$| e u=DŽ$DŽ$$$xË$[뻉&$|$D$L$D$t$D$@$DŽ$DŽ$0$$D$D$ L$$$0$D$:$D$D$ D$"D$L$$|e u=DŽ$DŽ$$$xË$8빋UTF-Q8utf-tQ8t$hgL$+$|DŽ$DŽ$$$xË$|t7DŽ$DŽ$$$xÍ@$>D$@ e uI m$|Pe u k$Ǎmݕ뮉 $1&D$L$T$ \$l$$|t7DŽ$DŽ$$$xÍ@$=D$@ e uI Ƨ$|Pe u k$ǍƧ뮉L$d$\$`$$|$$|$D$L$>$_D$D$$D$ D$dD$ǺD$D$=D$ D$0L$L$l@$L$<$|$(D$L$L$<  8tD$*$1<1$|DŽ$DŽ$$$xË$|Q4+Q<A4A<Ɓ11$|T$&È\$&T$) $ D$L$t|L$)-uhL$&-u>uD$$L$DL$DD$$$|$g D$L$L$$k>YT$DL$&X$|DŽ$DŽ$$$xƁZsi8q$|H8P4X0@<9)ƒ)!؅k$$$h$$D$ D$ L$$$DŽ$DŽ$xÍ@$3D$@- e uy $|Pe u=DŽ$DŽ$$$xË$袊뻉Ǎ蓊{D$%D$|DŽ$DŽ$$$xÍ@$2D$@% e uy 8$|Pe u=DŽ$DŽ$$$xË$誉뻉Ǎ8蛉{$|DŽ$DŽ$$$xË$|DŽ$DŽ$$$xË$|DŽ$DŽ$$$xÀ $|J $D$D$D$L$ T$ta$$$@h$$D$ D$ L$$$DŽ$DŽ$xË$|DŽ$DŽ$$$xË$| $|DŽ$DŽ$$$xƀDŽ$DŽ$DŽ$DŽ$ $$$$ $$D$XD$ L$$$DŽ$DŽ$xDŽ$DŽ$$$xËB $ЋD$L$ T$\$$$$$x  0$D$y    } v $ нD$D$0D$tD$ D$@D$vtD$L$$$0$$D$D$ L$ $D$   ne ;acD$ $kD$L$"'L$ < u JA0D$A4A<ƁD$$ëL$ $D$L$Hv΍HvƍHЀ v_t:t-t ukL$ JA4Q0Y{ <e $w $|8> &utvD$# t; u f$$٥D$#L$!$$9$$D$ 觥D$#L$!$$$H4+H5c |c -xc D$L c -c 5c D$L9w?\$8[)!щL$)D$t$ D$<$ӋD$L$D$PL$T4` Y R {Le ;a4D$@L$<11l$@t$<ډÉ9\T$ \$)Љ!ȉ$l$*D$L$ T$  " [ ;  t=ut D$epc lc -hc t$9\$,D$(L$$l$0D$8 $)!֋T$<2\$L$WD$8 $L$0L$L$$L$L$(L$ JS\$, u G u 8hw # w  Çc c -c c c -c t "c c -c `c \c -Xc '<&t 'hPc Lc -Hc @c ,c |c -xc Pc c -c 99w(T$8$)؉!ÍD$T$V4t m f Ie ;a0 D$0D$$Hc c -c l$T$\$ T$($ыD$L$D$,L$4T$0)\$4)É!؋\$,؉ʉD$,L$4T$0$T$L$ܳc -سc 5c l$ \$t$課D$= ܳc T$09L$49MD$T$$Zl$,l$D$L$ t$(4$ӋD$L$ucD$$Hc c -c l$T$\$ T$($ыD$L$uܳc L$ȋL$09D$8L$< ÉD$8L$< ËD$$H\$,\$T$T$4T$ T$($ыD$L$t D$8L$< ËD$$@ سc ܳc c L$T$\$ L$( $ЋD$L$L$8D$< ËT$0yL$8D$< D$8D$<   5Ge ;aaDD$ $D$HD$D$LD$D$ D$LD$D$LL$T$P$\$T\$L$D$ a\D$L$LȋL$T9)!D$P't"uwT$\$@D$B؉$L$2D$ t0H|yrtT$9wlT$@ЉD$XL$\DD$XD$\DD$XD$\DD$XD$\DD$XD$\D  Ee ;aHe vHu e 2bus^ mDa_uPd  $D$BD$L$ @( $ЋD$L$ xd e xd  $D$  $D$T$D$ SD$<$L$L$\T$D$ RD$>$L$L$/T$D$ RD$&$L$L$dT$D$ }RD$'$D$D$ xL$D$ KRD$"e D$8od "$D$D$ D$ D$1 PD$с}cL$ʋ+[l$\$ "$D$Q|$D$ \_e u뙉ÉOX댋 e ue ;avD$D$D>e ;avD$D$D$D>e ;av'D$D$D$D$D$gFB>e ;avD$D$D$ D$H >e ;av'D$D$D$ D$D$H=e ;av'D$D$D$D$D$I=e ;av: D$$L$L$G~D$L$ $D$0~D$D$ /=e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$zD$ 1݉4$T$l$zL$ D$\$D$D$P6ō|$ 9;uى#e ;av"YuD$ $8>D$D$P76ō|$ 9;uى#e ;av* Yu'D$$(D$ L$L$\D$`4봍|$9;uȉ#e ;av:Yu7D$$D$\D$>D$L$ T$T$`L$dD$h3뭍|$9;u#e ;avBYu?D$$D$`D$D$dD$?D$ L$T$D$hL$lT$p73륍|$9;u#e ;avNYu;D$t%H$L$D$L$ D$L$肱 {/멍|$9;u#e ;av:1L$ D$ T$‰$L$pL$D$ @=|ىL$/e ;avnD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$lD$ uD$ D$ {.ve ;avbD$ HD$L$`$D$ L$$L$h5D$L$ T$\$l$D$$L$(T$,\$0l$4-e ;avO D$$$_D$D$L$L$$35D$L$L$(D$,D$D$0D$D$4 -e ;avD$HD$L$ W-e ;avD`$ D$ H$T$@ e u JT$Íz|D,e ;avt D$vbD$HS9u7 $T$D$ D$$D$(D$,D$0 É$\$'D$ < e,pe ;avD$HAH$X/,e ;av"D$ H(@,I,$D$D$+e ;a4D$,D$0D$8L$8ȋHPX 9*H ʋQ h[L$T$,$ӋD$L$ T$\$l$T$8ZCZD$$L$(l$ 5t$,\$0\$,=J@|$\$ $ЋD$L$ T$ $T$D$D$ T$ 9uaD$8$L$(L$L$ L$L$$L$ ыD$8$D$411tt.C'HP4É$L$'D$艿 $T$  =*Xe ;aD$ H$I $ L$D$ 豚D$ L$t D$$L$(ËD$ H$I $ vL$D$uD$ L$uċD$ @$H\L$@`D$ $D$T$D$ 6D$~L$9wD$uD$ H)e ;a4D$T*D$PH P9qAD$, L$0á$|$D$,Ge uiD$0D$8H4@8IT$PR\$T$T$uTRUEbuTrueOZ=true9HtjuFALSuVQEuFalsu5Qe=falsAeփ뵉 $D$PT$D$ ]D$D$L$ D$L$S $D$OT$D$ ]D$D$L$,D$L$ e ;av?D$$D$D$D$ D$D$ L$$L$+mD$D$$J e ;avGD$$D$D$D$ D$/D$ L$$L$ mD$ L$L$$D$(e ;avKD$ $D$$D$D$(D$D$ L$$L$D$@3D$ D$,~e ;a뜉D$D$D$ D$$ d d T$L$L$HL$ D$$D$$D$D$D$L$ gD$H$ L$D$BL$ D$L3D$(D$,D$0D$4 d d T$(L$,L$@L$0D$4D$($D$D$L$ D$oD$@$ L$D$BL$ D$D7e ;av^ e ;a D$L$Y)5S9uhv{AI -@9u;L$$T$D$ D$$D$(D$,D$0 É$l$'D$R ,$t$'D$: ~ 7e ;aD$ D$H@Q$T$L$ D$ L$T$ vk\$k[ 5 9u?\$$L$T$D$(D$,D$0D$4D$8É,$t$'D$b } $/e ;aD$(D$$H@Q$T$L$,D$ L$T$(v{D$L$D$$H@ $L$D$D$ L$T$$T$T$D$L$ T$ D$0D$4D$8D$<D$@ } 4e ;a D$$D$L$(L$T$=CP$ЋD$+ $D$$D$L$(L$ҠD$tD$$D$,D$(D$0 ËD$$tHwXAQwjuZ A9uIT$(t1wXAQu `9uL$(uD$,L$0 ùD$,T$0 ú봁wXAQ봁iAu9uQT$(t9OK `A9uL$(7 D$,L$0 ùިD$,T$0 ú110$@D$= ae ;aE4D$H(D$DD$( H $L${DD$(28x,ËD$0x ‰ z$D$LЋT$LxÉx‰[xD$4"xD$H_1_ ߉‹D$H׉DD$ rD$8due ;aK(L$,Y(&\$8ku m؋Y0ʋI,91Ʉ9)މۇ!hM e u~]J L$Z\$$1t$nD$8L$T$,\$$9}+l$L$0 $t$4t$D$:D$ t(ËJ4 $L$0L$L$4L$D$ k%(Í}KrV\$t$l$ ,$L$\$4L$ D$8T$,\$l$ t$D$8$As je ;a쪺$D$іD$L$ ub B޺D$L$̫$D$蜖D$L$ $L$BD$uL$L$L$L$ D$$ɉȉQe ;auh2D$L$$\$tL$$\$pks\T=09}M:L$$|$,`&$D$ҌD$ L$ $D$D$D$ D$B$D$,D$D$$D$D$ D$(D$ D$(L$L$0T$lZ8-@l$8\$<\$85J@t$\$ $ЋD$L$T$ $L$D$`RD$L$ @9 D$4D$0D$PL$(L$T$L$D$HL$LD$XD$\D$`D$d0$L$PL$|D$ L$L$XD$\0$D$HD$VD$ L$L$`D$dD$4$ L$D$L$XL$ D$D$PD$0$D$(D$D$D$lD$ oD$L$t@D$@D$DD$@L$DD$4$D$@D$D$D$ h11qqSu. `&9u]u L$$׉L$$ߍ `&s `&σ|W\$pk3=09u8umu*KS `&9u u ȉ2Չн`&=0ՉΉĉ $T$'D$W ke ;av3L$ T$J0e uD$B,B(Íz,D$M e ;av| e $7e D$$WD$ qu=L$~ 4c e uD$0c x Í=0c D$x -he ;avm D$D$e $m6e D$$WD$]pu0c 4c D$L$w Ðw we ;a$^,$D$ D$L$ $L$$L$T$\$ d e ud u$Í=d B$ЋD$L$$T$D$D$ L$D$L$D$L$ 0$D$D$BD$L$ $L$Nz e ;av0$D$z \e ;av0$D$y e ;av0$D$y e ;av0$ȵD$Sy e ;av0$еD$y \e ;av0$صD$x e ;av0$D$x e ;av0$D$Sx e ;av0$D$x \e ;av0$D$w e ;av0$D$w e ;av0$D$Sw e ;av0$D$w \e ;av0$D$v e ;av0$ D$v e ;av0$(D$Sv e ;av8D$ $D$ HP I\$\$$ыD$L$ AAe ;aD$ HtePtIHP I\$$\$\$(\$\$,\$ $ыD$L$T$\$ KL$0T$4D$8Ë HEADu111މ$D$D$ We ;av D$@D$]e ;av D$@D$-e ;avD$@D$e ;a L$$QYi s9)ki< e u D$( ËD$($T$\$l$ t$D$L$T$\$$S e u C‰͉ى돍{CNe ;aD$ H @$D$L$跇D$L$ T$t4A$ЋD$ L$T$\$l$l$$L$(D$,T$0\$4Í)$D$9D$D$ D$PD$L$D$$D$(D$,D$0L$4Se ;av?D$H @ $D$L$D$ L$@ $ЋD$D$e ;avK D$HI#L$$D$*ՋD$HD$| Xh9r Uc ~e ;avBD$H @$D$L$D$L$ T$uËA$e ;aD$,D$$9D$D$$ WL$SfueD$@D$` $D$D$D$ D$ vD$D$` $D$$D$D$(D$ ND$D$,mÐmK6e ;aD$$:D$D$$ WL$eu|D$@D$` $D$D$D$ D$ D$D$` $D$$D$D$(D$ f|$e uD$,lËD$,ll'e ;av D$L$A L> E> >> 7= `e ;aLD0$D$D$ D$ L$T$\$Hl$Ll$LT$$D$4L$ T$$D$@$l$D$L$ T$\$\$Ll$ u׋T$$9BD$,D$@D$4D$,T$$T$4\ e uyiD$8L$(|$<0$L$@L$l$T$ t$讔D$L$T$qL$(\$Ll$ |$V\l$(\$8:t$4tk|$ T$$D$D$gD$L$T$8 e u L$4IT$(Zl$P9H|$4O f*.uO*u뵀*_\$XT$\D4 `&$l$~PD$L$ $L$D$D$ D$D$L$$ȂT$D$L$ D$tD$L$D$L$ D$$\$ d1[D$4L$8 D$4$ L$D$L$ D$8   Йe ;av;D$$D$ D$D$L$ T$\$D$$L$(T$,\$0ne ;avU$D$#D$D$ D$D$L$D$ D$$D$(L$,e ;av!D$D$D$ D$踘e ;aLT$HBD$0 $L$PL$L$TL$L$XL$ D$D$4 e {L$\H0D$0T$HZ Y H $D$\$kD$L$T$ \$4K C-e {S|$Dl$0mu<|$,]m9 99D$(T$@)ȉD$$!ЉD$t$D$$D$ H$l$t$\$8D$,L$4A T$(Qe  \$@Y\$Hk s<(|$$[I9d9\9TT$,L$H)‰T$(!D$l$D$(D$ H$\$l$t$蕳D$$L$4A D$,Ae uD$HA $jLË|$DD$H\$ɦT[ڪ襺Rv豭LGS.t 蚱K@5% \$D$ v $D$lǺT$D$ D$ ce nlQP v$D$D$ L$D$ 覡D$ c e  pQHD$td t[$D$  $D$T$D$ ID$ $L$L$ЫT$D$ D$ $L$L$3T$D$ D$ $L$L$kʺT$D$ 輠D$ $L$L$LT$D$ 荠D$ $L$L$T$D$ ^D$ $D$D$ 䪺L$D$ /D$e uD$td Ze $uT ȡd K$D$ fe L$u td xSe Í=td p܍=ȡd a룍=td D$PwxpQ==td D$.xlQ葎\e ;av'Yu$D$ @I$ыD$D$B|$ 9;uԉ#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8ʍ똍|$ 9;u#e ;av'Yu$D$ @IT$T$$уr|$ 9;uԉ#e ;avD$@4D$D$V1e ;av?Yue ;av/ Yu,D$I(@T$T$T$T$$у 蚆븍|$9;ủ#e ;av D$@4D$D$D$ ζIe ;av(Yu%D$ H@ I$ыD$D$뿍|$ 9;uӉ#e ;avBB$D$ D$D$$D$D$(D$ D$,D$D$0D$hD$D$4e ;avBB$D$ D$D$$D$D$(D$ D$,D$D$0D$ȬD$D$4规e ;avBB$D$ D$D$$D$D$(D$ D$,D$D$0D$جD$D$4Ge ;avBB$D$ D$D$$D$D$(D$ D$,D$D$0D$D$D$4e ;avBB$D$ D$D$$D$D$(D$ D$,D$D$0D$D$D$4臃e ;avBB$D$ D$D$$D$D$(D$ D$,D$D$0D$D$D$4'e ;avBB$D$ D$D$$D$D$(D$ D$,D$D$0D$D$D$4ǂe ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$ D$D$p띍|$ 9;u#e ;av>Yu;D$@L$T$TT$T$XT$ $ЋD$L$ L$\D$`苂멍|$9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$萭D$D$p띍|$ 9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$耪D$D$p蟁띍|$ 9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$D$D$p/띍|$ 9;u#e ;avFYuCD$@L$ T$XT$T$\T$ $ЋD$L$T$ T$`D$dL$hÀ롍|$9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$D$pD$O띍|$ 9;u#e ;av]$YuZD$\$D$dD$D$hD$D$lD$ D$pD$D$tD$D$xD$D$|D$谠D$ $$늍|$(9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$D$D$pO띍|$ 9;u#e ;av2Yu/D$H$D$PD$D$TD$D$XD$ p~뵍|$9;uɉ#e ;avV YuSD$$@L$(T$`T$T$dT$ $ЋD$L$T$\$l$ l$hD$lL$pT$t\$x s~둍|$$9;u#e ;av>Yu;D$@L$T$TT$T$XT$ $ЋD$L$ L$\D$` ~멍|$9;u#e ;avNYuKD$ @ L$$T$\T$T$`T$T$dT$ T$hT$ $ЋD$L$L$lD$p}뙍|$ 9;u#e ;av2Yu/D$H$D$PD$D$TD$D$XD$ 蠩'}뵍|$9;uɉ#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$D$D$p|띍|$ 9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$УD$D$p?|띍|$ 9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$УD$D$p{띍|$ 9;u#e ;avJYuGD$T$D$\D$D$`D$D$dD$ D$hD$D$lD$УD$D$p_{띍|$ 9;u#e ;av]$YuZD$\$D$dD$D$hD$D$lD$ D$pD$D$tD$D$xD$D$|D$耥D$ $$z늍|$(9;u#e ;avV YuSD$$@$L$(T$`T$T$dT$T$hT$ T$lT$T$pT$ $ЋD$L$L$tD$x Sz둍|$$9;u#e ;av#Yu D$@$D$HD$诔zč|$ 9;u؉#e ;av"YuD$@$D$HD$yō|$ 9;uى#e ;av. Yu+D$@(L$T$LT$T$PT$ $Ѓ [y빍|$9;u͉#e ;avR YuOD$X$D$`D$D$dD$D$hD$ D$lD$D$pD$pD$L$D$tL$x x땍|$$9;u#e ;avD$D$xe ;av4D$D$D$D$ D$D$D$j#Exe ;avD$D$D$D$ O xe ;av'D$D$D$D$D$we ;av'D$D$D$D$ D$we ;av7D$D$D$D$D$D$D$ GA2we ;avD$D$D$D$?ve ;av'D$D$D$D$ D$wve ;avD$D$D$D$ 7zve ;avD$D$D$D$/::ve ;avD$D$D$D$_?ue ;avD$D$D$ue ;avD$D$D$D$ ue ;avD$D$"Zue ;avD$D$D$D$ ?ue ;avD$D$D$wte ;avD$D$D$D$te ;avD$D$D$D$jte ;av"YuD$ $D$D$'tō|$ 9;uى#e ;avCYu@D$$D$L$T$\$ l$L$ D$$\$(l$,T$0s뤍|$9;u#e ;av* Yu'D$$D$L$L$D$ _s뽍|$9;uщ#e ;avBYu?D$$D$ D$D$$D$D$ L$T$D$(L$,T$0r륍|$9;u#e ;av2Yu/D$$8D$L$T$ L$D$T$ r뵍|$9;uɉ#e ;avR YuOD$$$D$(D$D$,D$XYu;D$@L$T$`T$T$dT$ $ЋD$L$ L$hD$l;l멍|$9;u#e ;avD$@ D$D$fke ;avJYuGD$@$D$hD$D$lD$D$pD$ D$tD$D$xD$D$D$|k띍|$ 9;u#e ;avD$@ D$D$Ake ;avJYuGD$@$D$hD$D$lD$D$pD$ D$tD$D$xD$谓D$D$|j띍|$ 9;u#e ;av@Yu=D$H4I@8T$T$T$ T$T$$T$ T$(T$$уij맍|$9;u#e ;av>Yu;D$L@L$PT$`T$T$dT$T$hT$ T$lT$ $Ѓi멍|$9;u#e ;avD$@ D$D$vie ;avJYuGD$@$D$hD$D$lD$D$pD$ D$tD$D$xD$D$D$|?i띍|$ 9;u#e ;avGYuDD$I@T$ T$T$$T$$ыD$L$ T$L$(D$,T$0h렍|$9;u#e ;avFYuCD$@L$ T$dT$T$hT$ $ЋD$L$T$ T$lD$pL$tch롍|$9;u#e ;avD$@ D$΍)he ;avJYuGD$@$D$hD$D$lD$D$pD$ D$tD$D$xD$D$|D$hg띍|$ 9;u#e ;a4YD$8H4I@8T$Yu;D$@L$T$`T$T$dT$ $ЋD$L$ L$hD$l[Y멍|$9;u#e ;avOYuLD$ I @T$$T$T$(T$T$,T$ T$0T$$ыD$L$D$4L$8X똍|$ 9;u#e ;avNYuKD$ @ L$$T$hT$T$lT$T$pT$ T$tT$ $ЋD$L$L$xD$|[X뙍|$ 9;u#e ;avD$@ D$鎄Xe ;av2Yu/D$4$D$\D$D$`D$D$dD$ @W뵍|$9;uɉ#e ;avD$@ D$D$ƀWe ;avJYuGD$@$D$hD$D$lD$D$pD$ D$tD$D$xD$`D$D$|W띍|$ 9;u#e ;avD$@ D$D$V~Ve ;avJYuGD$@$D$hD$D$lD$D$pD$ D$tD$D$xD$}D$D$|_V띍|$ 9;u#e ;av@Yu=D$H4I<@8T$T$T$ T$T$$T$ T$(T$$уU맍|$9;u#e ;av>Yu;D$L@Yu;D$L@@L$PT$`T$T$dT$T$hT$ T$lT$ $ЃKS멍|$9;u#e ;avD$@ D$D$$}Se ;avf$YucD$H$D$pD$D$tD$D$xD$ D$|D$$D$$D$$D$}D$ $$sR끍|$(9;u#e ;avD$@ D$΀9Re ;av2Yu/D$4$D$\D$D$`D$D$dD$ 耀Q뵍|$9;uɉ#e ;avW YuTD$$@I$T$(T$T$,T$T$0T$ T$4T$T$8T$$ыD$L$D$kPe ;av#Yu D$,$D$TD$jVPč|$ 9;u؉#e ;avD$@ D$n~Pe ;av"YuD$,$D$TD$0~Oō|$ 9;uى#e ;av/ Yu,D$I(@T$T$T$T$$у zO븍|$9;ủ#e ;av. Yu+D$@(L$T$XT$T$\T$ $Ѓ O빍|$9;u͉#e ;av0 Yu-D$H4ID@8T$T$T$T$$у N뷍|$9;uˉ#e ;av. Yu+D$D@DL$HT$XT$T$\T$ $Ѓ [N빍|$9;u͉#e ;av@Yu=D$H4IH@8T$T$T$ T$T$$T$ T$(T$$уM맍|$9;u#e ;av>Yu;D$L@HL$PT$`T$T$dT$T$hT$ T$lT$ $Ѓ{M멍|$9;u#e ;av(Yu%D$ H4@8ILT$T$$у!M뿍|$ 9;uӉ#e ;av&Yu#D$@@LL$DT$TT$ $ЃL|$ 9;uՉ#e ;avX YuUD$$H$P`$$L$T$D$ 7FD$ `e B>$P`$$L$ۺT$D$ ED$ `e =$P$d @$|$G e = $G  e F=G^$$ ` $D$įT$D$ 0ED$ `e <$P$d @$|$Ge |< "$G  e C<G@$|$Ge < $G  e ;G@$i|$Ge ; 8$G  e Q;G@$|$Ge ; $G  e :G@$|$Ge : $G  e _:G@$m|$Ge : $G  e 9G@$|$Ge 9 $G  e m9PG$$ ` $D$T$D$ BD$ `e 9$P`$$L$jT$D$ 1BD$ `e 8$P`$$L$eкT$D$ AD$ `e =8$P`$$L$кT$D$ AD$ `e 7$P`$$L$*6T$D$ DAD$ `e w7$P`$$L$\T$D$ @D$ `e 7$P`$$L$ۺT$D$ @D$ `e 6$P$d @$|$G e Q6 $G  e 6G@$3|$Ge 5 U$G  e 5G@$|$Ge _5 $G  e &5Gt$D$| ` $D$\T$D$ I?D$ `e 4$P`$L$|L$eкT$D$ >D$ `e _4$P`$L$|L$кT$D$ >D$ `e 3$PD$|d @$|$Ge 3 [$G  e l3G@$A|$Ge ,3 3$G  e 2G@$|$Ge 2 $G  e z2G@$|$Ge :2 (9$G  e 2G@$E|$Ge 1 9$G  e 1G@$|$Ge H1 "_$G  e 1G@$|$Ge 0 hһ$G  e 0G@$I|$Ge V0 |$xG  e  0PG@$|$Ge / !|$tG  e /PG`$D$ D$D$ D$p ` $D$T$D$ K;D$ `e )/$P`$L$pL$\T$D$ :D$ `e .$P`$L$pL$T$D$ :D$ `e i.$P`$L$pL$7T$D$ g:D$ `e  .$P`$L$pL$6T$D$ :D$ `e -$P`$L$pL$;YT$D$ 9D$ `e I-$P`$L$pL$кT$D$ 9D$ `e ,$P`$L$pL$eкT$D$ 79D$ `e ,T$xP`$L$pL$T$D$ 8D$ `e #,T$tPD$pd @$|$Ge + O$G  e +G@$|$Ge b+ 8$G  e )+G@$-|$Ge * ^$G  e *G@$|$Ge p* _$G  e 7*G@$|$G e ) N̼$G  e )G@$1|$G#e ~) $G  e E)G@$|$G e ) .̼$G  e (G@$|$Ge ( ||$xG  e V(PG@$8|$Ge ( |$tG  e 'PG`$D$ D$7D$ D$l ` $D$T$D$ 5D$ `e _'$P`$L$lL$jT$D$ ?5D$ `e &$P`$L$lL$eкT$D$ 4D$ `e &$P`$L$lL$кT$D$ 4D$ `e ?&$P`$L$lL$T$D$ [4D$ `e %$P`$L$lL$OκT$D$ 4D$ `e %$P`$L$lL$]T$D$ 3D$ `e %$P`$L$lL$cغT$D$ w3D$ `e $T$xP`$L$lL$ۺT$D$ .3D$ `e Y$T$tPD$ld @$|$G e $ 9$G  e #G@$|$Ge # A9$G  e _#G@$m|$Ge # $$G  e "G@$|$Ge " $G  e m"G@$|$Ge -" q$G  e !PG@$q|$G e ! ̼$G  e {!PG@$|$Ge ;! q$G  e !PG@$|$G e  n̼|$xG  e  PG@$x|$Ge L |$tG  e  PG`$D$ D$wD$ D$h ` $D$T$D$ /D$ `e $P`$L$hL$eкT$D$ /D$ `e 5$P`$L$hL$\T$D$ 3/D$ `e $P`$L$hL$кT$D$ .D$ `e u$P`$L$hL$7T$D$ .D$ `e $P`$L$hL$(T$D$ O.D$ `e $P`$L$hL$1T$D$ .D$ `e U$P`$L$hL$/yT$D$ -D$ `e T$xP`$L$hL$T$D$ n-D$ `e T$tPD$hd @$U|$G e G $G  e G@$|$Ge  [$G  e G@$|$Ge U u$G  e G@$Y|$Ge  $G  e G@$|$Ge c $G  e *G@$|$Ge  b$G  e PGF$D$d ` $D$T$D$ +D$ `e J$P`$L$dL$eкT$D$ *D$ `e $P`$L$dL$\T$D$ *D$ `e $P`$L$dL$&T$D$ 7*D$ `e *$P`$L$dL$кT$D$ )D$ `e $P`$L$dL$T$D$ )D$ `e [$PD$dd @$|$G e   $G e G@$/|$G e  $G  e XPG@$|$Ge  Tһ$G  e G@$|$Ge  ,һ$G  e fG@$3|$Ge & 8$G  e G@$|$Ge  Ծ$G  e tG@$|$Ge 4 $G  e G@$7|$Ge  D|$xG  e G@$|$Ge E |$tG  e G@$|$Ge  |$`G  e G@$D|$Ge Y 3|$\G  e #PG@$|$Ge  [|$XG  e G@$|$Ge m |$TG  e 7G@$Q|$G!e  |$PG  e G@$|$Ge  |$LG  e KG@$|$Ge   5'|$HG  e G@$^|$Ge  q[|$DG  e _G@$ |$Ge  n|$@G  e PG@$|$Ge  |$ e L$xHT$hPT$tP \$XCP\$$SD$nD$lD$D$tD$ $DUD$D$X$D$`D$D$L$ T$$$S e ,T$\S$D$xH P@9))ʉ!T$"u8$$$DŽ$DŽ$uĘÉD$(l$4L$pD$8$D$D$D$p$L$(L$T$4T$WD$|"L$49͋L$pXL$4D$(DŽ$DŽ$DŽ$$$tĘË$‹D$\tĘÍxD$xyD$hy D$t\$X{PD$|ZtĘÐMtĘËD$dmD$d_y$Ky $<y$-=$z|$|$`e $ $Je |$uvL$`y$re u:* L$`yGe u  $|$t$_$묋L$`QVz$|$$D$"5D$#D$0T$$\$\l$,GcD$4 I $^D$ # _ T$4ыe HL$0HL$,H DŽ$DŽ$ P$$X$$D$D$ L$$J e uB$ыT$$\$\t$#u$Eލx‰7[1)$$\$hD$L$ T$\$l$t$$G e uNw$u 1DŽ$DŽ$DŽ$$$uqĘË$$f f e ;a$D$(HtBH@IT$,T$T$0T$T$4T$ $ыD$L$T$D$8L$xc Qe uAAIL$@D$Dc0Íyސc0Ë|$$뚐c0Ë@L$ $ЋD$L$L$@D$DD$4$!D$4D$$ WL$[u8D$DL$@T$4J e uBD$<Oc0Ízs;c0É1^(D$$WD$M[u&d d D$<L$@D$Db0Ðb0ÉD$$ WL$Zu$D$4H@D$<D$@L$Db0Ðb0Ðb0ËD$4$#|c D$< L$@D$DUb0e ;avgD$$L$L$GD$ L$tD$ L$$D$(ËD$$D$D$D$L$ T$D$ L$$T$(re ;a0BJ L$RD$ D$$D$(D$,\$ T$$T$(D$,D$ $D$D$HD$D$L$ L$ Z$贙D$L$ e uUL$H 0 H e u)L$H L$DD$HD$LD$P0Íx D$̍xD$e ;a` $D$D$( 3 $D$D$D$L$L$ T$ |$41KT$4D$ D$8\$<D$@D$dD$DD$XD$\e |$(t$4D$($-D$L$tu/$C|$G.e uEGG Gp D$,|$0D$h$D$,D$1`Í~붉L$$A$Q T$D$`$[V.$D$  $D$T$D$ D$ $L$L$ƝT$D$ D$ $D$D$ .L$D$ ^D$e /D$tud L$D$8D$L$ d e  d $D$ÐD$ p  $D$ D$L$ d e  d d d d e uTd A$D$"s7D$L$ d e u d e Í=d =d 륍=d q=d =tud D$Ae ;avPYuMD$ HI@ T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8뗍|$ 9;u#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8J똍|$ 9;u#e ;avBD$$L$L$D$[D$ L$ $D$D$D$e ;avHD$T$9u1JRX@9t 1D$É$L$\$1D$ 1qe ;av: D$$L$L$D$L$ $D$D$D$ e ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$UD$ 1݉$L$l$:L$ D$\$vqe ;avNYuKD$(@L$,T$0T$T$4T$T$8T$ $ЋD$L$T$T$ ide ;av> D$$L$L$D$|L$9wL$L$D$ = e ;a D$$$L$(L$sD$L$ $L$D$L$ D$D$D$D$D$L$D$$D$D$(D$W$D$D$yZD$L$ D$,L$0 PKe ;avH D$$L$L$D$@L$9w)!ȋL$ȉD$T$ < e ;av+D$$D$D$gD$L$ D$L$ 莿e ;avD$D$ D$D$Xe ;a4D$8$L$Yu;D$t%H$L$+D$L$ D$L$9 苷멍|$9;u#e ;avVYuSD$ t=H$L$D$$D$D$(D$ D$,D$cD$L$D$0L$4 9 둍|$ 9;u#e ;avVYuSD$ t=H$L$D$$D$D$(D$ D$,D$D$L$D$0L$48 胶둍|$ 9;u#e ;av^ Yu[D$$tEH$L$D$(D$D$,D$ +D$L$T$\$D$0L$4T$8\$< 8 뉍|$$9;u#e ;avNYuKD$t5H$L$D$ D$D$$D$ D$L$D$(L$,7 {뙍|$9;u#e ;av>Yu;D$t%H$L$kD$L$ D$L$7 멍|$9;u#e ;av6 Yu3D$tH$L$kD$D$ 6 裴뱍|$9;uʼn#e ;av>Yu;D$t%H$L$D$L$ D$L$B6 ;멍|$9;u#e ;avNYuKD$t5H$L$D$ D$D$$D$ [D$L$D$(L$,5 軳뙍|$9;u#e ;av>Yu;D$t%H$L$ D$L$ D$L$R5 K멍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$4 ۲멍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$r4 k멍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$4 멍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$3 英멍|$9;u#e ;av>Yu;D$t%H$L$;D$L$ D$L$"3 멍|$9;u#e ;av: D$$L$L$D$L$ $D$D$D$ 诰e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$D$ 1݉4$T$l$*L$ D$\$qe ;av: D$$L$L$D$L$ $D$D$D$ 迯e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$D$ 1݉4$T$l$:L$ D$\$&qe ;avEYuBD$t,H P@$D$T$L$ D$D$0 Į뢍|$9;u#e ;avl(YulD$,tSH P@$D$T$L$ D$0D$D$4D$D$8D$D$L$ T$$D$e vuZ+ e |&荦e ۫e D$;AM$$$L$D$ʚ;D$ zD$D$ L$L$$$$\$D$ʚ;D$ |D$D$D$L$ D$lL$p$D$D$lD$D$ D$BD$L$$$ĤD$|DŽ$ `& $L$\)ʸ$I)ʉT$8>L$ T$T$|$  $D$L$|L$D$ D$ L$T$$$ĤDŽ$DŽ$ `& $L$\)ʉT$=L$ T$$$ [ݺ $D$$L$D$ D$ L$T$$$ĤDŽ$DŽ$ `& $D$=D$ L$$$$D$$D$D$ D$j D$L$$$ĤÍ7K$DŽ$ ĤDŽ$DŽ$ `& $D$fD$L$T$4$Z8j<\$l$$ĝ\$ D$L$D$D$ L$o$L$TL$l$T$ 4D$L$( e uL$DHD$4L$PpxD$D|$Hl$LT$0HP<$ыD$uL$PT$0\$(l$Lt$Dt1ދD$,@(L$H $ЋD$L$@P $ЋD$11|$,1G@ҵ$R$e p|$|$X_ulL$TOޯL$4T$XJ< e u5L$PJ8H0@4J0 e uB4$Íz4踩z8D$P訩蝩OϋD$T菩  $\$t$i$m11ڑe ;a@ҵ$QD$e |$|$ e P_ubWߍt$ˮHЄD$D$$D$$D$D$(D$D$,D$ D$0D$D$D$4Ð(nSe ;avuD$ D$$D$D$L$L$D$ $ lML$]u&D$$D$D$eD$D$ Ðmoe ;av}D$$D$$WD$D$L$L$D$ $ lML$u.D$$D$D$D$ D$}D$ D$$OÐElge ;a,D$(D$$D$D$L$L$D$ $ lML$@ҵ$S,D$e |$|$ e Pp_ubW薉H<@8T$J< e u7B8L$ J0 e uD$$B4T$(LÍz4D$$lz8bOωT  $\$t$.D$뀉‰/Oke ;a[,D$HD$0$cD$D$L$0L$D$ $ lML$|$t$4肈@ҵ$*D$e |$He O|$ e Wue׍t$*Hce ;av3D$$D$D$D$D$ D$ D$$D$be ;avGD$$D$L$L$L$ L$ L$$L$D$$D$be ;av3D$$D$D$D$D$ D$ D$$D$o6be ;avvD$$L$ L$gD$uËD$$D$D$$L$ L$L$$L$L$(L$ L$,L$D$$D$D$jane ;av3D$$D$D$D$D$ D$ D$$D$Fae ;av3D$$D$D$D$D$ D$ D$$D$`e ;av3D$$D$D$D$D$ D$ D$$D$`e ;avOD$$D$D$$L$L$L$ L$L$$L$ D$$D$D$:`e ;av3D$$D$D$D$D$ D$ D$$D$_e ;av+D$$D$D$D$D$D$ D$ w_e ;av3D$$D$D$D$D$ D$ D$$D$F_e ;avGD$$D$L$L$L$ L$ L$$L$D$$D$[^e ;av3D$$D$D$D$D$ D$ D$$D$o^e ;avNVD$H4tP4D$ $ЃË e u \UH4ٍx4\Uu+^e ;avD$H@$]e ;av D$ $JD$D$]e ;av D$ $D$D$by]e ;avD$ $_D$D$>]e ;avmD$HL$ $fD$ D$$pMD$xu)D$@$D$D$D$D$EÐ\we ;av$D$ $D$L$9D$e\e ;avxD$HL$ $D$ D$$pMD$u4L$T$J e uD$BBÍzD$bs*[le ;avwD$HL$ $D$ D$$pMD$u3L$T$ e uD$BÍzD$r2[me ;avZD$HL$ $VD$ D$$pMD$huD$L$AÐZe ;avZ D$HL$ $D$HL$e uT$PD$$D$D$ ÍxD$q/Ze ;avMD$$_D$tD$ D$$$UaD$L$L$ D$$Ye ;aQ4D$8$L$$,H $5D$L$$$0$$L$D$L$ $ $D$T$D$ l$,p2b$L$T$@T$D$ L$$$0$$L$L$ D$68$$D$ ̂$HP X9 )щ!ȉ$0)Ӊ$4$8DŽ$<DŽ$@$Ë$($$D$$,L$$L$ L$DL$$L$$L$$L$L$@L$ + $m\$$,x0$T$t$|$ \$|$T$$(L$D$$t$X$|$|Hc$D$D$DL$X$\$|9$99\$\$)ˉ!ˍLL$D$t$ 0 $$\$D$$t$<_$(P$ $$\$l$\l$*Ջ$$‰ȉ0$$l$L$\$ T$\$l$D$DL$X$$(P$ $\$D\$$l$2֋D$X$y$$L$DL$$T$*D$DL$X$\$|9w$]9U9M$)ˉ!ˍLL$D$T$ 0 $$T$D$$\$]$$0$$l$L$\$ T$L\$l$D$DL$X$G$t$x|$t$(H@)$L$ L$D$ MD$L$PL$xYl$t9L$ߍ\ ΋e u#D$`$\$T$DW҉T$$$0$$T$L$l$ \$Rt$D$l$X$L$xT$$hB$(H@)$L$ L$D$ LD$L$@L$XY$9P$ߍ\ ΋e u#D$`$\$T$7ωÉVΉD$8$0$$T$L$l$ \$It$D$l$XD$8L$X$d ;H Q T$TI$DŽ$ DŽ$DŽ$DŽ$X \$0$D$ L$$ $$,H IL$ `& $D$ L$$$ᶺ$D$$ D$D$ D$ D$L$$\$Tt$X11111G1@$l$p|$l$(H@)$L$ EL$D$ JD$L$PL$lYl$p97$ߍ\ ΋e u$,yT牄$T$(0$$T$L$l$ \$>t$D$l$X$L$lT$(뀍E Z$|$hl$d$(H@)$L$ L$D$ ID$L$PL$hYl$d97$ߍ\ ΋e u$,uST$,$0$$T$L$l$ \$Et$D$l$X$L$hT$,뀺ZST$0$0$$T$L$l$ \$t$D$l$X$L$XT$0xN$L$\T$XC @) $D$8D$D$ ?D$\L$`d 9toD$`L$\tStID$D$ L$D$ D$p$6 D$D$#D$D$ D$D$D$t$lÉ$L$d D$pD$ n11m%5e ;av D$$连 %e ;a0D$4$˴D$L$u0D$ D$$D$(D$,0T$ T$$L$(D$,|ud 0  $D$D$ D$D$ D$o$Se ;av' $D$ L$ D$$e ;aD$D$$D$D$D$D$ 裫D$$MD$$ND$L$ $D$WD$L$ l~d e uh~d `e Í=h~d p;#De ;avBJ $D$9 #e ;ae vu e Sm<舟^D?_{HUPC$V!?'e $u qd ? e Í=qd b:"6e ;av2DYu/t$Ht?ДD$@D$LD莤 "뵍|$H9;uɉ#e ;av*B$D$D$D$D$D$D$ Ț!e ;av*B$D$D$D$D$D$D$ ȚO!e ;av*B$D$D$D$D$D$D$  e ;av*B$D$D$D$D$D$D$  e ;av*B$D$D$D$D$D$D$ h_ e ;av*B$D$D$D$D$D$D$ h e ;av*B$D$D$D$D$D$D$ 舛e ;av*B$D$D$D$D$D$D$ 8oe ;avOYuLD$t6$"D$L$T$\$ l$l$ T$$\$(L$,D$0葡 똍|$9;u#e ;av7 Yu4D$t$"D$L$L$D$ ) "밍|$9;uĉ#e ;av7 Yu4D$t$D$D$D$D$R ɠ 밍|$9;uĉ#e ;avGYuDD$t.$D$D$D$ D$D$L$ L$$D$(Y R렍|$9;u#e ;av+D$$D$D$D$ 菦D$ D$e ;av4D$T$9u JX9u@J8D$ 11e ;a$`e v$u `e M]9舧SE:_J6q #$D$!D$WD$ D$ 1QL$=ʋk\$l$  #$D$-D$L$>lmhAD$ !| e (pd \$D$  $D$D$D$ 3-D$ $L$L$lT$D$ -D$ $L$L$tT$D$ ,D$ $L$L$T$D$ ,D$ $L$L$T$D$ w,D$ $L$L$eT$D$ H,D$ $L$L$\T$D$ ,D$ $L$L$xT$D$ +D$e 2D$0pd  $D$ D$-D$ D$  $D$T$D$ +D$ $L$L$ĺT$D$ R+D$ $L$L$'T$D$ #+D$ $L$L$6T$D$ *D$ $L$L$T$D$ *D$ $L$L$.T$D$ *D$ $L$L$}ٺT$D$ g*D$ $L$L$T$D$ 8*D$ $L$L$źT$D$  *D$ $D$D$ غL$D$ )D$e uD$,pd `e $Í=,pd D$e0=0pd D$T0=(pd D0e ;av81L$ D$ T$‰$L$lYL$D$ @!|ۉL$ae ;avkD$L$1\$S\$l$؉!};Ѝ,ыum{9uT$$l$|$UD$ uD$ D$ ye ;avJD$$L$L$D$D$ L$ $D$D$D$ D$_e ;av&D$T$8uJ@9D$ 1e ;av81L$ D$ T$‰$L$L$D$ @!|ۉL$e ;avBD$L$1B!}*,m8Õu\lm9tD$ D$ We ;av3D$$D$D$D$L$ T$D$ L$$T$(e ;awL$e c u]=Pd 16.wTd L$ Xd  \d e u `d Í=`d ,\$ $Pd D$3w\$ :5e ;a03$D$D$D$L$ L$,T$T$(\$4$l$8l$t$=Z9"t`\$(l$,u09l$DD$H\$LD$PD$T0D$DD$HD$LT$PL$T0Í 3 $D$D$D$L$ L$,T$T$(\$4$\$8\$\$<\$\$@\$ L$D$T$衔D$T$ L$$\$(l$,5\$(l$,(\$(l$,D$DD$HD$LD$PD$T0Å-   4e ;ace vu@ ce +}8XCSI0)'_ .5ff{/ƌa:LqǜwW$D$*'uD$L$  {d e uY ${d R$D$!tD$L$ {d e u {d ce Í={d )=${d y)e ;ae vu e /轋*c.BI9-]$D$DtD$ L$ ~d e l~d $D$"sD$ L$ }d e $}d $D$!sD$L$ }d e  }d $D$ `&e ]e vu蚅 ]e LW 2"H]e e D$;Al3$D$ D$ D$ L$T$111L$4$\$8$t$hڋl$\t$X$ËD$h9\$,o)ډT$T!‰T$)ىL$L$TL$ $ $ՋD$L$T$\$,؋d 9t3fDŽ$DŽ$$$ĄÉD$PL$dT$0$L$d D$OD$ uD$PL$dT$0딋D$PL$4 T$h$$|$8\$#l$(t$`D$TrjZ  Z \$$kl$L9w)͍]l l$H9c9[T$h|$8 $\$!D$8L$HT$hD$8L$4T$h\$L$$|$T.L$hT$8\$Ll$4$$T$hNjD$899|$D])D$T!ЉD$)L$L$TL$ 4$ӋD$L$T$\$D؋d 9t3qDŽ$DŽ$$$ĄÉD$@L$dT$0$L$d D$MD$ uD$@L$dT$0딋D$@L$L9T$#~T$89D$TD$(@Jl$hL$L$$L$\$ \$`$ЋD$L$T$L$$9L$XڋT$\‹D$L\$49NT$\L$Xl$8)Ňۇ!ŋ|$hL=)ËT$49~Rt<$L$\$V!\$T|$L)T$8D$hL$4l$\t$Xl$\T$8D$hL$4t$X$몋čd d DŽ$DŽ$$$ĄDŽ$DŽ$$$ĄÅofD$89Z$T$hЉD$D$$D$L$ fD$L$L$lD$pD$tD$x0$D$lD$@D$ L$L$tD$x$D$D$tD$D$ D$rhD$L$T$X$T$\$$$ĄËD$X$D$\$DŽ$DŽ$ĄÉىE\$<3$T$L$|$ l$Q|$T$D$TL$4\$be vu} be |zl.]xXVbe +e ;avk D$$$D$ToD$D$L$ L$T$T$ի$豽D$T$f @fBT$(D$D$,D$D$0 ye ;av*re vu| re 茇re Oe ;a|$@$u^$ݼ|$Ge u.DŽ$p$$ĀÍ/͍$D$7D$L$ -誺$D$D$L$ N11ɍT$ Y9lE-e <ʍtt$<؍\ tL-[/e  \l$<] e T һT$4D$01\$,KD$0T$49L$,ʋ+[|$P1l$P\$T$\$D$$L$ T$T$\L$X$L$d$T$`\$P$D$D$a"L$T$ $L$L$T$ B$DŽ$DŽ$ĀÍ$軺|$G!e u.DŽ$p$$ĀÍ ͉һ|$<Í \jō[5L$$-0,$T$L$D$ \$T$D$XL$$L$(|$@5hD$@D$(D$DD$@$D$D$!D$ D$8L$L$00$\$ \$D$D$ D$ |$D$L$T$0We uT$8Xȉى‹D$8L$ |$h1T$hL$ L$l$T$D$$kL$ T$T$tL$p$L$|$L$xL$h $D$D$ L$T$ $L$5L$T$ \$$$$ĀSe ;a,,$ID$D$$ w $3D$D$( ; $D$D$ ೯ $D$D$ P?L$8H e 4L$4HL$$H T$ P\$(X$D$MD$0 T$L$ $L$L$N D$0H T$L$ $L$L$% D$0@ "L$D$ $D$D$ D$($ND$ t%D$$HD$VN9}\$(l$0)! $)T$D$D$ -D$L$0\$\+s99$)Ήۇ!΍L5L$D$T$ D$(T$PZht$|$<Ut$H|$0 Td D@T$D$ "$\$|$D$0Ge uD$HD$PL$4T$L\$(D$H$$t|$G'e u+ZD$xpD$|$slÍZЍ$|$G*e u+D$xpD$|$MslÍnЉD$xD$|DŽ$slËT$Pz=D$xD$|$rl'D$xD$|$rlÉrT$PzD$xL$|$rlÉ3$D$D$D$L$T$ T$`L$dD$h$D$`D$D$ L$L$D$ $L$a `&$9r$$9B$m9Çݕ_ T ;;6$ f%AuX ;$9$t1$9l$_ T;1f%O ;$9$t_ T;$9$͋$$D$ L$D$  D$$ f%^t|f%m `&$9$$9$q $Ӄt1҉T$VeT$ D$ ;_ `&$9$ $9$3 $L$dT$ D$ ;_ J$ f%|tPf%~`&$92$ $щL$dT$ D$ ;_ `&$9%$ $9$ $L$?dT$ D$ ;_ $D\$$$ tpH P(@9 $)ȉ!D$)ʉT$\$ D$L$$\$`D$$$d$D$hLø 귺ōtX,$ML$L$語D$L$T$ $Pks;^9_$tn6@$|t$h$$$-,,$T$L$D$ |$\$$\$$$PG$Ge u#$tL$h$|11 $[؉$$$ tsP Xh9$)Ӊ!؉D$)Չl$L$ D$L$$\$`$$d$$hLø 귺t,$JL$L$D$L$T$ $Pks;^9$tn6$lt$d$$$-,,$T$L$D$ |$\$$\$L$$PG$Ge u#$t11ɋ$l\$d$؍$D$#D$$ $\,MUL$T$$ D$L$ $$QY \A Q$D$T$$P$D$L$T$$PH$:|$Ge t1ɍp1ۅ-`&9 $s $TCKD$L$$P$PD$L$ T$\$u.$ $L$D$$$P|$t$$$ tyH(p@ 9$)Ɖۇ!ƍ\5\$)L$T$ D$L$$\$`$$d$$hLø 귺…K ~N$0CKD$L$$P$3D$L$T$\$ ʼnЉΉى$C,K(L$D$$P$L$D$\$ T$밉11ۉ릋$PT$($H$ tpHh@ 9$)!ىL$)ʼnl$T$ mD$L$$\$`D$($d$H$hLÍ 귺ōta,$IL$L$sD$L$T$ $Pks;^9$tn6$$t$P$$-,,$T$D$L$ |$\$$\$$$PG$Ge u#$tL$P11$$$؋$ HX @9$)؉!ЉD$)ىL$l$ D$L$$dD$4$|$G!e u<]$d$\D$4$`p$d$hLÍ]\뿍 귺y$$$ txZj2R 9@$)Չۇ!Ս .L$)Ӊ\$D$ D$L$$\$`$$d$$hLÍ 귺‰T$\$$P$L$D$T$zE,M( $D$D$ D$ YD$L$T$\$$P ' $T$\$ZD$L$ $PZj2{95kj,މM| e u$Ջ|$tZ牄$$,$t$\$l$ |$蓖D$L$T$$PWe uˉƋ$$dc$$$ ttZj2R 9$)Ӊ!Ӎ L$)Չl$D$ D$L$$\$`$$d$$hLø 귺‹$PQ$|$Ge o t11ҍp$ $tLqI$xT$pqqv$$P|$tL$"`)$ pd L$L$"L$荔D$ L$p e u$xH$ $뗍x$x߈L$#$PHL$ `) $T$#T$&D$ L$p e u$xH$ $-x$x6܉$<$@DŽ$DDŽ$H0$$<D$XD$ L$$D$Hqt$D$)$DD$D$ D$&D$$L$$$ Z jr9$)݉ۇ!ݍ *L$)މt$D$ LD$L$L$,$P$~|$$Ge u=$$P$\D$,$`p$d$hLË$뾹귺t$$$ tsH Ph93$)ʉ!ЉD$)͉l$\$ eD$L$$\$`$$d$$hLø 귺t t,$JL$L$`D$L$T$ $Pks;^9$tn6`$tt$\$$$-,,$T$L$D$ |$\$$\$$$PG$Ge u#$ t$tT$\11$؃ E M $D$D$ D$ TSD$L$T$\$$PQ i9e 9] ‹Biqߍ^94^Y;|e u$͋|$tV牼$$,$T$t$l$ \$D$L$T$$PWe u $Ή‹$$P`ۋ$ H PX9 $)ˉ!؉D$)ʉT$l$ D$L$D$D$X$z|$Ge u<ۋ$X$\D$D$`p$d$hLÍۋ뿸 귺y$$$ twX hp9 $)މۇ!D$)݉l$L$ D$L$$\$`$$d$$hLø 귺‹$PQ$y|$Ge t11ҍp09u3A $ $L$D$c$$P|$t`$ HP@ 9 $)!ىL$)‰T$l$ D$L$D$H$\$x|$Ge u< O$\$\D$H$`p$d$hLÍ O뿸 귺y$$ $ tsH Ph9 $)ʉ!ЉD$)͉l$\$ 豿D$L$$\$`$ $d$$hLø 귺t`0,$JL$L$貊D$L$T$ $Pks;^9 $tn6$t$T$$$-,,$T$L$D$ |$\$$\$$$PG$Ge u#$t$T$T11N$c؋$PQ!$v|$Ge t11ҍpu;39$  $D$$$P|$t[$$$ tsH Ph9$)ʉ!ЉD$)͉l$\$ 脽D$L$$\$`$$d$$hLø 귺t3,$JL$L$腈D$L$T$ $Pks;^9 $tn6$t$X$$$-,,$T$L$D$ |$\$$\$$$PG$Ge u#$t$T$X11,$6؋$ $D$%$$P|$t9Ή$ G9΋$vlw9|؃hS9}ȅR$9C$X94$$ $)׉ۇ!׋$T,:l$\$$$P|$t$$'$Xr9"$ tmH P@9$)ȉ!؉D$)ʉT$l$ D$L$$\$`DŽ$dDŽ$hLÍ 귺ȋ$T$\$X$`DŽ$dDŽ$hL/ / . . $D$,D$G $L$,D$G $L$,D$G $L$,D$G $L$,D$G $L$,D$qG $L$,D$YG $L$,D$AG $L$,D$)G $L$,D$G $D$,D$F $D$,D$F $D$,D$F $D$,D$F $D$,D$F $D$,D$F / $L$,D$bF $L$,D$JF . $L$,D$+F $L$,D$F $D$,D$E $D$,D$E $D$,D$E $D$,D$E $D$,D$E $D$,D$E - , - - , , , + + ,$|$,D$,E 4$|$,D$E , $L$,D$D , , + y, r+ k+ d+ $l$,D$D E, >, 7+ 0, ), "+ + + , , + * + * * + * * + * * + * + + * * + + z* s+ l+ e+ ^* $\$,D$C ?+ 8+ 1* *+ #* * Ee ;a`d $D$D$UD$ D$WD$L$$L$胻D$ e uKpd `)$D$D$xe L$ u pd Í=pd =pd x3e ;aRLB D$4JL$0Z\$8jl$ RT$,t$Pt$<|$T|$@L$<D$$D$D$@( $ЋD$L$@P $ЋD$ L$P9L$TL$$D$,D$D$ D$ D$L$_ Ѝ;tL$4e uAD$0D$8${LÍy߃ug L$P9L$TL$$D$,D$D$ D$ fD$L$L$&$fD$CCD$ T$L$\D$DD$H"L$P9uzL$TL$$D$,D$D$ D$ D$HT$T$D$DL$H0$D$DD$ DD$ T$L$1111ɉL$1F $D$'D$j@ $D$'D$R@ $D$'D$:@ se ;a$B D$ JL$Z\$RT$l$(t$,1 GD$ L$9D@9u|$ $\$D$}D$ tKL$Q\$,9saT$(luE|$ w-e uT$\$l$(t$,T$\$l$(t$,|$a $$% he ;av\e vu) e %2jD$OJe }e ;av81L$ D$ T$‰$L$,L$D$ @|ۉL$!e ;avkD$L$1\$S\$l$؉};Ѝ,ыum{9uT$$l$|$D$ uD$ D$ 莨ye ;av81L$ D$ T$‰$L$$D$$D$D$ D$D$L$L$xD$<$PZs11\$@rzÅÇ!߅ ߗ;ZrۇÇ߅Ç! ޖ\$42|I11$L$D$l$ D$@D$\$T$D$L$ $T$XLÉl$|$5t$$ ӽ$PHwL$LP$ ȸ c $$ 诸DŽ$D$L$$$$獴$ V|$$ FiD$,L$($PZjl$\$ $D$*o$PH P)ыl$l$8ƉȉT$LT$nv$)ʋD$8D$LȉD$D$ʚ;D$ nD$ʚ;L$iʚ;ыT$0211ɋl$|‰ˋD$de vu de R荖de {ze ;av*Qe vu Qe 輪Qe /ze ;av*Te vuJ Te Te ye ;avBD$$L$L$藺D$L$ $D$D$D$ D$wye ;avWD$HT$Z*09t1Ʉt@J8D$1,$t$\$L$ D$T$ye ;aD$$L$L$ùD$L$Q$D$謹D$L$Q$D$蕹D$L$Q$D$D$D$ L$Q$D$_D$L$$ $D$D$ D$ D$?x:e ;aCD$HT$Z*091ɄH Xj r91ɄHXjr9tz1ɄtpHZ8u`J Zh p9t11Ʉu 1D$Ã$D$B$$D$ yD$ ׉$t$L$bL$ D$T$11몉4$\$l$;L$ D$T$f1_4$\$l$L$ D$T$#1,$t$\$L$ D$T$ve ;avXD$$D$D$7}D$ L$u)=defau Af=uluAtu D$ËL$Qve ;avHD$$D$D$|D$ L$u =hypeuAf=rvD$11ue ;avUD$$D$D$G|D$ L$u-=procu Af=esuAsD$111due ;av$ D$$D$D$wD$D$ %ue ;avHRe vuJ Re 茚ݐh~Re te ;av7 Yu4D$tH$L$D$D$ i bt밍|$9;uĉ#e ;av7 Yu4D$tH$L$D$D$  t밍|$9;uĉ#e ;av7 Yu4D$tH$L$D$D$  s밍|$9;uĉ#e ;av7 Yu4D$tH$L$D$D$ I Bs밍|$9;uĉ#e ;av/Ze vuZ Ze 輚Ze re ;av9Se vu  Se ̒W袎mSe re ;av D$D$`re ;avw$D$($_D$L$ $D$<D$D$ D$D$D$?D$L$ $L${xD$L$ D$,L$0$qme D$;A$1|$h ۥ $ pd L$$L$at$ L$L$'|$h耎|$(t$hsL$'t$t$(ZĈËTe $Ut$|$H8$t$H(Ĉp'e ;av0DD$H$t$|$$D$,L$(L$LD$PDpe ;av0DD$H$t$|$$蒍D$4L$0L$LD$PD9pe ;avGD$$?$xD$L$T$ T$ L$$D$(D$,D$0oe ;ah|$H1$ ` $ pd L$L$pL$L$tL$ |t$L$L$'|$H讌|$(t$H行L$'t!D$(L$lD$|DŽ$hËTe $yt$|$(\o@e ;av-|$1n|$eL$L$L$L$L$ L$ne ;aL|$\1L$P $L$L$ T$|$$1L$PL$$T$(L$ L$,|$׆|$8ΆL$$L$8L$,T$(T$_e ;avYD$$L$L$D$D$ L$Q$D$؟D$L$ $D$豣D$D$^e ;aD$T$9ujHZjp9t;1Ʉt1JR X@ 9t 1D$É$L$\$D$ 1݉,$L$\$,L$ D$T$1^_e ;av9Yu6t$ t 3{D$L$L$$D$( ]뮍|$ 9;u‰#e ;av1Yu.t$tzD$D$ _ X]붍|$9;uʉ#e ;avfHYuc|$\1ut$LtBhzD$PD$D$TD$D$XD$t$ |$4>z|$\t$41zH \끍|$L9;u#e ;av^DYu[|$T1ut$Ht:yD$LD$D$PD$%t$|$0y|$Tt$0yDB ;\뉍|$H9;u#e ;a5$D$(wfw0u`D$,D$0$ÍD$,D$0$Ãu{D$,D$0$ÍdqD$,D$0$Ãw1uD$,D$0$ÍD$,D$0$ÃuxKD$,D$0 $Í@D$,D$0$à wg w1uD$,D$0$ÍD$,D$0$à u޺D$,D$0$ÍD$,D$0 $à w1 uPD$,D$0 $Í&D$,D$0$ÃtwuuD$,D$0$É$D$D$ Q$qD$D$ D$D$u`D$ L$L$,D$0$Í.D$,D$0$Íy.D$,D$0 $Ye ;a8D$DoL$@nullIT$<$L$D$T$HT$ `D$L$$L$D$ D$ D$L$T$!؅ ÄtxD$0D$4`3$T$L$D$L$ L$0D$4`$D$D$0D$D$ D$D$L$D$LL$P8ËD$<D$LD$P8Í$sd D$D$@D$L$DL$ eD$L$tL$<D$LD$P8$D$@D$D$DD$D$HD$ _D$L$D$ L$$D$(D$,0$D$ D$cD$L$ D$(L$,`$D$D$(D$D$ D$蕿D$L$D$LL$P8Í($D$$D$D$ D$SD$L$L$LD$P8D$LD$P8ËL$@WXe ;a)e vu0 )e ~M$D$D$!D$ D$  $D$଺T$D$ CgD$$L$L$J/T$D$ gD$$L$L$ T$D$ fD$$L$L$MT$D$ fD$$L$L$ŻT$D$ {fD$$L$L$`/T$D$ IfD$$L$L$ T$D$ fD$$L$L$ŻT$D$ eD$$L$L$ٻT$D$ eD$$L$L$T$D$ eD$ $L$L$x T$D$ OeD$ $L$L$CcT$D$ eD$ $L$L$PvT$D$ dD$ $L$L$ T$D$ dD$ $L$L$iQT$D$ dD$$L$L$U/T$D$ UdD$$D$D$ L$D$ #dD$e uD$sd )e Í=sd D$j$Se ;av7 Yu4D$t$D$L$L$D$  R밍|$9;uĉ#e ;a;(D$ D$$L$,Qd d e D$0d T$ D$$T$ xZ݃ uˀʼnރ\$;{$D$t$D$ L$@( $ЋD$L$ $D$ D$L$ T$$L$D$蠯D$L$ ۫$L$D$D$D$L$ L$ $D$T$,T$T$0T$ D$D$4D$D$8(ƀtÃ8L$4l$8(Éu 8Ã׍^$|$Ge u ͻ`ͻOhS{t볉111=d D$0hSD$0Jl$0111gD$G E$|$ ZPe ;atD$LD$PD$TD$X$D$xD$L$|L$D$L$T$ t"B$T$$T$ $ЃtË$wQZd ?d e $d T$T\$XT$Tj ù؋t$xϋN5d  d 5e Gt$|5d L$Lt$PL$LAD$|$ u t$8L$0D$$D$,xjD$$3l$ \$Ç߃uÇ߃D$$ԍ^$ |$Ge u ͻͻ{cx1t뭉111=d D$|Gc$t$|$t$||$|111ωE111'=d $b$$111D$,G E$|$ D$,G E$|$ D$dD$hD$lD$pD$dD$|D$hL$l$D$p$D$!D$dD$D$ D$D$L$L$\D$`0$D$\D$D$ L$ $D$ 0$D$ JJe D$;A$$$L$$T$ D$L$ $D$D$$L$L$\1D$DPT$D$$$L$$\$D$ L$D9a$$$L$$T${D$ @,L$T$DT$ $Ѝ$$Nf$$1O$$$L$$T$\$D\$ BD$D$|L$L$TT$T$x$$$l$$t$|$D|$ D$L$T$\$\k3|$D9\$\$x$\$|\$\$T\$L$ T$D$D$$D$D$9D$ $$$L$$T$Z{D$L$T$ $L$D$D$ L$$L$XD$L$ T$c$$$D$$D$D$ D$D$L$T$$D$L${{D$ L$ĸÉD$XL$<$$$D$$D$D$ D$詞D$D$|L$L$TT$T$x3$D$D$D$ \$<\$CD$L$T$<9JD$tL$P$L$XL$T$#fD$x$D$|D$D$TD$D$tD$ D$$$$L$$T$1D$L$T$ $L$D$D$L$ T$ $T$D$9D$L$ $D$eD$L$T$ $$$l$$t$D$ T$L$x$$$D$$D$胔D$D$HL$L$dT$ T$`$$$\$$\$FD$`$D$dD$D$HD$D$D$$D$hD$L$D$ O€t$Ã{$u$(ÃЍ^$|$Ge u ͻ ͻXX\tt $ƒĨË$ދ$ƒӃP1$ƒD$HX_$$$D$T$藒D$D$HL$L$dT$ T$`$$$\$$\$ZD$`$D$dD$D$HD$D$D$€$ÃR$$$T$L$D$L$T$ $L$D$ D$L$ $D$9D$L$T$ $$$l$$t$L$ T$D$L$$Ku$(Ã8^$I|$Ge u ͻWͻUGX:tt $ƒĨË$މD$H^$|$Ge u ͻͻ2U$$$T$L$/D$ I$D$HP$$$L$$T$=D$ L$@( $ЋD$L$@P $ЋD$D$,$ $$T$$\$D$L$ bD$@1\$\ ى‹D$@L$\T$'D$L!@D$XD$GD$HH(T$`$ыD$L$@P $ЋD$tH 6C'$$D$ 07CT$HPe u T$`Px‹D$`&믋D$L@D$XtXD$GuO'$D$ 8CT$HPe uT$`P 6Cx‹D$`&D$L8@0BP $ЋD$u L$`T$HD$L@\$GD$H@(L$` $ЋL$T$D$XD$HH(T$`$ыD$L$@P $ЋD$ED$H@(L$` $ЋD$L$- $D$D$KD$ $A $X1&L$LI8T$D$T$d$эt$ $Xp*L$@L$F$$XT*L$FD$F$DŽ$DŽ$D$|$$D$|tb $$9us$T$D$WD$ tZ$$A A$D$s;Č11랋$ѐѓČÐēČÍ0$8D$ DŽ$DŽ$DŽ$DŽ$$D$d$0$$$L$茤D$L$ $$d$D$G$D$D$ D$sD$L$$$0$$D$D$ L$ $D$" DŽ$DŽ$DŽ$DŽ$$D$d$0$$$L$詣D$ L$$$1$D$;$D$D$ D$"rD$L$$$0$$D$3D$ L$ $D$? DŽ$DŽ$DŽ$DŽ$$D$d$0$$$L$ƢD$ L$$$!/$D$%$D$D$ D$?qD$L$$$0$$D$PD$ L$ $D$\ DŽ$DŽ$DŽ$DŽ$$D$d$0$$$L$D$L$ $$ $D$6$D$D$ D$\pD$L$$$0$$D$mD$ L$ $D$y e $;A$x $$$$ $i QL d 1 d e  $d $$$ Z݃ uˀʼnރtĬÍ{Y * $D$t$sZD$L$T$ ˃ $$\$h$D$\$wD$$L$L$tT$ T$H1D$PX\$P$$$L$T$hT$;sD$ L$P9D$HP,L$\$t$ҍ$x$#$|$xI1{$$$L$T$hT$\$P\$ Z$D$DL$$T$T$d\$$$l$ppP,$֋D$}D$pL$D1҉D$pL$DT$?YP$ӋD$D$`*L$pT$D\$?BP $ЋD$D$`D$?xD$dD$\OPu%$ƒ@$$$L$iD$D$ D$$$$D$D$dD$WD$L$T$ ˃L$d"iuÀ$D$\$WD$L$T$ $L$D$D$ XD$L$T$˃H$D$\$bD$ L$۫$D$L$£D$ L$$L$Tu(H^$|$Ge u ͻ"ͻsit뭋$5u$ƒ"^$|$Ge u ͻͻPt뭋$@$KD$`D$?1y$$$T$\$d\$L$ w]D$L$T$$L$D$`D$ L$۫$D$L$ D$L$ $D$D$L@D$L$ $$T$\$d\$dD$ L$L9Q$$$D$D$dD$7`D$ L$۫$D$L$yD$L$ $D$U$L@DD$`D$?o$$$L$T$dT$轈D$ L$@( $ЋD$D$@L$L$lPP $ҋD$0D$@@@ |d |d T$L$L$l $D$ $$$L$T$dT$5fD$L$ D$X1 \$| ى‰L$|T$TAY)$4$$|$|$d|$l$ \$D$dD$ L$T$$L$D$^D$L$ ۫$L$D$D$L$ $D$D$T@L$X9X$@$L$pT$DBP $ЋD$u L$pT$D$J@B\$?D$D@(L$p $ЋL$T$D$`D$DH(T$p$ыD$L$@P $ЋD$VD$D@(L$p $ЋD$L$> $D$D$j=D$ $$$D$D$hD$D$ D$VD$L$T$ $t@$$D$D$L$ T$B $ЋD$D$x$H19 $D$xD$$HD$T$H$$Htu$L$0$H$$0$ $۫$L$D$UD$ L$T$t$L$hqĬÉD$h$$$L$D$D$L$ T$?$DŽ$DŽ$$$$$-9 $D$\$)HD$  d   d e Hd $$$tVHʃ uɀH$$$\$\$h\$D$ T$L$vs$111뼍=d H/sH b11ĬƀtÃ\$h^$4|$Ge u ͻͻ111<=d $$$111D$dG E$|$s D$\G E$|$X D$hG E$|$= 0$@D$# DŽ$DŽ$DŽ$DŽ$$$$0$$xL$觓D$ L$$$fd$D$G$D$D$ D$ bD$L$$$0$$D$1D$ L$ $D$= DŽ$DŽ$DŽ$DŽ$$$$0$$xL$D$ L$$$_1$D$;$D$D$ D$:aD$L$$$0$$D$KD$ L$ $D$W DŽ$DŽ$DŽ$DŽ$$$$0$$xL$ۑD$ L$$$.$D$%$D$D$ D$T`D$L$$$0$$D$eD$ L$ $D$q DŽ$DŽ$ DŽ$DŽ$$$$ 0$$xL$D$ L$$$ $D$6$D$D$ D$n_D$L$$$0$$D$D$ L$ $D$苂 e ;a`$yD$L$T$ 1ՃʀC ɇÇ݃Ç!ɇÇ t r1 s%K|D$L$D$ s r r Ae ;aA D$$L$(T$,!up΃ɀ + L$(ÁÇ!҇Ç ݕtjhux9~T$,3$\$l$|$ t$D$L$T$|$$We uT$,͉ÉL$(S Phr9jh D$0D$4 Í3$\$T$l$ t$KD$L$T$|$$We uʉÉL$(+ e ;a,D$0HPjt$8D$4 ƋD$4 lj|$(D$4|$8 9ABL$0AD$4DD$(DDD$8DD$<D$@,Ét$$|$ 3$\$T$L$ l$;D$L$T$|$0We ut$$|$ ʉi e ;a,D$0HPjt$4D$8 D$(D$8 D$$D$8 97Jl$0ML$(LL$$LDD$<D$@,ÉD$ 3$\$T$L$ l$5D$L$T$|$0We u|$4ʉËD$ w e ;avGD$$D$T$ 1ЉD$ 1Ӊ\$;D$L$ L$$D$("e ;av<D$$D$1ȉD$D$D$L$ L$$D$(e ;a,D$0$L$8L$L$D$0HT$8\$ h09wp9t$(l$$$D$4D$T$D$ |$0GD$$Ge uD$(D$@D$D,ËD$( L$$3$t$L$l$ \$Ot$l$D$0L$$T$8\$ Qn e ;a,D$0$L$8L$L$|D$0HT$8\$ h09wp9t$(l$$$D$4D$T$D$ |$0GD$$Ge uD$(D$<D$@,ËD$(sL$$3$t$L$l$ \$?t$l$D$0L$$T$8\$ Q}m e ;avbD$$L$ L$gD$L$ $D$D$\D$$D$D$D$ D$pD$ L$D$$L$('e ;avD$ @L$ $ЋD$D$e ;av3D$ @L$ $ЋD$D$pWD$@e D$e ;avxe ;avXe ;acDD$Hu(|d |d D$PD$TL$XD$\DÍ  $D$L$LL$ D$L$ T$L$AT$($T$D$tyD$t@D$4D$8D$4D$(D$8 ż$D$D$4D$D$ D$[VD$L$D$PD$TL$XD$\DËD$D$PD$(D$TD$XD$\DÉC`$D$HD$D$LD$D$L$ T$L$ AT$$$T$D$tyD$ t@D$,D$0D$,D$$D$0 ż$D$D$,D$D$ D$\UD$L$D$PD$TD$XL$\DD$<D$@D$ D$8D$@/l$@111LD$G E$|$8_ e ;a8D$0D$4L$<Jd 2 d e  D$@d L$0D$4T$0Z݃ uˀʼn\$D$$T$ ރ t L$Dl$H8É$D$t$ZD$ L$@( $ЋD$L$@P $ЋD$u D$@L$<믋D$ $L$$L$T$T$iZD$ L$$L$kD$D$L$ L$,T$T$($L$D$%D$L$T$ $D$L$D$ D$ D$$D$D$D$ID$($D$,D$D$D$0L$ D$G\$$D$t$YD$ L$@( $ЋD$L$@P $ЋD$>D$HD$tEL$ $L$$L$D$%D$L$T$ $L$D$'0D$ L$͉PtpL$$ƒtT$ $L$D$XD$ L$@( $ЋD$L$ $D$UiD$L$ T$$L$D$/D$ L$뀋L$$뎍^$i|$Ge u ͻͻuL$@D$<"HHЉ111,=d D$@D$@l$@111D$G E$|$|[ Pe ;a$D$(HuBŘ$D$D$D$ D$7D$L$D$,L$0$D$D$ D$0$hD$L$ D$L$ ؼ$D$ D$D$D$ D$J7D$L$L$,D$0$e ;avD$e ;a$D$(HuD$,D$0$D$D$ D$0$gD$L$ D$L$ J$D$&D$D$D$ D$f6D$L$L$,D$0$He ;avD$e ;a$D$D$L$ L$YmD$L$T$ uR$D$D$D$ D$*mD$L$ T$u D$$ËI$D$tD$$ËB $D$tD$$Be ;avp D$t\$L$L$D$t:L$t D$ ËT$e u D$AލyD$"D$ D$ te ;avD$@@ Ve ;av5L$ |$OL$O e uD$G ËD$e ;avD$H@T$L$ D$e ;av D$L$Ae ;av_ $D$D$D$D$D$ L$Pt D$ T$$ËD$$D$L$L$ D$$e ;a*hD$tL$p"0$譋D$D$ L$p $L$tL$L$xL$ @L$ D$D$L$:D$ HT$L$ ` $L$lL$D$L$t!$DŽ$DŽ$hËD$|D$4$D$8D$ @L$,D$0D$XD$\D$`D$d0$L$4L$jcD$L$ D$XL$\0$D$,D$DcD$L$ D$`L$d$D$D$XD$D$ D$v2D$L$DŽ$$$hDŽ$$$hÍ&$D$D$L$p $T$tT$\$x\$-l$ D$tD$D$pD$Ztqu+FALSu]kEu+Falsu:ke+falskevӃ밉$T$PD$D$ D$T$ D$P$\$(|$L D$P$T$ \$(|$L.$T$OD$D$ aD$T$ D$P$\$(|$LD$P$T$ \$(|$L$@($ $ЋD$L$@P $ЋD$D$TD$X V $D$ID$ L$L$TD$XT$D$D$TD$D$ D$D$L$DŽ$Ƅ$$$Ë$HD$L$ D$$L$($D$D$$D$D$ D$p D$L$L$D$ 0$D$D$>D$ L$ $D$0 ߥje ;av D$D$谥e ;aL$0T$$9 I\$ lttt$4t$t$49l$ $vtll$ ,t5e LL$ uA4$,l$ ll$l-e u |Éb|$WD$|$D|$D$ 7D$z  裤e ;avlD$0L$$9sV@\$ lt|$49s< D$tD$,D$0Ë|d |d D$,L$0ËH P@$T$L$D$$D$ D$(D$D$L$L$,D$0N)e ;aB,$\$ۺD$D$ D$D$0L$@\$8l$Dt$p|$4D$0L$@\$8l$Dt$p|$4`V׉ D$0|$4D$tD$\D$xD$`D$dD$h0$D$\D$D$ L$L$dD$h|ud 0  $D$D$D$ "D$dD$D$D$l     Ȅe ;a D$(L$$T$ \$l$u$щډ$$$$$ĨÉ$$T$$T$$T$ L$$L$D$(L$$T$ \$l$nHD$L$$$D$L$T$qXu<ÃVD$,L$ T$H P$L$D$L$ L$,Q+byteks\$[iquk.freuanquVl$@E,$L$DL$D$T$ 1D$s D$@$D$DD$D$,D$D$D$ D$ D$ <Ël$@묃uQ+grouuBkpu S+varikfnt1&у̃룉D$$T$(\$0}uu-+fixeudkfd3uTk2u :+fixe,kfd6k4뿃tNu+zigzu:kag32>+zigzkag64Ӊ$T$gD$D$ 胄D$T$(D$$L$,\$0D$$L$,T$(\$0_$T$ۺD$D$ 0D$D$$L$,T$(\$0D$$L$,T$(\$0 $D$D$\$ T$!MD$L$D$4L$80$D$4D$D$L$ $L$ 0$`D$}   Fe D$;A$$$H $ BBB$D$D$L$ e $BJe $J$H$L$$$Z\$xRT$X1t$dn$$T$X\$x$9l$d$@$$$ D$lL$Ti@T$\$$D$ yD$TH(T$l$ыD$@,L$D$ $Ѝ$$1b$$ $D$fD$D$ wD$L$$L$ D$D$ a9D$L$T$D$HL$hT$LA Q$D$D$L$ fD$PL$hQ$+byteksT$D$$$D$L$D$HD$ D$LD$fD$D$D$pL$L$tT$TR(\$l$ҋD$L$$$D$P L$`T$@!؅ɇÇ D$< `ò $fD$@L$D ȋL$$D$`1 ЉAD$D$L$D$hL$lLËD$P$D$TD$VD$$ZD$L$D$hL$lLÃfL$(]D$P@(L$T $ЋL$T$D$$D$PH(T$T$ыD$L$@P $ЋD$D$P@(L$T $ЋD$L$D$<D$@D$DD$HD$3$$8\$\$T\$L$ D$OT$D$L$@뻍3$t$\$l$ T$"l$t$D$8L$dT$T$<+3$$8L$T$l$ \$t$D$l$XD$8L$d$<$4$$L$D$D$x ' $D$$$e HL$xYif^ ؕtQ$8 $$<L$$@L$D$ D$D$$HD$ ыD$,D$pL$(L$P\$$l$ t$}9$8$<$@. $$L$D$#yD$ t$@$<$8F$8$L$<$P$@$TD$P$XD$p$\0É$<3$t$l$\$ |$t$D$\$xD$pL$P$<@x‰]k$<-3,$\$L$T$ D$\$D$T$@$<3$$8l$D$T$ L$m\$D$T$H$<$L$P$T$$$X$\0Ð0Ë$8$L$<$P$@$TDŽ$XDŽ$\0111   ,Ee ;aLtL$|.|$D1d]  $L$|L$L$DL$ 1D$ L$D $"D$ L$Dt$H|$,aL$D|$t$,aL$tL$uL$$먉D$ D$x$L$L$D$D$ ' $(D$L$T$e uHHL$Yit0^ ؕtQ IL$$ЋD$L$ @Ӎx‰\[뫉$tDŽ$tCe D$;Av$`&$D$L$UD$D$0L$ L$LT$T$4$1[ $$L$$l$D$4L$0T$L*T$Ll$0D$4$ $!D$4L$0T$LL$0$tFi9~\$8`&$T$L$D$ l$T$D$L$h\$8ȋL$0끉T$\$L$D$D$`D$d1$$$ l$HEӉʉl$09D$H$$$L$\ $$l$T$;1t$ |$hB_D$lt D$hD$x$T$D\$t$9wN$9{$$ $\$D$a$L$D$D$@\$X3$$\$L$l$ T$t$l$D$@$T$D\$Xl$$L$hL$D$D$T ' $D$L$pT$le "HL$TYi^ ؕtQY L$\$$ $$L$$L$D$ $D$ ыD$,D$PL$(L$<\$$$l$ $t$$|$`<$L$D$rD$ t$$$$$$$$$D$<$D$P$İË@x‰'WD$dl$`$$$$$İË$$$$$$DŽ$DŽ$İ ?fe ;a`L$D$D$L$ L$D$L$T$ `$D$D$L$ L$fD$L$ T$uJD$t6$_D$$D$D$D$ D$D$ D$$D$$ËA$ЋD$D$$ËB $ЋD$D$$> e ;a<`L$D$@D$L$DL$D$L$T$ T`$D$@D$L$DL$fD$L$ T$D$@$WD$D$8$L$@L$T$DT$D$ 3 $D$D$)D$ L$T$\$8$D$L$T$ D$@D$D$DD$D$D$L$ T$$\$(l$,D$HL$LT$P\$Tl$X<Ë|d |d D$HD$LD$PD$TL$X<ËI$ыD$L$ T$\$l$l$HD$LL$PT$T\$X<ÉL$4T$0B $ЋD$ 3 $D$D$2D$L$ T$\$0[L$T$D$ D$D$4$ӋD$$L$ T$\$l$l$H\$LT$PL$TD$X<;e ;a``L$D$hD$L$lL$YD$L$ T$L$0T$HA$ЋD$L$dQЋY9mD$0@QiqD$\$T$l$ T$H$ЋD$L$T$\$$l$ |$dOGe ul$p\$t`ÉuR9 3 $D$D$ D$L$dQ\$Dl$t$ 99w^9l$@t$X$|$T$ZD$D|$dGD$@Ge u D$XD$XQT$@|$TD$< 3 $t$D$l$ \$l$t$D$HP$T$L$bD$L$ 9HP$SHKL e CD '$6D$ 0CL$\H e $H$ $D$D$D$ D$D$D$D$$H( !ډӃP0پ !Ճ ! h4$D$W2ъÍx$7{Dk@Y$$è$D$L$@D$L$ T$tI$ыD$L$`è$$D$$D$D$L$ T$[I$ыD$L$JÐÉ $T$'D$謗 E~ D$\@`$ $ЋD$L$$lT$D$6L$ D$2D$L$$D$H0$$DD$蓚D$ L$ $D$蟌 ~ $H @D$ L$$D$D$#D$L$$L$P0$$LD$D$ L$ $D$  9} 2~ +~ $H @D$ L$$D$D$#&D$L$$T$X0$$TD$臙D$ L$ $D$蓋 D$\@`$ $ЋD$L$$$\5$$d$h$H$t$x$$D$H$$$\D$D$D$ .D$L$$$$(0$$$D$蟘D$ L$ $D$諊 CK@` $ЋD$L$$[ T$D$#L$ D$D$L$$,$00$$,D$D$ L$ $D$* CK@` $ЋD$L$$T$D$+L$ D$<D$L$$4$80$$4D$蝗D$ L$ $D$詉 EM@` $ЋD$L$$t2T$D$%L$ D$D$L$$<$@0$$<D$D$ L$ $D$( q e ;a8|$ 1L$DL$ L$HL$$L$LL$(L$PL$,L$TL$0L$XL$4L$<YRd$ҋL$T$@D$<L$@ʋHXh9֍U9FUPTm<ы e u 5p.뼍$|$p.D$D$<뚍$L$l$\$ T$D$L$T$\$D$,D$tK$ĨÍK$ĨÃD$tND$,t1D$t`L$ĨÍdL$ĨÍ\L$ĨËD$,t1D$tTL$ĨÍXL$ĨÍPL$ĨÃD$,D$(}L$HbytecQsD$tH$$$D$D$$D$DD$D$$D$ppD$ $ĨË$$$D$D$$D$DD$D$$D$oD$ $ĨÃgrouQpD$tH$$$D$?D$$D$DD$D$$D$pD$ $ĨË$$$D$D$$D$DD$D$$D$oD$ $ĨÃ>L$H5D$HD$hD$(D$l$@AP$ЋD$V$$\$$@($ $ЋL$T$D$,$H($$ыD$L$@P $ЋD$$@($ $ЋD$L$DŽ$DŽ$DŽ$DŽ$$$$0$L$XL$D$ L$$$$D$)$D$D$ D$lVD$L$L$PD$T0$D$PD$膇D$ L$ $D$y DŽ$DŽ$DŽ$DŽ$$$$0$L$hL$D$ L$$$}$D$)$D$D$ D$UD$L$D$`L$d0$D$`D$謆D$ L$ $D$x $@`$ $ЋD$L$$T$D$D$ L$D$L$L$pD$t0$D$pD$,D$ L$ $D$8x $@`$ $ЋD$L$$0üT$D$D$ L$BD$L$L$xD$|0$D$xD$謅D$ L$ $D$w $@`$ $ЋD$L$$ xT$D$)L$ D$D$L$$$0$$D$#D$ L$ $D$/w Hi Ai :h ce ;aD$,D$$L$ L$T$$T$vD$L$ T$tM\$ 9l$(MUL$$)!l$L$0)É\$4T$8D$<D$@Ëȍd ̍d D$0D$4D$8D$D$<$L$@L$T$DT$ftD$L$T$ \$@9)ˉ\$@l$D)͉l$Dۇ!l$<L$D$@$L$DL$T$HT$fD$L$T$ \$D9)ˉ\$Dl$H)͉l$Hۇ!l$@L$@l$L}u]N9:NM AD$@D$TD$DD$XD$HD$\D$`D$d<ÉD$(T$ `3$|$t$\$ L$药D$L$T$|$LWe uT$ ΉNjD$(nfȍd ̍d D$TD$XD$\D$`L$d<Ë|d |d T$@T$TT$DT$XT$HT$\L$`D$d<ËD$@$L$DL$T$HT$8eD$L$ T$\$D9T)Ël$H)ʼnۇ!l$@D$@9ڇÇ9!9 9)͉)Ήۇ!΋\$@ޅl$0T$4t$8&z}<ӉOT$4l$0t$8L$DD$H\$@L$DD$H\$@$L$D$LdD$ L$T$\$D9S)Ӊ\$Dl$H)Չl$Hۇ!l$@T$@l$L}U]r9YD$$L$,`3$\$T$|$ t$iD$L$T$|$LWe uʉËD$$L$,B̍d ȍd D$TD$XD$\L$`D$d<Ét$Tl$XT$\D$`D$d<Ë̍d ȍd D$TD$XD$\L$`D$d<Ëȍd ̍d D$TD$XD$\D$`L$d69.t$D$$L$$D$L$t$ D$L$|$0O e uID$L$(9T$)‰!‹l$$T$8)L$<\$@D$DD$H 蔬D$L$(9벋̍d ȍd D$8D$<D$@L$DD$H Ëȍd ̍d D$8D$<D$@D$DL$H Ë|d |d T$$T$8T$(T$e ;a0D$DsD$4$L$8L$T$D$ pCL$ H e L$4HL$H e uGL$$HL$,HL$(HL$H e uL$0H D$@8Íx D$0苕xD$$yyD$,myD$(a뤍xD$4Oi}e ;atD$xH,D$T$|$эt$|$@耚D$`D$< ` $<=D$ CL$xH e uVL$|H$H L$$XHL$xQXT$$T$D$$\$$\$ \$`\$R D$L$$X$D$ D$ L$WD$X$X$ ۺL$D$D$L$v$XH)L$xQ\T$$T$D$$\$$\$ \$X\$D$L$$X$D$ HD$ L$$X$$X$D$>D$ L$uK$X$D$ D$ L$uD$\@L$H9?$h$lPÉ$h$lPÉ$h$lPÉ$h$lPÉ$D$ rD$ L$u $X$h$lPÉ$h$lPÍPw=0t$ƒ $D$d^$ |$Ge u ͻ=ͻ|l-$h$lPÉ$h$lPÉ$D$ pD$L$ u $X$h$lPÉ$h$lPÉ$D$ !D$L$ u $XY$h$lPÉ$h$lPÉ$D$ D$ L$u $X$h$lPÉ$h$lP1\$LCL$d$D$L$$T$L$OD$ L$L9$X$L$xL$hD$L$ $XH$$$L$T$dT$\$L\$ ˭D$L$T$Ãuh$T$$Xl$T$L$ \$L$xL$D$L$u9$X$D$ oD$ L$$h$lPÉ$h$lPÀt|^$ɺD$D$[D$ L$T$$X$D$L$T$ FD$L$:$h$lPÉ낉D$d^$|$Ge u ͻͻ>i $D$ \D$L$ 7$h$lPÉ$h$lPË$$!$*Ã$t$Ã$^$|$Ge u ͻAͻJh1 $D$D$諎T$ D$DL$tn $ٻT$D$胎D$ WD$DL$t3$\$$`D$$dD$蔃D$$L$L$dT$ $$D$L$D$ L$$L$`D$tDŽ$hDŽ$lPË$T$$XD$$D$$D$ D$dD$UD$L$t$h$lPË$\$$`L$$dT$D$ u $T$T$$XL$$\T$$`\$ $dl$D$L$T$$h$lPËD$dG E$|$| D$dG E$|$a D$dG E$|$F D$`G E$|$+ D$dG E$|$ $T$'D$x  :Nue ;adD$p$D$tD$D$xD$KD$L$T$ à !Z f.f- c 5c =c H\$(L$XT$TD$|h@(groue@pI{}D$#L$l $D$D$ L$D$lHAL$(T$X\$TL$$T$P\$L$T$L$ѪD$L$  $L$D$D$L$T$ D$$D$PT$L\$h$\$l\$T$D$ L$D$L$uYD$l$D$l$D$#D$D$ L$uDŽ$DŽ$dÉ$$dÉ$$dËD$L$D$PD$L$襞L$D$T$ @B $ЋD$L$u.D$l$D$L$<$$dÉ$$dËD$T$D$XD$L$~L$T$\$ Z$D$ D$ L$u D$l$$dÉ$$dø<><><><>$L$\$赨D$ L$D$\D$`D$\L$`0$D$lD$D$\D$D$ D$D$L$$$dÉ$L$\$=D$L$ T$l$L$D$D$L$ $$dÉ$L$\$}D$L$T$ \$,$T$L$D$ KQD$L$L$D$D$l$/D$L$ t$$dËD$l$|$t$l$ D$L$$$d f.v-c 5c =c f.u{-c 5c =c h111]u +D$(^$|$Ge u sͻsͻB` D$(G E$|$F HZe ;a4D$8$D$"D$ L$D$@L$8T$<1l$(]l$@t$8|$<91X\$(, P   u_s,AQ @D$$ЋD$L$ tD$DL$H4D$,D$03D$,Е_ ډT$0Qi T$l$@$D$ L$$L$ͻD$D$ L$,L$D$D$+D$ L$$^AQ c @-c 5c t$l$\$ $ЋD$L$%AQ жc @-̶c 5ȶc t$l$\$ $ЋL$D$ "tD\AQ @c -c 5c \$l$t$ $ЋD$L$AQ @c -c 5c \$l$t$ $ЋD$L$]AQ @c -c 5c \$l$t$ $ЋD$L$$ $D$"D$L$ D$DL$H4ÉL$DD$H4 E&e ;a6$QX|$l1]|$l]$L$l$L$p$L$tD$xL$p9D$l$@D$L$ T$\$Qك ȃta$$;$$ c ܶc ضc \$T$L$ D$L$b$$ĀÉl$,\$(D$HD$L `3 $D$T$hD$L$ L$HD$L0$$L$T$HT$D$ D$ǬD$L$;D$($Qt ƒt $D$ D$ L$D$(D$,tuD$l$$$>D$L$u9$$D$ D$L$ $$ĀÉ$$ĀÍD$l$8 $$D$L$뉃_D$xH}<ȍd ̍d 11ۋ$,$T$\$D$ L$RL$D$T$p9L$xL$lT$p9h9l ݍX9\  h9T  11WD$0D$4 `3 $D$D$D$L$ L$0D$40$$L$LT$D$ \$0\$D$D$苧L$ D$$$$D${D$ L$$CD$l$D$!D$L$T$\$l$ twtqBD$8D$<D$8L$<0$$L$T$D$ \$8\$D$D$ȦD$ L$$‰ȉ?뎉\$`l$dD$hD$@D$D$L$`L$D$ L$L$@D$D0$$L$T$D$ \$@\$D$D$,L$$D$ _$$ĀË$$D$:D$ L$u D$($$ĀÉ$$Āt{AD$PD$TD$PT$T0$$D$D$D$ D$PD$D$D$WD$ L$$$$ĀÉDŽ$DŽ$ĀD$XD$\`&$$D$D$L$ D$XL$\0$$L$T$D$ T$XT$D$D$蝤D$ L$$u $$$Ā; 4 - & O>e ;a8D$Htut@D$(D$,D$(D$LD$,0$D$D$X5111T $D$ D$ L$u L$HL$\D$`@ÉD$\L$`@3e ;a$D$(Htf0L$T$ Hp I\$T$l$ 4$ыL$D$ )D$(~$,c (c -0c 9~ |9v@$Ã$, U3`e ;aPD$HD$LL$`Qkd Sd e +D$dd T$HD$LT$HZ݃ ˀɉ\$ D$8T$4ރ\$,{BL$D$XD$L$\L$D$L$ T$1T$0L$D$< $ D$L$H e \L$0H D$@@L$TP $T$`T$T$dT$D$L$ T$t|I$ыD$L$u\D$@$D$L$u8D$ul$ Uzul$ Udul$ ]UPuT$^$|$Ge u fa>YuT$uT$uT$B D$G E$|$8 D$G E$|$ f&!e ;a D$D$ ID$1ɋT$$T$ u#T$ 199!9 ЈD$( Ãu l$ U1ԃ u l$ U1Í^$|$Ge u CC = ul$ U1p ul$ U]\ ul$ U1IuT$1 uT$1^$|$Ge u C_ClD$L$T$ \$덁@! tƁ ! t뮁! t떃…!ڃÇ t o=!=Ç t I=!=Ç t #=!=Ç t =!= „t l$, \7e ;aZXBD$@L$hQT$, L$DD$PD$T\$pl$lt$d|$`D$81D$4D$8+D$4@L$,T$D\$pl$lt$d|$`ыT$,D$4D$@D$49 oL$LD$\$|$t$l$ \$ e ;avZ D$tL$t ÉD$&$D$L$  e uL$̋|$&e ;avD$tL$he ;a4D$<@tqT$8Z,l$(r:99t$$|$0߉$L$D$q%D$(|$8GD$$Ge uID$0t4Í`$D$|$8GG e uËD$0벉L$,D$$\$  '$|$\$t$ l$t$|$D$$L$,T$8\$ l$( *e ;avfD$tT$ tA CÍ '$D$L$PQe uD$ ȋ|$ *e ;av#D$H… ӄt T$Jfe ;a4D$<@tqT$8Z,l$(r:99t$$|$0$L$D$q#D$(|$8GD$$Ge uID$0t4Í`$D$|$8GG e uËD$0벉L$,D$$\$  3$|$\$t$ l$t$|$D$$L$,T$8\$ l$( *e ;avZD$tT$ tÍ 3$D$L$e uD$ ΋|$ 6e ;avD$tL$xe ;a4D$<@tqT$8Z,l$(r:99t$$|$0߉$L$D$!D$(|$8GD$$Ge uID$0t4Í$D$|$8GG e uËD$0벉L$,D$$\$ `3$|$\$t$ l$t$|$D$$L$,T$8\$ l$(~ :e ;avfD$tT$ tA CÍ`3$D$L$PQe uD$ ȋ|$ :e ;av#D$H… ӄt T$Jve ;a4D$<@tqT$8Z,l$(r:99t$$|$0$L$D$D$(|$8GD$$Ge uID$0t4Í$觿D$|$8GG e uËD$0벉L$,D$$\$ `B$|$\$t$ l$t$|$D$$L$,T$8\$ l$(| :e ;avbD$tT$ t Í`B$;D$L$e uD$ ʋ|$ >e ;avD$W.u{D$~e ;a4D$<@tqT$8Z,l$(r:99t$$|$0߉$L$D$D$(|$8GD$$Ge uID$0t4Í $觽D$|$8GG e uËD$0벉L$,D$$\$ B$|$\$t$ l$t$|$D$$L$,T$8\$ l$(z :e ;avbD$tT$ t ÍB$ͼD$L$e uD$ ʋ|$ >e ;avD$Wf.u{D$}e ;a4D$TD$L$T$ $L$D$bt볋D$C9!DE*j$D$+D$ L$ |d e =|d H$D$-]+D$ L$ |d e |d Fe $ pd g:$D$% +D$L$ |d e } |d ؼ$D$ *D$L$ |d e 3 |d $D$*D$L$ |d e  |d $D$#a*D$L$ |d e  |d M3$D$)*D$L$ |d e U |d J$D$&)D$L$ |d e   |d ڑ$ e d 辑e $ pd 袑e $ pd 4e  $D$ӕD$L$ |d e 7 |d B:$D$%+)D$L$ |d e  |d 8e * $D$aD$L$ @( $ЋD$L$|d e  |d D$ D$e ;avUD$HT$Z*09t1ɄtJ@9D$14$L$\$XL$ D$T$蔵e ;av'Yu$D$ @I$ыD$D$R|$ 9;uԉ#e ;av7Yu4D$@I$ыD$L$T$ D$L$T$ 밍|$9;uĉ#e ;avYuD$I@$у誴ȍ|$9;u܉#e ;avYuD$I@$уZȍ|$9;u܉#e ;av/ Yu,D$@I $ыD$L$D$L$ 븍|$9;ủ#e ;avFYuCD$t-@ $D$D$ L$T$L$D$ T$$5 胳롍|$9;u#e ;av6 Yu3D$t@ $D$D$D$ *5 #뱍|$9;uʼn#e ;av&Yu#D$ @L$ $ЋD$D$Ӳ|$ 9;uՉ#e ;av6Yu3D$@L$ $ЋD$L$ T$T$D$ L$$s뱍|$9;uʼn#e ;avYuD$@L$ $Ѓ+ɍ|$9;u݉#e ;avYuD$@L$ $Ѓ۱ɍ|$9;u݉#e ;av. Yu+D$@ L$ $ЋD$L$L$D$ {빍|$9;u͉#e ;av=Yu:D$t$HP$L$T$tD$ D$3 몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$sD$D$(2 苰뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$s2 뢍|$9;u#e ;avDYuAD$t+H P@$D$T$L$ D$D$1 襯룍|$9;u#e ;avUYuRD$ t跦e ;av-0h$D$D$xD$ L$L$D$le ;avHe ;avSġ$eD$ f c c c T$\$L$D$D$ D$$֥e ;av~D$D$ 覥e ;avO d $0hD$D$$D$D$(D$ D$,D$D$0D$sD$L$D$4L$8 :e ;avp0d $D$8D$D$!e vu !e "!e ke ;a4D$8P@T$D$ D$$D$(D$,D$0`E$L$D$ L$L$$D$(0$D$D$]D$ L$L$,D$0$D$D$$D$D$ D$D$L$L$D$D$  $W>D$L$,L$H e uL$$HL$ L$D(ÍxD$$蹕|$ 讕%~0e ;avk$=D$L$ L$H e u-L$Htu11ɉL$D$Í 1xD$'}ye ;a$D$,$D$0D$D$4D$D$8D$ D$Ç߃uÇ߃D$$ԍ^$)|$Ge u ͻͻKx1t뭉111=d D$|$t$|$t$||$|111ωE111'=d $$$111D$,G E$|$ D$,G E$|$ D$dD$hD$lD$pD$dD$|D$hL$l$D$p$D$!D$dD$D$ D$D$L$L$\D$`0$D$\D$D$ L$ $D$ 0$D$ he D$;A$$$L$$T$D$ L$$L$D$$L$L$l1D$DPT$D$$$L$$\$D$ L$D9n$$$L$$T$KD$ @,L$T$DT$ $Ѝ$$$$1O$$$L$$T$\$D\$ D$D$dL$$T$$$$$l$$t$|$D|$ ǺD$L$T$\$l+s|$D9S\\$$$$\$\$d\$L$ D$T$D$+v$D$D$D$ $$$L$$T$D$L$T$ $L$D$D$L$ @`$L$D$D$L$ T$$L$T$$$L$$T$螘D$L$T$ $L$D$2D$ L$@`$D$L$tD$$L$ L$LT$TR$$ҋD$$L$LI$$ыD$$H$Z,l$`0x99$|$\$T$\$D$`$GD$\Ge ~$$$$D$$D$D$ D$衻D$L$T$#$D$L$D$ L$ÉD$hL$<$$$D$$D$D$ D$+D$$L$L$dT$$3$D$D$D$ \$<\$7D$L$T$<9*$L$`$L$hL$T$蜂$$$D$D$dD$$D$ D$$$$L$$T$ѰD$L$T$ $L$D$走D$L$ T$ $T$D$D$L$ $D$D$L$T$ $$$l$$t$D$ T$L$$$$D$$D$#D$D$HL$L$dT$ T$`$$$\$$\$D$`$D$dD$D$HD$D$D$$D$hD$L$脧D$ O€t$Ã{$u$(ÃЍ^$K|$Ge u ͻ ͻsX\tt $ƒĨË$ދ$ƒӃP1$ƒD$HX_$$$D$T$7D$D$HL$L$dT$ T$`$$$\$$\$D$`$D$dD$D$HD$D$D$€$ÃR$$$T$L$艭D$L$T$ $L$D$D$L$ $D$D$L$T$ $$$l$$t$L$ T$D$$$Ku$(Ã8^$|$Ge u ͻWͻ\qGX:tt $ƒĨË$މD$H^$_|$Ge u ͻͻp$$$T$L$ϺD$ I$D$HP$$$L$$T$D$ L$@( $ЋD$L$@P $ЋD$D$,$ $$T$$\$落D$L$ bD$@1\$\ ى‹D$@L$\T$e ;a2D$H Q}%̍d ȍd D$D$ L$D$ËX9ԉP P9i9l i9l  i9l  Y9sh\ q9sSt q9s;t q9s#Dl$ É\$ D$D$; 4 - &     3=e ;aD$H Q}%̍d ȍd D$D$ L$D$ËX9ԉP @9sx i9sfl ݍY9sL\  i9s*D ؉D$ L$ D$D$, %   @<e ;aveD$$D$L$ T$\$tD$\$ L$$T$(É ؃1D$1t$ L$$T$(;e ;av^D$$D$ L$T$\$t\$L$ D$$T$(É1ˉ\$D$ D$$T$(;;e ;a1sD$L$T$ $L$D$D$ tD$L$T$˃H$D$\$ ~D$ L$׫$D$L$bD$ L$$L$Tu(H^$|$Ge u ͻ"ͻ7it뭋$5u$ƒ"^$$|$Ge u ͻͻ6Pt뭋$@$KD$`D$?1y$$$T$\$d\$L$ yD$L$T$$L$D$k|D$ L$׫$D$L$譽D$L$ $D$D$L@D$L$ $$T$\$d\$D$ L$L9Q$$$D$D$dD${D$ L$׫$D$L$D$L$ $D$U$L@DD$`D$?o$$$L$T$dT$]D$ L$@( $ЋD$D$@L$L$lPP $ҋD$0D$@@@ \|d X|d T$L$L$l $D$ $$$L$T$dT$ՁD$L$ D$X1 \$| ى‰L$|T$TAY)$4$$|$|$d|$l$ \$D$D$ L$T$$L$D$HzD$L$ ׫$L$D$芻D$L$ $D$D$T@L$X9X$@$L$pT$DBP $ЋD$u L$pT$D$J@B\$?D$D@(L$p $ЋL$T$D$`D$DH(T$p$ыD$L$@P $ЋD$VD$D@(L$p $ЋD$L$> $D$D$ YD$ $$$D$D$hD$D$ D$\rD$L$T$ $t@$$D$D$L$ T$B $ЋD$D$x$H12$D$xD$$HD$$H$c$Htu$L$0i7$H$$0M7$ $׫$L$D$D$ L$T$t$L$hqĬÉD$h$$$L$D$蚠D$L$ T$?$DŽ$DŽ$$$$$-9 $D$\$cD$  d   d e d $$$tVHʃ uɀ$$$\$\$h\$D$ T$L$$111뼍=d /s b11ĬƀtÃ\$h^$|$Ge u ͻͻG/111<=d $&/$$111D$dG E$|$ D$\G E$|$ D$hG E$|$ݡ 0$D$á DŽ$DŽ$DŽ$DŽ$$$$0$$xL$GD$ L$$$fd$D$G$D$D$ D$}D$L$$$0$$D$ѮD$ L$ $D$ݠ DŽ$DŽ$DŽ$DŽ$$$$0$$xL$aD$ L$$$_1$D$;$D$D$ D$|D$L$$$0$$D$D$ L$ $D$ DŽ$DŽ$DŽ$DŽ$$$$0$$xL${D$ L$$$.$D$%$D$D$ D${D$L$$$0$$D$D$ L$ $D$ DŽ$DŽ$ DŽ$DŽ$$$$ 0$$xL$蕬D$ L$$$ $D$6$D$D$ D${D$L$$$0$$D$D$ L$ $D$+ te ;a"4D$8ʁyX݃IÇށ<! ˄,Hɚ;5wÅ҇Ç!ޅÇ ~`D$,D$0 L$,D$0!$D$5D$,D$D$ D$tzD$L$L$C $ЋD$L$T$ D$4L$$T$,A$ЋD$,D$$D$$D$x|$P1L$tQT$$\$4\$t$ L$L$#|$P(|$8t$PL$# D$@L$<T$8\$t9tf$p|$Ge u6eXD$xD$|p$$hÍeXʼnL$xD$|DŽ$DŽ$dhËD$tH L$HT$L\$D$L$T$D$ AD$L$T$\$D$D$L$ $T$$T$D$(D$ L$T$tHu({d {d D$LD$PD$TL$XDÉD$(D$HPT$$$ыD$$D$$D$$D$薌D$L$ T$$L$D$FD$D$0L$L$ T$ T$,$D$L${D$ L$@( $ЋD$L$$L$.D$L$ T$\$,$l$0l$t$ t$T$ L$D$JjD$(HD$,$L$0L$T$ T$NFD$L$T$ \$(k[ 5&9$D$L$\$ \$-nD$,$D$0D$D$ D$!QD$ L$D$LL$PD$TD$XDËD$,$L$0L$T$ T$ED$L$T$ \$(k[ 5d t-d 5e uUd l$4\$8l$4t7u u΀$D$L$l$ \$t$h111׍=d Ɖ 111뼋D$(H @D$LL$PD$TD$XDD$LD$PL$TT$XD11{d {d D$LD$PL$TD$XDÉ,$t$'D$݆ ae ;aPD$`H PT$HL$LL$HT$,L$؋Z9~r r9 +M9 LL$` эU9 \$xT$`\\$` ӋT$` ʍM9_ L$xL   Չ1ϋL$d1wT$($1 `& $T$HT$nL$T$ $$ `3 $T$dT$T$4T$nL$ T$$$ `3 $L$(L$D$nL$ T$$$ ^ $D$$L$D$ D$(=ODŽ$DŽ$DŽ$DŽ$`&$L$HL$mD$ L$$$`3$L$dL$L$4L$mD$ L$$$gn$D$$L$D$ D$fZtqu+FALSu]kEu+Falsu:ke+falskevӃ밉$T$PD$D$ D$T$ D$P$\$(|$L D$P$T$ \$(|$L.$T$OD$D$ D$T$ D$P$\$(|$LD$P$T$ \$(|$L$@($ $ЋD$L$@P $ЋD$D$TD$X V $D$ ^D$ L$L$TD$XT$D$D$TD$D$ D$.D$L$DŽ$Ƅ$$$Ë$HÍګ$|$.觰e ;av-c$D$D$%D$ L$L$D$\e ;av8e ;avBD$L$1B9s*ÀuB\$ )Ӊ!؉D$)щL$l$+ ׯe D$;A$HއDD9,$'\$Tګ$EoD$D$P$ $$L$$L$ cL$ D$ wD$L$D$PHL$DD$h1\$@SD$hL$D9lT$@ \$,il$(IL$L$ މt$蠠D$ D$0L$L$\T$T$4$1  $l$Tl$t$,t$ t$ D$$|$l$$L$|T$x\$09)؉D$$!ЉD$H$)ىL$ L$l$hD$L$ 9)T$$)‰!ЋT$HЋT$(, l$<99zD$d $L$LL$T$D$e ;avD$ $׿D$D$e ;avD$ $D$D$辨e ;avD$ $O׿D$D$~e ;avD$ $D$D$G>e ;avD$ $ֿD$D$e ;avD$ $D$D$辧e ;avD$ $OֿD$D$~e ;avD$ $D$D$G>e ;a ,$\$ۺD$D$ ѿD$D$0L$@\$8l$Dt$p|$4D$0L$@\$8l$Dt$p|$4`V׉nD$0|$4D$tD$\D$xD$`D$dD$h0$D$\D$;-D$L$ D$dL$h|ud 0  $D$D$D$ "D$dD$D$D$Yl         se ;aIDD$LHPT$P$ыD$L$HQH~ QTt QUt QVt nD$LHPT$P$ыD$4L$LT$HJl e D$PBpo$%Se L$QD$HHtHlPpIL$ыD$L$ $D$jbD$ D$@L$L$0T$TZj,$\$/F\$D$ RQD$HHtT$\$ $L$0L$L$@L$ 墺L$ D$\$T$D$L$XL$ o$RRe L$iD$HHxHlPpI($ыD$D$$L$L$4PP $ҋD$D$$L$4D$$L$4T$HZxjHrDkH-e sDBxJUHUBxJTHTBxJVHVD$TH@$L$;FD$D$ /PD$HHxT$\$ $L$$L$L$4L$ <L$ D$\$T$D$L$XL$ D$H$D$XD$DÍ{D躨@D$$HPT$4$ыD$D$$$D$4D$d`L$ D$T$HzxiT$HztTzpD$PAiVD$LH(T$P$ыD$L$@P $ЋD$)D$L@(L$P $ЋD$L$T$HJX e uB\z\ͧt;L$LT$HJX e u D$PB\z\D$P荧D$L@(L$P $ЋD$D$,L$L$$HXd$L,$ӋD$L$P9`³$ID$$$HQ,\$P\$$L,$ҋe _$$ro$6ID$D$h$QT$H\$xiq4$l$-fl$D$ G$HP\$l$D$t$h4$L$T$L$xL$ L$HL$l$\$D$ L$H@$L$iD$D$ !GD$L$twT$hB e uVJ\$dk3\$> ً\$P9-e t6Qe $ D$dH HL$`$11CD$d9\$T4t$l~}|1uF(tjED$@N$L$L$dQ$\$LD$dH T$lZ RT$\$ $L$QD$\$TL$`$l$@f땉l$\$D$D$QĿD$ L$`$\$Tl$\t$lGh $PDËT$dz 葝B $ЋD$D$DL$L$pPe $4T$dJ01 L$LAD$L$HQd$L$ҋD$L$L9$HP,L$$L$ҍ$$~$$@P $ЋD$uD$tPI$$l$\$$D$ OD$LL$tAA T$dZ0h @D$l$ `$\$訕|$e L$tL$`AT$dL$D9wD$`\$p,Ëumd t-d e 5d $$$kD$?|$? ù$t$l$; D$$L$ L$Xo$CD$D$|  $CD$D$tL$Xe $P\$|X A($ЋD$@,L$D$ $Ѝ$$袠D$tx $$O e uk$$ $D$fD$D$ AD$tH T$\$ $\$T$1WD$t蕚BL$t耚뎍x‹$mz ËD$|_111=d >D$`<111mT$dz0{$ %D$d$PD+ $ Me ;a4TD$,D$0 $ |pd L$L$`L$T$dT$ 2D$wL$XdQT$4D$\D$8T$48ɍ#i 5d t-d 5e d l$,D$0l$,u u΀ljT$$\$t$$T$D$L$ T$$L$D$D$L$ ׫$L$D$T D$ D$ L$L$( $|pd T$T$`T$\$d\$ |D$L$  e uaL$(HD$D$D$D$L$,e uUT$0PL$T$$hpd D$D$D$7R|$ e u D$rD$cxD$0U}e ;avVD$L$tI $D$D$D$D$ L$t$L$D$D$ D$ S}e ;a,D$DL$@tI $D$D$0D$D$ L$DtY$D$4D$D$8D$D$A=ඪ9-\c 9D$@t$$ʼnȋL$X$H$L$.CD$ L$$$$ pd L$$L$UBD$ @T$|Z RT$\$$L$D$D$ D$yD$ D$+zigzkag64Ӊ$T$gD$D$ sD$T$(D$$L$,\$0D$$L$,T$(\$0_$T$ۺD$D$  D$D$$L$,T$(\$0D$$L$,T$(\$0  $D$D$\$ T$\D$L$D$4L$80$D$4D${D$L$ $L$ 0$D$m   Ue D$;A$$$H $ BBB$D$|D$L$ e $BJe $J$H$L$$$Z\$xRT$X1t$dn$$T$X\$x$9l$d$@$$$ D$lL$Ti@T$\$$D$ yD$TH(T$l$ыD$@,L$D$ $Ѝ$$!q$$ $D$fD$D$ gD$L$$L$ D$D$ QHD$L$T$D$HL$hT$LA Q$D$D$L$ fD$PL$hQ$+byteksT$D$$$D$L$D$HD$ D$LD$fD$D$D$pL$L$tT$TR(\$l$ҋD$L$$$D$P L$`T$@!؅ɇÇ D$<  $VD$@L$D ȋL$$D$`1 ЉAD$&|$ e u$$diy D$pViyD$tJi듁@! t % ! t  ! t !ÃÇ ݕt !ÁÇ t !ÁÇ ݕt t!ÁÇ ݕt J!Á ؄t & uQ+grouuBkpu C+varikfnt1у̃룉\$|T$\}uu-+fixeudkfd3uTk2u y+fixekkfd6\k4M뿃tNu+zigzu:kag32B+zigzkag64Ӊ$T$gD$D$ D$T$\D$PL$h\$|D$PL$hT$\\$|_$T$ۺD$D$ 請D$D$PL$hT$\\$|vD$PL$hT$\\$|11MË$z$(f$zfzfj$D$D$\$ T$]TD$L$$$0$$D$D$L$ $L$ 0$D$  MMe ;aD$@ L$D$ \$ ÉY ӋT$ ډQ=Ç!ՅۇÇ t A =@Ç! t= Ç! t=Ç! t륃…!ƒÇ t끁!Ç t Y!Ç t 1!Ç t  ! „t BL]e ;a D$(HPIP$ыD$twD$$@D$(H@$L$D$,D$D$0D$ D$4D$fD$D$$ e T$\$u XP Íx cybD$$@L$( $D$L$e uT$$BJ ËT$$zbzb,Ke ;a#|$#$L$4PT$,$kP$4$ՋD$&!$$1҉$$T$XP $ӋD$D$0 $$$$$$11D$!1D$1D$%1D$#1D$$AF$$L$ L$D$%D$#T$$D$0$$$9h"LQ(packhfedrprotdXfo3UL$8t$(\$ D$"D$! 1Yl$% *stdtjfimje t5T$$Y uwktpuIftru D$'D$&$27D$\$赆D$ tD$'L$8l$&t$(|$"D$'L$8l$&t$(|$"T$$hl$#T${1D$D$ ID$ L$8\$ l$!t$(|$"\$l$!q\$$t$%t$#umD$t2$L$D$$# D$L$$$|É$L$D$$D$L$$$|D$t2$L$rD$$D$L$$$|É$L$@D$$tD$L$$$|t$$umD$t2$L$D$$!D$L$$$|É$L$D$$c D$L$$$|D$t2$L$D$$ D$L$$$|É$L$RD$$FD$L$$$|× BP $ЋD$ D$0D$t@$$$D$D$$/{D$L$$$|Ë$$$D$D$$yD$L$$$|D$t@$$$D$BD$$yD$L$$$|Ë$$$D$D$$VxD$L$$$|ÃD$0D$t@$$$D$D$$qD$L$$$|Ë$$$D$cD$$goD$L$$$|D$t@$$$D$D$$oD$L$$$|Ë$$$D$D$$.nD$L$$$|Ë \e 9D$0D$t@$$$D$vD$$ځD$L$$$|Ë$$$D$6D$$:D$L$$$|D$t@$$$D$D$$血D$L$$$|Ë$$$D$D$$D$L$$$|Ë$@D$0D$t@$$$D$7D$$eD$L$$$|Ë$$$D$D$$cD$L$$$|D$t@$$$D$D$$bdD$L$$$|Ë$$$D$nD$$bD$L$$$|à D$0D$t@$$$D$D$$qD$L$$$|Ë$$$D$D$$SpD$L$$$|D$t@$$$D$D$$pD$L$$$|Ë$$$D$FD$$oD$L$$$|à P D$0D$t@$$$D$D$$gD$L$$$|Ë$$$D$D$$"fD$L$$$|D$t@$$$D$UD$$fD$L$$$|Ë$$$D$D$$dD$L$$$|à 2D$0D$t@$$$D$趿D$$]D$L$$$|Ë$$$D$vD$$[D$L$$$|D$t@$$$D$-D$$a\D$L$$$|Ë$$$D$D$$ZD$L$$$|ÃD$0D$t@$$$D$莾D$$WD$L$$$|Ë$$$D$ND$$RVD$L$$$|D$t@$$$D$D$$VD$L$$$|Ë$$$D$ŽD$$UD$L$$$|ÃD$0D$t@$$$D$fD$$JvD$L$$$|Ë$$$D$&D$$tD$L$$$|D$t@$$$D$ݼD$$uD$L$$$|Ë$$$D$蝼D$$qsD$L$$$|Õ$BP $ЋD$  D$0D$tED$!tG$E$|ÍG$E$|$t G$E$|Í$G$E$|ÍG$E$|ÃD$,L$4variQfntD$0D$tED$!tG$F$|ÍG$F$|$tG$F$|ÍG$F$|ÍG$F$|ÃfixeQfd3Q2D$0D$tED$!t`G$F$|ÍhG$$F$|$tlG$(F$|ÍpG$,F$|ÍdG$ F$|ÃzigzQag32D$0D$tED$!tH$F$|ÍH$F$|$tH$F$|Í H$F$|ÍH$F$|ÉL$TD$X$<@4L$4D$,L$4΃D$,L$4variQfntD$0D$tED$!tG$F$|ÍH$F$|$tH$F$|Í H$F$|ÍH$F$|ÃfixeQfd6Q4D$0D$tED$!ttG$0F$|Í|G$8F$|$tG$D$$bD$L$$$|Ë$@l$1$@($ $ЋT$L$D$0#$H($$ыD$L$@P $ЋD$$@($ $ЋD$L$D$lD$pD$tD$xD$l$D$p0$L$TL$D$ L$L$tD$x$D$3D$lD$D$ D$ D$L$L$LD$P0$D$LD$'D$ L$ $D$3 D$dD$hD$d$D$ho$D$D$dD$D$ D$脏D$L$L$\D$`0$D$\D$D$ L$ $D$課 D$DD$HD$D$D$HY$D$DD$DD$D$ D$D$L$D$v4$!ȅÇ t뵁@! t띁 ! t녁! t j$Ç!Ç t <=!=Ç t =!=Ç t =!=Ç t =!= t l$ Xe ;a D$ @L$11 Bˋl$9,ыum,$Ç߅!υÇ t뷁@Ç! t뙁 Ç! t xÇ! t W $Ç݅Ç!Ç t #Ç!Ç t Ç!Ç t Ç!Ç t Ç! ͕t o e=!ʅۇÇ tȋL$ȉD$=@! t= ! t=! t뫃!уÇ t뇁!сÇ t _!сÇ t 7!сÇ t !с фt D$e ;a2D$@!ӅÇ tL$ȉD$ Á@! t݁ ! tŁ! t뭃…!ʃ ڄt=!= ڄt k=!= ڄt I=!= ڄt '=!= „t  e ;aJD$@…!ӄ$!ӅÇ tL$ȉD$ Á@! t݁ ! tŁ! t뭃…!ʃ ӄt=!= ӄt k=!= ӄt I=!= ӄt '=!= Єt  D$ e ;aED$.@!ӅÇ tL$ȉD$ Á@! t݁ ! tŁ! t뭃…!ʃ ڄt=!= ڄt k=!= ڄt I=!= ڄt '=!= „t  D$ e ;a D$L$@$T$11C44$|$9J4ً>vt$!ȅÇ t뵁@! t띁 ! t녁! t jD$Ç!Ç t ;=!=Ç t =!=Ç t =!=Ç t =!= t l$ Xe ;a D$ @L$11 Bˋl$9,ыum,$Ç߅!υÇ t뷁@Ç! t뙁 Ç! t xÇ! t W $Ç݅Ç!Ç t #Ç!Ç t Ç!Ç t Ç!Ç t Ç! ͕t o e=!ʅۇÇ tȋL$ȉD$=@! t= ! t=! t뫃!уÇ t뇁!сÇ t _!сÇ t 7!сÇ t !с фt D$e ;aD$1=tL$ȉD$ =@t= t=t본ttttt | r/e ;aD$1=tL$ȉD$ =@t= t=t본ttttt | rD$ e ;aD$1=tL$ȉD$ =@t= t=t본ttttt | rD$ e ;aD$HT$11C941Ç߃tʁ@Ç߃t뭁 Ç߃t됁Çރt pt [t Ot Ct 7t + !l$ e ;aAD$H'11B9,1Çރt́@Çރt믁 Çރt뒁Ç݃t rt ]t Qt Et 9t - #=!ʅۇÇ tȋL$ȉD$ =@! t= ! t=! t뮃!уÇ t늁!сÇ t b!сÇ t :!сÇ t !с фt D$ te ;aND$H 11Ӆ!…ɇÇ tL$ȉD$ Á@! t݁ ! tŁ! t뭃!Ѓ ؄t덁!Ё ؄t i!Ё ؄t E!Ё ؄t !!Ё Ȅt e ;akD$H…!ڄE 11Ӆ!…ɇÇ tL$ȉD$ Á@! t݁ ! tŁ! t뭃!Ѓ Ät덁!Ё Ät i!Ё Ät E!Ё Ät !!Ё t D$ jue ;aYD$B@ 11Ӆ!ʅÇ tL$ȉD$ Á@! t݁ ! tŁ! t뭃!у لt=!= لt k=!= لt I=!= لt '=!= t  D$ e ;aD$HL$ D$T$11C4t$ |$9n4؋>|$vt$ |$D$1Ɖ4$1Dž!Ç t땁@! t z ! t _! t D$Ç!Ç t =!=Ç t =!=Ç t =!=Ç t =!= t xl$ 2e ;a! D$HD$11 BËl$9,Ћut$m t$1,$1Ç߅!DžÇ t띁@Ç! t | Ç! t [Ç! t :$Ç݅Ç!Ç t =Ç!=Ç t =Ç!=Ç t =Ç!=Ç t =Ç!= ŕt Z P=!ʅۇÇ tȋL$ȉD$ =@! t= ! t=! t뫃!уÇ t뇁!сÇ t _!сÇ t 7!сÇ t !с фt D$ e ;av D$@D$ e ;avD$t D$@D$ D$ [e ;avD$t D$@D$ D$ e ;avD$@L$AȉL$ e ;aXD$@@!ӅÇ tȋL$ȉD$ Á@! tہ ! tÁ! t뫃…!ڃÇ t=!=Ç t a=!=Ç t ;=!=Ç t =!= „t D$ me ;aGD$@!ӅÇ tȋL$ȉD$ Á@! tہ ! tÁ! t뫃…!ڃÇ t=!=Ç t a=!=Ç t ;=!=Ç t =!= „t e ;aXD$@@!ӅÇ tȋL$ȉD$ Á@! tہ ! tÁ! t뫃…!ڃÇ t=!=Ç t a=!=Ç t ;=!=Ç t =!= „t D$ }e ;aZD$C@!ӅÇ tȋL$ȉD$ Á@! tہ ! tÁ! t뫃…!ڃÇ t=!=Ç t a=!=Ç t ;=!=Ç t =!= „t D$ e ;aD$L$ @$T$11C484$|$ 9i4ًvt$!ȅÇ t밁@! t똁 ! t뀁! t el$D$Ç!Ç tl$.=!=Ç tl$=!=Ç tl$=!=Ç tl$=!= tl$ l$ |l$,7e ;a^D$HD=!ӅɇÇ tȋL$ȉD$ =@! t= ! t=! t뮃…!ڃÇ t늁!ځÇ t b!ځÇ t :!ځÇ t !ځ ʄt D$ e ;aXD$@@!ӅÇ tȋL$ȉD$ Á@! tہ ! tÁ! t뫃…!ڃÇ t=!=Ç t a=!=Ç t ;=!=Ç t =!= „t D$ -e ;aGD$@!ӅÇ tȋL$ȉD$ Á@! tہ ! tÁ! t뫃…!ڃÇ t=!=Ç t a=!=Ç t ;=!=Ç t =!= „t e ;aD$H $T$11t$ ˉŋ $D$ pt$!Ç tK$9|D$Á@! tЁ ! t븁! t렉l$D$Ç!Ç tl$i=!=Ç tl$?=!=Ç tl$=!=Ç tl$=!= tl$ l$ 1+e ;a 0D$DT$@!˅Ç tbD$8H\$<9l$4Tl$HL$L\$P0Í3$T$4T$D$\$ L$跫l$D$\$HD$8T$@뱁@! t}L$8Y ЋT$<9!t$4̀DىjD$,3$D$4D$L$T$ \$-t$D$T$XD$,L$8l$@렁 ! L$8Y Љ l$<9-|$4ʀ DDىD$,t$(3$D$4D$L$l$ \$|$D$l$XD$,L$8T$@t$(댁! L$8Y Љ  ׋T$<9DT$<̀T$4  D ΀D D ىՋ\$ |$8D |$4D D |$$| |$ |$4D |$0D D |$8| |$|$ \|$8DD|$$||$D$L$T$D$HL$LT$PD$TD$X(ݓHe ;a(D$8H…!ڄt,D$,D$HD$0D$LD$4D$PD$TD$X(ÉL$$D$ D$,$D$0D$D$4D$D$UD$L$T$YL$,贀e ;a D$0D$$$D$(D$D$,D$D$4D$ D$8D$|D$L$T$X9$L$@\$DT$HD$LD$P ÉD$(-3,$L$D$T$ \$cTL$D$T$XD$(륋D$$D$@D$(D$DD$,D$HD$LD$P e ;a&$D$4D$ D$($D$,D$D$0D$D$8D$ D$CT$D$L$,\$$l$D본3t$\c l$\|$`t$d L$hD$l<Él$\|$`t$dD$hD$l<1 Zne ;aV,D$D$T$L$$\$ l$4k je ;au8D$HHLL$$1ҋ\$Dl$@t$<|$4 ‹\$Dl$@t$Ӊ$\$gD$D$  D$!\$P$$$$$$\$PM$\$ۺD$D$ 襔D$$$$\$P$$$\$Po$D$D$\$ l$]D$L$$$0$$D$D$ L$ $D$  $D$D$T$ \$]D$L$$$0$$D$zD$ L$ $D$  V#e ;aD$HL$ @D$9$gD$D$ GL$He uuT$ P\$X 9$*D$ GL$H e uL$ HL$H L$L$ D$$ÍxD$ my D$umҍx‹D$ cmz D$WmzUe ;a$sHTPL$D$T$J$э|$P1m$D$D$D$PD$01D$ L$P $a3D$ D$ L$Pt$T|$8drL$P|$ t$8QrL$$tL$ uL$0뤋$$L$ L$ND$D$ ' $D$L$$T$( e u4 e ;a<K$D$@D$L$DL$ҾD$L$T$ T$D$@D$L$DL$ҾD$L$ T$D$@ $wD$D$8$L$@L$T$DT$践D$ 3 $D$D$ID$ L$T$\$8$D$L$T$ D$@D$D$DD$D$еD$L$ T$$\$(l$,D$HL$LT$P\$Tl$X<Ë{d {d D$HD$LD$PD$TL$X<ËI$ыD$L$ T$\$l$l$HD$LL$PT$T\$X<ÉL$4T$0B $ЋD$ 3 $D$D$RD$L$ T$\$0[L$T$D$ D$D$4$ӋD$$L$ T$\$l$l$H\$LT$PL$TD$X<2e ;amhD$lHK$D$pD$L$tL$iоD$L$ T$L$0T$HA$ЋD$L$lQЋY9qD$0@QY)qD$l$\$T$ T$H$ЋD$$L$ T$\$l$|$l_We u/L$xD$|hɉH9 3 $D$D$D$L$lQ\$Dl$t$ 99w^?97l$@t$X$|$T$PD$D|$lGD$@Ge u D$XD$XGT$@|$TD$< 3 $t$D$l$ \$l$t$D$D$`D$D$ D$薔D$L$L$xD$|hM F ? h,se ;a &$D$D$ @G e uTL$H&$D$ G e uL$HL$L$D$ ÍxD$OCލxD$?C+Se ;a &$iD$D$ G e uTL$H&$:D$ G e uL$HL$L$D$ ÍxD$BލxD$B+Se ;a &$D$D$ G e uTL$H&$D$ G e uL$HL$L$D$ ÍxD$AލxD$AX*Se ;a &$ D$D$ pG e uTL$H&$D$ @G e uL$HL$L$D$ ÍxD$?AލxD$/A)Se ;a &$YD$D$ @G e uTL$H&$*D$ `G e uL$HL$L$D$ ÍxD$@ލxD$@(Se ;a &$D$D$ G e uTL$H&$zD$ G e uL$HL$L$D$ ÍxD$?ލxD$?H(Se ;a &$D$D$ G e uTL$H&$D$ pG e uL$HL$L$D$ ÍxD$/?ލxD$?'Se ;a &$ID$D$ G e uTL$H&$D$ G e uL$HL$L$D$ ÍxD$>ލxD$o>&Se ;a &$D$D$ G e uTL$H&$jD$ G e uL$HL$L$D$ ÍxD$=ލxD$=8&Se ;a &$D$D$ 0G e uTL$H&$D$ G e uL$HL$L$D$ ÍxD$=ލxD$=%Se ;a &$9D$D$ H e uTL$H&$ D$ H e uL$HL$L$D$ ÍxD$o<ލxD$_<$Se ;a &$D$D$ H e uTL$H&$ZD$ H e uL$HL$L$D$ ÍxD$;ލxD$;($Se ;aD$D$D$ D$${D$tL$(T$0$L$T$ËD$$L$(t@D$L$D$t@ I($ыD$L$$L$0D$D$ L$ $D$x{D$ 11W#2e ;a$D$0e $he D$$WD$葢D$(D$L$,L$  $lpd \$\$\$D$ tD$0$Í$D$D$L$(e uRT$,PL$T$ $lpd D$D$D$|$ e uD$녋D$9xD$,9륐s$"e ;apD$xL$|D$tH $>PD$|D$tHX~uL$D$\$$L$UD$ L$ $D$qD$L$ T$$L$D$D$ D$3`D$L$T$$k< $T$D$D$ D$D$*D$L$AQ $T$D$$$= `³$$D$$L${ 111@=d p111%*vÐvÉ $T$'D$ yj D$\@`$ $ЋD$L$$lT$D$6L$ D$fD$L$$4$80$$4D$džD$ L$ $D$x j $H @D$ L$$D$D$#D$L$$<$@0$$<D$HD$ L$ $D$Tx mi fi _j Xj $H @D$ L$$D$D$#SD$L$$D$H0$$DD$贅D$L$ $L$w D$\@`$ $ЋD$L$$$l5 $t$$x$H$$$$D$L$$$lD$D$D$ [D$L$$L$P0$$LD$̄D$ L$ $D$v CK@` $ЋD$L$$[ T$D$#L$ D$D$L$$T$X0$$TD$KD$ L$ $D$Wv CK@` $ЋD$L$$T$D$+L$ D$iD$L$$\$`0$$\D$ʃD$ L$ $D$u EM@` $ЋD$L$$t2T$D$%L$ D$D$L$$d$h0$$dD$ID$ L$ $D$Uu e ;a8|$ 1L$DL$ L$HL$$L$LL$(L$PL$,L$TL$0L$XL$4L$<YRd$ҋL$T$@D$<L$@ʋHXh9֍U9FUPTm<ы e u 5P.뼍 $|$P.D$D$<뚍 $L$l$\$ T$D$L$T$\$D$4D$!tDH$ĸÍHH$ĸÃD$ tND$4t1D$!tH$ĸÍH$ĸÍH$ĸËD$4t1D$!tH$ĸÍH$ĸÍH$ĸÃD$4D$0}L$XbytecQsD$!tH$$$D$D$$D$TD$D$,D$w~D$ $ĸË$$$D$KD$$D$TD$D$,D$}D$ $ĸÃgrouQpD$!tH$$$D$D$$D$TD$D$,D$~D$ $ĸË$$$D$D$$D$TD$D$,D$~D$ $ĸÃ>L$X5D$0L$XbyteNQsAD$!tH$$$D$D$$D$TD$D$,D$4D$ $ĸË$$$D$D$$D$TD$D$,D$\D$ $ĸËL$XAP$ЋD$$$A\$!7AP$ЋD$ ?D$4D$!tH$$$D$D$$D$TD$D$,D$|D$ $ĸË$$$D$D$$D$TD$D$,D$ D$ $ĸD$!tH$$$D$_D$$D$TD$D$,D$SD$ $ĸË$$$D$D$$D$TD$D$,D$ D$ $ĸÃ?D$4D$!tH$$$D$D$$D$TD$D$,D$4D$ $ĸË$$$D$hD$$D$TD$D$,D$|D$ $ĸD$!tH$$$D$D$$D$TD$D$,D$ D$ $ĸË$$$D$D$$D$TD$D$,D$sD$ $ĸË \e 9?D$4D$!tH$$$D$cD$$D$TD$D$,D$D$ $ĸË$$$D$D$$D$TD$D$,D$/D$ $ĸD$!tH$$$D$D$$D$TD$D$,D$D$ $ĸË$$$D$D$$D$TD$D$,D$&D$ $ĸË$ @ ?D$4D$!tH$$$D$D$$D$TD$D$,D$D$ $ĸË$$$D$D$$D$TD$D$,D$D$ $ĸD$!tH$$$D$kD$$D$TD$D$,D$_D$ $ĸË$$$D$#D$$D$TD$D$,D$D$ $ĸà KD$4D$!tH$$$D$D$$D$TD$D$,D$D$ $ĸË$$$D$tD$$D$TD$D$,D$D$ $ĸD$!tH$$$D$#D$$D$TD$D$,D$D$ $ĸË$$$D$D$$D$TD$D$,D$D$ $ĸà  ?D$4D$!tH$$$D$kD$$D$TD$D$,D$oD$ $ĸË$$$D$#D$$D$TD$D$,D$D$ $ĸD$!tH$$$D$D$$D$TD$D$,D$FD$ $ĸË$$$D$D$$D$TD$D$,D$D$ $ĸà D$4D$!tH$$$D$#D$$D$TD$D$,D$'D$ $ĸË$$$D$ۿD$$D$TD$D$,D$oD$ $ĸD$!tH$$$D$芿D$$D$TD$D$,D$D$ $ĸË$$$D$BD$$D$TD$D$,D$fD$ $ĸÃ?D$4D$!tH$$$D$۾D$$D$TD$D$,D$_D$ $ĸË$$$D$蓾D$$D$TD$D$,D$D$ $ĸD$!tH$$$D$BD$$D$TD$D$,D$6D$ $ĸË$$$D$D$$D$TD$D$,D$D$ $ĸÃ"D$4D$!tH$$$D$蓽D$$D$TD$D$,D$D$ $ĸË$$$D$KD$$D$TD$D$,D$D$ $ĸD$!tH$$$D$D$$D$TD$D$,D$nD$ $ĸË$$$D$貼D$$D$TD$D$,D$D$ $ĸÉ $T$XD$L$ @@|d |d T$\$ $D$ D$!D$4uH$$$D$D$$D$TD$D$,D$ۅD$ $ĸË$$$D$ϻD$$D$TD$D$,D$sD$ $ĸË$$$D$臻D$$D$TD$D$,D$軅D$ $ĸË$@$@($ $ЋT$L$D$4$H($$ыD$L$@P $ЋD$1$@($ $ЋD$L$DŽ$DŽ$DŽ$DŽ$$$$0$L$xL$ybD$ L$$$$D$)$D$D$ D$0D$L$L$pD$t0$D$pD$ bD$ L$ $D$T $@`$ $ЋD$L$$T$D$L$ D$"D$L$$$0$$D$aD$ L$ $D$S $@`$ $ЋD$L$$0üT$D$L$ D$D$L$$$0$$D$`D$ L$ $D$S $@`$ $ЋD$L$$ xT$D$)L$ D$D$L$$$0$$D$q`D$ L$ $D$}R DŽ$DŽ$$$$o$D$$D$D$ D$.D$L$$$0$$D$_D$ L$ $D$Q D$hD$lD$h$D$lY$D$DD$hD$D$ D$-.D$L$D$`L$d0$D$`D$G_D$L$ $L$SQ lC eC ^B e ;aD$,D$$L$ L$T$$T$o{D$L$ T$tM\$ 9l$(MUL$$)!l$L$0)É\$4T$8D$<D$@Ëȍd ̍d D$0D$4D$8D$D$<$L$@L$T$DT$xD$L$T$ \$@9)ˉ\$@l$D)͉l$Dۇ!l$<L$D$@$L$DL$T$HT$6kD$L$T$ \$D9)ˉ\$Dl$H)͉l$Hۇ!l$@L$@l$L}u]N9:NM AD$@D$TD$DD$XD$HD$\D$`D$d<ÉD$(T$ `3$|$t$\$ L$轉D$L$T$|$LWe uT$ ΉNjD$(nȍd ̍d D$TD$XD$\D$`L$d<Ë|d |d T$@T$TT$DT$XT$HT$\L$`D$d<ËD$@$L$DL$T$HT$iD$L$ T$\$D9T)Ël$H)ʼnۇ!l$@D$@9ڇÇ9!9 9)͉)Ήۇ!΋\$@ޅl$0T$4t$8&z}<ӉOT$4l$0t$8L$DD$H\$@L$DD$H\$@$L$D$hD$ L$T$\$D9S)Ӊ\$Dl$H)Չl$Hۇ!l$@T$@l$L}U]r9YD$$L$,`3$\$T$|$ t$虇D$L$T$|$LWe uʉËD$$L$,r̍d ȍd D$TD$XD$\L$`D$d<Ét$Tl$XT$\D$`D$d<Ë̍d ȍd D$TD$XD$\L$`D$d<Ëȍd ̍d D$TD$XD$\D$`L$d< / / . . . e ;aD$,D$$L$ L$T$$T$fD$L$ tIT$ 9\$( L$$)!l$L$0)‰T$4\$8D$<D$@Ë̍d ȍd D$0D$4D$8L$cD$L$ T$\$@9B)Ël$D)ʼnۇ!l$<D$<9ڇÇ9!9 9)͉)Ήۇ!΋\$<ޅl$(T$0t$4G{T$0t$4\$69.t$D$$L$$D$L$t$ +wD$L$|$0O e uID$L$(9T$)‰!‹l$$T$8)L$<\$@D$DD$H ĆD$L$(9벋̍d ȍd D$8D$<D$@L$DD$H Ëȍd ̍d D$8D$<D$@D$DL$H Ë|d |d T$$T$8T$(T$e ;a0D$DsD$4$L$8L$T$D$L$ T$\$89|)É\$8l$<)ʼnۇ!l$49ڇÇ9Ç!9 &9t$(D$4L$ $D$L$t$ jD$L$T$@jr}9urT<e  $D$QD$tGD$ L$89T$()‰!‹l$4T$H)L$L\$PD$TD$X0ËD$ L$89A\c \$()É!Ët$4\$H)L$Ll$PD$TT$X0ɉyID$$L$,0$\$l$t$ |$6D$L$T$|$@We u͉ËD$$L$,y̍d ȍd D$HD$LD$PL$TD$X0Ë̍d ȍd D$HD$LD$PL$TD$X0Ë|d |d T$4T$HT$8T$LT$H e u9L$ HL$H e uL$HD$ÍxD$rqxD$ `qYre D$;AS$HL$4PT$tYL$ӋD$D$|L$L$D$ L$T$\$d$D$L$T$ :D$L$D$PD$D$4D$论D$ D$8L$L$ $L$D$D$d$L$8L$L$ L$I&D$dH[$D$D$ >D$ L$T$\$d$D$L$T$ D$H$D$DD$D$0D$ˇD$L$T$ \$`$\$d\$T$D$ L$_D$L$D$dHt[$D$D$e=D$ L$T$\$d$D$L$T$ D$tD$xD$|\ËI$ L$D$=D$ L$T$\$d$D$L$T$ D$tD$xL$|\$D$D$D$ L$uK$d$D$ kD$L$ uD$`@L$L96z$t$x\É$t$x\É$t$x\É$t$x\É$D$ D$ L$u $d$t$x\É$t$x\ÍPw=-t$ƒ$D$h^$/|$Ge u ͻVͻ;F$t$x\É$t$x\É$D$ D$L$ u $d$t$x\É$t$x\É$D$ D$L$ u $dS$t$x\É$t$x\É$D$ HD$L$ u $d$t$x\É$t$x\1\$PCL$h$D$P$$T$L$uD$ L$P9$d$$L$D$L$ N$dH $$$L$T$hT$\$P\$ |D$L$T$Ãuhy$h0$`,$$dt$T$L$ \$D$.D$L$u9$d$D$ D$L$ $t$x\É$t$x\Ë$`,$$dt$T$L$ \$D$0D$L$x$t$x\Àt|$ɺD$D$)D$L$ T$$d$L$T$D$ \D$L$$t$x\É낉D$h^$|$Ge u ͻͻ8$D$ rD$L$ $t$x\É$t$x\Ë$6$:$*Ã$t$à $^$߽|$Ge u ͻͻ7$ L$D$q]T$ D$xL$D$ٻT$L$I]D$ mD$xL$DL$p$h $$lL$D$ORD$L$T$ T$|D$H$$L$D$|D$L$ $D$ D$tDŽ$tDŽ$x\Ë$`$$dD$D$|D$$D$ D$HD$vD$L$t$t$x\Ë$h $$lT$D$7D$L$ $D$cD$D$hL$ $T$$$L$D$pD$L$T$ $D$L$$hD$ $lD$$pD$H$D$h$$h$$lL$$pT$D$ u $`0$`$$dL$$hT$$l\$ $pl$|D$L$T$$t$x\ËD$hG E$|$艧 D$hG E$|$n D$hG E$|$S D$dG E$|$8 D$hG E$|$ $T$'D$腱  Ge $x;A $$$D$$D$HD$$L$L$@T$ $$ t2kH kPd kT kU̓ YZ f.5lc =hc -pc K[ grouKp{}\$+$$L$D$ L$L$HAL$@$$L$,$$$T$L$xD$L$  $L$D$聺D$L$ T$D$,$$$ $$\$T$D$ L$D$L$ue$$$$D$+D$D$ L$uDŽ$$DŽ$(É$$$(É$$$(Ë$$$D$L$2lL$D$T$ %I$ыD$L$u4$$D$L$$$$$(É$$$(Ë$$$D$L$<$L$\$ $$D$ D$ L$u $$$$(É$$$(ù<>i<>Z<>K<><$D$D$@D$&vD$L$ DŽ$DŽ$$$$$D$$D$D$ D$vD$L$$$$(É$D$D$@D$蕜D$ L$$$D$L$VD$L$ $$$(É$D$D$@D$MKD$L$ T$\$T$L$T$D$ D$L$D$L$$$D$L$ #$$$(Ë$$|$t$l$ *D$L$$$$( f.v%5Lc =Pc -Hc D$LŋD$L f.u{'5@c =$D$L$sD$L$ y9HOD$8$L$D$ʚ;D$ D$D$0ʚ;L$8)L$8D$D$4@٫$-սD$L$0L$4HL$8H$$ |1Ƅ$ d   d e d $$$tbQӃ uʀ$ $$\$L$D$ T$$D$MD$L$$$$(111몍=d +m b$$$D$D$@D$+rD$ L$DŽ$DŽ$$$+$D$$$D$D$ D${D$L$$$$(ø$D$L$qD$ D$D$L$u9$$D$ D$L$ $$ĀÉ$$ĀÍD$l$8$$D$L$뉃_D$xH}<ȍd ̍d 11ۋ$,$T$\$D$ L$RL$D$T$p9L$xL$lT$p9h9l ݍX9\  h9T  11WD$0D$4 `3 $D$D$莠D$L$ L$0D$4$$L$LT$D$ \$0\$D$D$+nL$ D$$$$D${ D$ L$$CD$l$D$D$L$T$\$l$ twtqBD$8D$<D$8L$<$$L$T$D$ \$8\$D$D$hmD$ L$$‰ȉ?뎉\$`l$dD$hD$@D$D$L$`L$/D$ L$L$@D$D$$L$T$D$ \$@\$D$D$lL$$D$ _$$ĀË$$D$:D$ L$u D$($$ĀÉ$$Āt{AD$PD$TD$PT$T$$D$D$D$ D$PD$D$D$kD$ L$$$$ĀÉDŽ$DŽ$ĀD$XD$\`&$$D$@D$L$ D$XL$\$$L$T$D$ T$XT$D$D$=kD$ L$$u $$$Āۀ Ԁ ̀ ƀ e ;a8D$Htut@D$(D$,D$(D$LD$,$D$D$X5111T $D$ D$ L$u L$HL$\D$`@ÉD$\L$`@e ;a$D$(Htf0L$T$ Hp I\$T$l$ 4$ыL$D$ )D$(~$|c xc -c 9~ |9v@$Ã$u `e ;aPD$HD$LL$`Qkd Sd e +D$dd T$HD$LT$HZ݃ ˀɉ\$ D$8T$4ރ\$,{BL$D$XD$L$\L$ږD$L$ T$1T$0L$D$<$ɷD$L$H e \L$0H D$@@L$TP $T$`T$T$dT$YD$L$ T$t|I$ыD$L$u\D$@$طD$L$u8D$ D$G E$|$i> "Me ;a D$D$4D$T$$T$wu&T$ 99!9 ؈D$( Ãul$ Uэ^$r|$Ge u Uul$ Uzul$ Udul$ ]UPuT$^$Kr|$Ge u fYuT$uT$uT$B D$G E$|$< D$G E$|$}< Ʊ!e ;a D$D$ ID$1ɋT$$T$ u#T$ 199!9 ЈD$( Ãu l$ U1ԃ u l$ U1Í^$p|$Ge u CCi ul$ U1p ul$ U]\ ul$ U1IuT$1 uT$1^$Vp|$Ge u C_CR u T$1 uT$J uT$1D$G E$|$: D$G E$|$: دe ;avUD$$D$D$D$D$oD$ t 1D$,ËD$ $D$$D$D$(D$@D$ de ;aD$ $D$$D$D$(D$+4D$D$L$ L$T$,$T$0T$T$4T$3D$ L$T$$T$T$D$L$ D$D$8Ů`e ;av; BL$ t$L$4D$L$HD$ D$ ޭe ;a$@BL$P D$4L$8D$TD$0T$D$T$HT$T$LT$L$ T$XT$)D$L$T$\$4$L$T$D$ D$8D$D$\D$6D$L$T$ \$$\$,l$(l$< $D$T$D$0D$ D$TD$XD$D$L$T$D$`L$dT$hD$,D$lD$D$L$T$ \$덁@! tƁ ! t뮁! t떃…!ڃÇ t o=!=Ç t I=!=Ç t #=!=Ç t =!= „t l$, 輤7e ;aZXBD$@L$hQT$, L$DD$PD$T\$pl$lt$d|$`D$81D$4D$8+D$4@L$,T$D\$pl$lt$d|$`ыT$,D$4D$@D$49 oL$LD$\$|$t$l$ \$D$D$\L$L$`T$T$d\$@$l$Ll$-D$L$\ $L$`L$L$dL$D$ D$VD$L$T$\$@$D$L$T$ D$LD$D$tD$-D$D$\L$L$`T$ T$d\$$\$0l$(l$Ht$P4$\$l$5D$ {d L$09t1D$HT$\T$xT$`T$|T$d$$$XÉ $D$HD${d T$D$ t @|d D|d 뢋L$0D$H똋@|d D|d T$\T$x|$|$$$XËD$PL$TT$\T$x|$|$$$X;e ;as BL$ S$L$:+D$…!څÇ tȋL$ȉD$ Á@! t؁ ! t! t먃…!ڃÇ t=!=Ç t ^=!=Ç t 8=!=Ç t =!= „t D$ 袠me ;avhB D$'JL$HZ\$@jRt$l4$l$T$GD$L$T$ $L$D$D$ D$dL$L$D$(L$@T$<\$ l$$L$D$D$ L$ 9D$<$T$@T$\$(\$L$ D$D$$L$L$8T$T$4'$OD$D$0L$4 $L$8L$L$$L$D$L$ T$0 e ^BBL$, $D$2D$…!څÇ t @! t  ! t ! t …!ڃÇ t o=!=Ç t I=!=Ç t #=!=Ç t =!= „t zD$D$PD輍We ;a8pBD$LHT$L$$ $D$D$DL$L$lT$ T$h1ۋl$|t$x|$t1l$01t$Tl$|t$x!l$,EΉ|$0\$TL$lՉNjD$DT$h\$,l$|t$x|$t$L$D$'D$ L$,9JD$h$T$lT$\$D\$L$ D$D$@L$L$dT$T$`'$MD$D$PL$` $L$dL$L$@L$ D$ L$T$Pe JBD$HL$t $L$xL$L$|L$$L$ $T$D$D$tL$L$xT$T$|\$L$l$Hl$ D$L$t $L$xL$L$|L$D$ D$莴D$L$T$\$L$D$L$T$ D$HD$$D$6D$L$T$ \$$l$(59u|$0t \$T'߉5{d 9t'$$$$$pÉD$\L$D$,L$4T$0\$$l$ $L$D$2D$ L$$9D$0$T$4T$\$,\$L$ D$L$T$$L$D$Ft$D$ D$(|$L1誐L$(9|$Lr|$8t$Let$8ZD$L$Z c $D$BD$!ӅÇ t @! t  ! t ! t …!ڃÇ t ^=!=Ç t 8=!=Ç t =!=Ç t =!= „t D$l`ËD$ D$l`É $T$'D$  u3e ;a/pB@L$D$$$D$D$4L$L$DT$ T$@1ۋl$tt$x|$|=T$|D$t $L$D$(L$0T$,\$$l$ $L$D$D$ L$$9D$,$T$0T$\$(\$L$ D$L$T$$L$D$D$ t$ 9SD$L$b c $D$D$0L$8T$4\$,l$($L$D$2D$ L$,9D$4$T$8T$\$0\$L$ D$L$T$$L$D$FD$L$ y9HD$$$L$D$ʚ;D$ {1D$D$ʚ;T$$)‰T$$D$D$ -@٫,$!D$L$L$ HL$$H c $D$,D$!ӅÇ t @! t  ! t }! t b…!ڃÇ t ;=!=Ç t =!=Ç t =!=Ç t =!= „t D$(D$H<É $T$'D$x _e ;aPBHD$L$D$`$D$D$D$0L$8T$4\$,l$($L$D$D$ L$,9D$4$T$8T$\$0\$L$ ζD$L$T$$L$D$"D$L$ ɴ9HD$$$L$D$ʚ;D$ W+D$D$ʚ;T$$)‰T$$D$D$ -@٫,$D$L$L$ HL$$H c $D$^&D$!ӅÇ t @! t  ! t }! t b…!ڃÇ t ;=!=Ç t =!=Ç t =!=Ç t =!= „t D$(D$H<É $T$'D$T Ye ;aPBH$L$C)D$ L$T$`$L$D$dzD$D$Ҿ Ue ;avZ D$tL$t ÉD$&$mD$L$  e uL$̋|$l_Ue ;avD$tL$(Ue ;a4D$<@tqT$8Z,l$(r:99t$$|$0߉$L$D$1tD$(|$8GD$$Ge uID$0t4Í`$WD$|$8GG e ukËD$0k벉L$,D$$\$  '$|$\$t$ l$(t$|$D$$L$,T$8\$ l$(о Se ;avfD$tT$ tA CÍ '${D$L$PQe uD$ ȋ|$ jcSe ;av#D$H… ӄt T$J&Se ;a4D$<@tqT$8Z,l$(r:99t$$|$0$L$D$1rD$(|$8GD$$Ge uID$0t4Í`$WD$|$8GG e uiËD$0i벉L$,D$$\$  3$|$\$t$ l$&t$|$D$$L$,T$8\$ l$(ξ Qe ;avZD$tT$ tÍ 3$D$L$e uD$ ΋|$ hoQe ;avD$tL$8Qe ;a4D$<@tqT$8Z,l$(r:99t$$|$0߉$L$D$ApD$(|$8GD$$Ge uID$0t4Í$gD$|$8GG e ugËD$0g벉L$,D$$\$ `3$|$\$t$ l$$t$|$D$$L$,T$8\$ l$(̾ Oe ;avfD$tT$ tA CÍ`3$D$L$PQe uD$ ȋ|$ fsOe ;av#D$H… ӄt T$J6Oe ;a4D$<@tqT$8Z,l$(r:99t$$|$0$L$D$AnD$(|$8GD$$Ge uID$0t4Í$gD$|$8GG e ueËD$0e벉L$,D$$\$ `B$|$\$t$ l$"t$|$D$$L$,T$8\$ l$(ʾ Me ;avbD$tT$ t Í`B$ D$L$e uD$ ʋ|$ dwMe ;avD$W.u{D$>Me ;a4D$<@tqT$8Z,l$(r:99t$$|$0߉$L$D$AlD$(|$8GD$$Ge uID$0t4Í $g D$|$8GG e ucËD$0c벉L$,D$$\$ B$|$\$t$ l$ t$|$D$$L$,T$8\$ l$(Ⱦ Ke ;avbD$tT$ t ÍB$ D$L$e uD$ ʋ|$ bwKe ;avD$Wf.u{D$=Ke ;a4D$t볋D$D$\D$`D$dL$hT$lDɸ"D$(D$4H$L$оD$L$ T$$L$D$|D$ e uL$TL$$ËD$(z|$T=̍d ȍd D$\D$`D$dL$hD$lDË|d |d T$HT$\T$LT$`T$PT$dD$hL$lD衢 蚢 3%~e ;aHB JR\$\iT$4D$,L$e ;aTB D$8JL$,Z\$T$2\$$9&@l$8l$T$\$ $ЋD$L$uGD$L$<9T$$)‰!‹l$8T$L)L$P\$TD$XD$\4D$LD$PD$TD$XL$\4Ëȍd ̍d D$LD$PD$TD$XL$\4Ë̍d ȍd D$LD$PD$TL$XD$\4Ë|d |d D$LD$PD$TD$XL$\4H A : e ;a4BL$HRD$(D$8$L$T$2\$ 9&@l$,l$T$\$ $ЋD$L$uGD$L$09T$ )‰!‹l$,T$@)L$D\$HD$LD$P(D$@D$DD$HD$LL$P(Ëȍd ̍d D$@D$DD$HD$LL$P(Ë̍d ȍd D$@D$DD$HL$LD$P(Ë|d |d D$@D$DD$HD$LL$P(酾 ⅾ ۅ te D$;AUD$DD$HB$D$0$$$L$$T$跽D$L$ T$Y$9)É$$)ʼnۇ!苬$9ڇÇ9Ç!9 t$,$L$ T$$ ۫$ǼD$L$$TL$ HT$,9<D$4$$L$T$-cl$ D$D$L$|$t1 L$4 $t$|$t$L$L$8T$|$Lt$t$D$0@L$D$$$]D$L$T$ $L$D$YD$D$(L$L$@T$ T$<|$`t$LJ$  $L$`L$覝D$ L$d t d e d L$DD$HL$DQӃ uʀ\$<$\$@\$\$(\$L$ D$T$|D$ $9T$,)‰!‹$ꉔ$)$$DŽ$DŽ$Ĉ111n=d \6111SDŽ$DŽ$DŽ$$D$8$ĈDŽ$DŽ$DŽ$$$ĈËȍd ̍d DŽ$DŽ$DŽ$$$ĈË̍d ȍd DŽ$DŽ$DŽ$$$ĈË|d |d DŽ$DŽ$DŽ$$$Ĉa Z S e ;a\BL$pD$0D$`$L$dL$T$hT$WD$L$ T$?\$d9)É\$dl$h)ʼnۇ!l$`9ڇÇ9Ç!9 t$,D$`L$ T$$ ۫$üD$L$$1L$ %T$,9D$4\$`$L$T$-cl$ D$4D$L$$üD$D$<|$H1D$4$wt$|$Hh D$L$L$(e |$D$tD$xD$|$$\ÉD$8$D$e ;a8BHD$L$D$<$7D$D$$L$L$4T$ T$011#t$ ^4|$@|$,>D$$L$4T$0\$ l$$L$D$>D$ L$ 9D$0$T$4T$\$$\$L$ 7D$L$T$$L$D$:D$L$ B9D$($蘜D$D$( Pc $D$hD$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt W=!=Ç Օt /=!=Ç Օt =!= Єt D$D$D8É $T$'D$Vp Ze ;aLB@L$D$D$\$4D$D$0L$L$HT$ T$D1ۋl$Pt$T|$X=T$XD$P $L$@L$\$D$$XD$0L$HT$Dl$Pt$T|$Xl$Pt$T\$$|$X$L$D$;D$ L$$9D$D$T$HT$\$0\$L$ 4D$L$T$$L$D$ 8D$ L$B9D$4$輙D$D$<D$4 Pc $D$舤D$D$ Pc $T$D$$L$0T$,\$ l$$L$D$>9D$ L$ 9D$,$T$0T$\$$\$L$ 1D$L$T$$L$D$R5D$ L$Ĝ9L$($ D$L$( Pc $D$ءD$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt [=!=Ç Օt 3=!=Ç Օt  =!= Єt D$D$@4É$T$'D$j Je ;aHB@ $D$賤D$L$ T$X$D$L$7/D$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$qD$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$R6D$ L$$9D$@$T$DT$\$0\$L$ /D$L$T$$L$D$f2D$ L$Ĝ9L$<$D$D$4L$< Pc $D$D$D$ Pc $T$4T$ʟD$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$D$L$T$$L$T$D$ D$ D$D$L$T$\$(,l$P9w9IL$,3$D$L$T$ l$衧D$T$L$,\$(l$PD$hD$lD$pT$t\$xHËD$LD$hD$PD$lD$TD$pD$tD$xHO $T$'D$g "e ;aNDD$D$(L$0T$,\$$l$ $L$D$bD$ L$$9D$,$T$0T$\$(\$L$ "D$L$T$$L$D$vD$L$ `B9D$@$(zD$D$ 0c $D$D$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt W=!=Ç Օt /=!=Ç Օt =!= Єt D$ D$@4É $T$'D$M Ze ;aHB@L$D$D$X$kD$D$4L$L$DT$ T$@1ۋl$Lt$P|$T=T$TD$L $L$D$$L$0T$,\$ l$$L$D$D$ L$ 9D$,$T$0T$\$$\$L$ D$L$T$$L$D$D$ L$Ü9L$(@$tD$L$( 0c $D$hD$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt [=!=Ç Օt 3=!=Ç Օt  =!= Єt D$D$@4É$T$'D$VH 菲Je ;aHB@ $D$CD$L$ T$X$D$L$ D$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$D$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$D$ L$$9D$@$T$DT$\$0\$L$ D$L$T$$L$D$D$ L$Ü9L$<@$qD$D$4L$< 0c $D$x|D$D$ 0c $T$4T$Z}D$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$nD$L$T$$L$T$D$ D$ D$CD$L$T$\$(,l$P9w9IL$,3$D$L$T$ l$1D$T$L$,\$(l$PD$hD$lD$pT$t\$xHËD$LD$hD$PD$lD$TD$pD$tD$xH&- $T$'D$nE 觯"e ;aNDD$D$,L$4T$0\$(l$$$L$D$D$ L$(9D$0$T$4T$\$,\$L$ D$L$T$$L$D$D$L$  '9HL$ D$`$WD$L$L$ H c $D$bD$!ӅÇ t @! t  ! t ! t …!ڃÇ t {=!=Ç t U=!=Ç t /=!=Ç t  =!= „t D$$D$D8É $T$'D$x+ 豕\e ;aLB@L$D$D$\$D$D$8L$L$HT$ T$D1ۋl$Pt$T|$X=T$XD$P $L$@L$\$5D$,XD$8L$HT$Dl$Pt$T|$Xl$Pt$T\$,|$X$L$D$D$ L$,9D$D$T$HT$\$8\$L$ D$L$T$$L$D$*D$ L$ '9D$ IL$$`$TD$D$D$$L$0T$,\$ l$$L$D$ND$ L$ 9D$,$T$0T$\$$\$L$ D$L$T$$L$D$bD$ L$9L$(`$RD$L$(Q P c $D$\D$!ӅÇ t @! t  ! t ! t …!ڃÇ t =!=Ç t ]=!=Ç t 7=!=Ç t =!= „t D$D$@4É$T$'D$% Pe ;aHB@ $D$_D$L$ T$X$D$L$WD$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$葯D$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$rD$ L$$9D$@$T$DT$\$0\$L$ 2D$L$T$$L$D$D$ L$9L$<`$>OD$D$4L$<IH c $D$ZD$D$ c $T$4T$ZD$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$D$L$T$$L$T$D$ D$ D$ѶD$L$T$\$(,l$P9w9GL$,3$D$L$T$ l$bD$T$L$,\$(l$PD$hD$lD$pT$t\$xHËD$LD$hD$PD$lD$TD$pD$tD$xH  $T$'D$" 5 e ;aQDD$D$$L$`90T$0)‰!‹l$\T$p)L$t\$xD$|DŽ$X111=d ŋD$8踛l$8l$8D$pD$tD$xL$|$XËȍd ̍d D$pD$tD$xD$|$XË̍d ȍd D$pD$tD$xL$|$XË|d |d D$pD$tD$xL$|$X) "  贂Oe ;aXD$DD$HBL$lCD$4D$\$L$`L$T$dT$ 8D$L$T$ \$`9D)É\$`l$d)ʼnۇ!l$\9هÇ9Ç!9 Vt$0D$\L$(T$$`$5BD$L$(L$$T$09D$8\$\$L$T$-cl$ D$ID$L$D$4@L$D$D$h$D$D$@L$ L$D$L$Q P 0d $D$ID$!ӅÇ tT$$ȉD$(Á@! t؁ ! t! t먃…!ڃÇ t=!=Ç t ^=!=Ç t 8=!=Ç t =!= „t $T$'D$ |e ;a0BHD$L$D$@$D$L$T$ $L$D$D$L$ 9D$,$D$,L$4T$0\$(l$$$L$D$rD$ L$(9D$0$T$4T$\$,\$L$ 2D$L$T$$L$D$D$L$ `39HL$ D$$55D$L$L$ H 0d $D$@D$!ӅÇ t @! t  ! t ! t …!ڃÇ t {=!=Ç t U=!=Ç t /=!=Ç t  =!= „t D$$D$D8É $T$'D$ 1s\e ;aLB@L$D$D$\${D$D$8L$L$HT$ T$D1ۋl$Pt$T|$X=T$XD$P $L$@L$\$赒D$,XD$8L$HT$Dl$Pt$T|$Xl$Pt$T\$,|$X$L$D$D$ L$,9D$D$T$HT$\$8\$L$ VD$L$T$$L$D$D$ L$`39D$ IL$$$Y2D$D$D$L$ T$\$D$@L$0D$P$D$TD$D$XD$D$`D$ L$dL$D$L$T$$L$T$D$(D$ D$D$L$T$\$0,l$T9w9?L$43$D$L$T$ l$ED$T$L$4\$0l$TD$lD$pD$tT$x\$|LËD$PD$lD$TD$pD$XD$tD$xD$|L $T$'D$ Qp,e ;a4BH$L$@D$ L$T$8$L$D$D$D$$L$L$0T$ T$,11#t$ ^4|$<|$,>D$$L$0T$,\$ l$$L$D$D$ L$ 9D$,$T$0T$\$$\$L$ D$L$T$$L$D$D$ L$9L$($/D$L$(Q P 0d $D$f:D$!ӅÇ t @! t  ! t ! t …!ڃÇ t =!=Ç t ]=!=Ç t 7=!=Ç t =!= „t D$D$@4É$T$'D$\ mPe ;aHB@ $D$S=D$L$ T$X$D$L$D$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$D$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$D$ L$$9D$@$T$DT$\$0\$L$ D$L$T$$L$D$D$ L$9L$<$,D$D$4L$<IH 0d $D$7D$D$ 0d $T$4T$h8D$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$|D$L$T$$L$T$D$ D$ D$QD$L$T$\$(,l$P9w9GL$,3$D$L$T$ l$?@D$T$L$,\$(l$PD$hD$lD$pT$t\$xHËD$LD$hD$PD$lD$TD$pD$tD$xH4 $T$'D$| j e ;aQDD$D$(L$0T$,\$$l$ $L$D$D$ L$$9D$,$T$0T$\$(\$L$ ­D$L$T$$L$D$D$L$ &9D$  $D$L$ pc $D$D$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt _=!=Ç Օt 7=!=Ç Օt =!= Єt D$ D$@4É $T$'D$ Pbe ;aHB@L$D$D$X$D$D$4L$L$DT$ T$@1ۋl$Lt$P|$T=T$TD$L $L$D$$L$0T$,\$ l$$L$D$~D$ L$ 9D$,$T$0T$\$$\$L$ >D$L$T$$L$D$蒫D$ L$9L$($J D$L$(  pc $D$D$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt _=!=Ç Օt 7=!=Ç Օt =!= Єt D$D$@4É$T$'D$  CKNe ;aHB@ $D$D$L$ T$X$D$L$wD$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$jD$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$蒬D$ L$$9D$@$T$DT$\$0\$L$ RD$L$T$$L$D$覨D$ L$9L$<$^ D$D$4L$<  pc $D$,D$D$ pc $T$4T$D$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$"rD$L$T$$L$T$D$ D$ D$qD$L$T$\$(,l$P9w9ML$,3$D$L$T$ l$D$T$L$,\$(l$PD$hD$lD$pT$t\$xHËD$LD$hD$PD$lD$TD$pD$tD$xHŽ $T$'D$"޻ [H&e ;aJDD$D$D$$L$L$8T$ T$4\$0\$&$޻D$L$ d td e  d D$D$(L$0T$,\$$l$ $L$D$貒D$ L$$9D$,$T$0T$\$(\$L$ rD$L$T$$L$D$ƎD$L$  39D$ @ $|D$L$ d $D$PD$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt _=!=Ç Օt 7=!=Ç Օt =!= Єt D$ D$@4É $T$'D$>Ļ w.be ;aHB@L$D$D$X$ˈD$D$4L$L$DT$ T$@1ۋl$Lt$P|$T=T$TD$L $L$D$$L$0T$,\$ l$$L$D$.D$ L$ 9D$,$T$0T$\$$\$L$ D$L$T$$L$D$BD$ L$@9L$(@$D$L$(  d $D$D$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt _=!=Ç Օt 7=!=Ç Օt =!= Єt D$D$@4É$T$'D$躾 (Ne ;aHB@ $D$D$L$ T$X$D$L$'D$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$aHD$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$BD$ L$$9D$@$T$DT$\$0\$L$ D$L$T$$L$D$VD$ L$@9L$<@$D$D$4L$<  d $D$D$D$ d $T$4T$D$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$OD$L$T$$L$T$D$ D$ D$OD$L$T$\$(,l$P9w9ML$,3$D$L$T$ l$D$T$L$,\$(l$PD$hD$lD$pT$t\$xHËD$LD$hD$PD$lD$TD$pD$tD$xH芣 $T$'D$һ &&e ;aJDD$D$(L$0T$,\$$l$ $L$D$RpD$ L$$9D$,$T$0T$\$(\$L$ iD$L$T$$L$D$flD$L$ ;9D$  $λD$L$ b $D$D$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt ]=!=Ç Օt 5=!=Ç Օt  =!= Єt D$ D$@4É $T$'D$ܡ  `e ;aHB@L$D$D$X$kfD$D$4L$L$DT$ T$@1ۋl$Lt$P|$T=T$TD$L $L$D$$L$0T$,\$ l$$L$D$jD$ L$ 9D$,$T$0T$\$$\$L$ cD$L$T$$L$D$fD$ L$9L$($ȻD$L$(  b $D$kD$!ӅÇ t @! t  ! t ! t …!ڃÇ Օt =!=Ç Օt ^=!=Ç Օt 6=!=Ç Օt =!= Єt D$D$@4É$T$'D$Y Me ;aHB@ $D$CD$L$ T$X$D$L$`D$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$&D$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$gD$ L$$9D$@$T$DT$\$0\$L$ `D$L$T$$L$D$cD$ L$9L$<$ŻD$D$4L$<  b $D${D$D$ b $T$4T$]D$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$q-D$L$T$$L$T$D$ D$ D$F-D$L$T$\$(,l$P9w9LL$,3$D$L$T$ l$4پD$T$L$,\$(l$PD$hD$lD$pT$t\$xHËD$LD$hD$PD$lD$TD$pD$tD$xH) $T$'D$q %e ;a8BL$LD$(D$<$L$@L$T$DT$D$L$ T$X\$@9)É\$@l$D)ʼnۇ!l$<9هÇ9ڇÇ!9 t$$D$D$(L$4T$0\$$l$ $L$D$MD$ L$$9D$0$T$4T$\$(\$L$ FD$L$T$$L$D$JD$ L$09D$,IL$಩$赫|$D$Ge `D$,c$|$tD$!ӅÇ t @! t  ! t ! t …!ڃÇ t m=!=Ç t G=!=Ç t !=!=Ç t =!= „t D$,D$ D$D8É$T$'D$\ @e ;aLB@L$D$D$\$CD$D$4L$L$HT$ T$D1ۋl$Pt$T|$X=T$XD$P $L$@L$\$% D$(XD$4L$HT$Dl$Pt$T|$Xl$Pt$T\$(|$X$L$D$KD$ L$(9D$D$T$HT$\$4\$L$ CD$L$T$$L$D$GD$ L$09D$D$$L$0T$,\$ l$$L$D$.HD$ L$ 9D$,$T$0T$\$$\$L$ @D$L$T$$L$D$BDD$ L$@9L$(಩$|$D$(@Ge \c$|$踰D$!ӅÇ t @! t  ! t ! t …!ڃÇ t u=!=Ç t O=!=Ç t )=!=Ç t =!= „t D$D$@4É$T$'D$y 6e ;aHB@ $D$蓳D$L$ T$X$D$L$>D$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$QD$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$2ED$ L$$9D$@$T$DT$\$0\$L$ =D$L$T$$L$D$FAD$ L$@9L$<಩$|$D$<@Ge 9|$4c$|$踭D$D$ c $T$4T$蚮D$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$ D$L$T$$L$T$D$ D$ D$ D$L$T$\$(,l$P9w99L$,3$D$L$T$ l$qD$T$L$,\$(l$PD$hD$lD$pT$t\$xHÉ@D$LD$hD$PD$lD$TD$pD$tD$xHZ^ $T$'D$v e ;a@DD$d t d e d L$DD$HL$DQӃ uʀD$LD$PD$TL$LD$PT$TD$@$L$D$,L$8T$4\$(l$$$L$D$*D$ L$(9D$4$T$8T$\$,\$L$ #D$L$T$$L$D$&D$ L$9D$0QT$IL$ ௩$莈|$D$GD$ Ge `D$0b$|$FD$!ӅÇ t @! t  ! t ! t …!ڃÇ t _=!=Ç t 9=!=Ç t =!=Ç t =!= „t D$0޿D$$D$H<É$T$'D$.\ gƿ2e ;aPB@L$D$D$`$ D$D$8L$L$LT$ T$H1ۋl$Xt$\|$T=T$\D$T $L$DL$\$D$,XD$8L$LT$Hl$Xt$\|$Tl$X\$,t$\|$T$L$D$'D$ L$,9D$H$T$LT$\$8\$L$ D$L$T$$L$D$#D$ L$9D$@QT$ IL$$௩$蒅|$D$ GD$$Ge @D$@|$<b$|$FD$D$( b $T$D$$L$0T$,\$ l$$L$D$$D$ L$ 9D$,$T$0T$\$$\$L$ D$L$T$$L$D$ D$ L$9L$(௩$誂|$D$(P@WGe \b$|$bD$!ӅÇ t @! t  ! t ! t …!ڃÇ t o=!=Ç t I=!=Ç t #=!=Ç t =!= „t ؿD$D$@4É$T$'D$LV 0e ;aHB@ $D$CD$L$ T$X$D$L$D$D$0L$L$DT$ T$@1ۋl$Pt$T|$L=T$TD$L $L$8L$\$D$$XD$0L$DT$@l$Pt$T|$Ll$P\$$t$T|$L$L$D$!D$ L$$9D$@$T$DT$\$0\$L$ D$L$T$$L$D$D$ L$9L$<௩$|$D$<P@WGe 9|$4b$|$bD$D$ b $T$4T$DD$L$ T$\$D$8L$(D$L$D$PD$D$TD$D$\D$ L$`L$XD$L$T$$L$T$D$ D$ D$-D$L$T$\$(,l$P9w93L$,3$D$L$T$ l$D$T$L$,\$(l$PD$hD$lD$pT$t\$xHÉտD$LD$hD$PD$lD$TD$pD$tD$xH; $T$'D$LS 腽e ;aBDD$d t d e d L$DD$HL$DQӃ uʀD$LD$PD$TL$LD$PT$TD$<$L$@L$T$,T$\$L\$ D$D$>D$ L$T$\$<$\$@\$\$,\$T$ L$D$'D$$L$`9 T$0)‰!‹l$\T$p)L$t\$xD$|DŽ$X111=d Cȿ111D$pD$tD$xL$|$XË̍d ȍd D$pD$tD$xL$|$XË̍d ȍd D$pD$tD$xL$|$XË|d |d D$pD$tD$xL$|$X, , , IDe ;a ve vu. ve Mp)+*ePk&e # $D$^~D$L$ @( $ЋD$L$ |d e h|d $D$D$ L$ 8|d e  <|d H$D$-nD$L$ {d e  {d Wye $ Xpd  e ɴ $D$}D$L$ @( $ЋD$L$|d e L |d g:$D$%D$L$ @|d e  D|d ؼ$D$ D$L$ 0|d e  4|d $D$`D$L$ {d e n {d $D$#(D$L$ {d e $ {d M3$D$D$L$ {d e  {d J$D$&D$L$ (|d e  ,|d we $b hd we $4 dpd iwe $ Tpd e  $D${D$L$ H|d e  L|d B:$D$%D$L$  |d e p $|d e " $D$({D$L$ @( $ЋD$L$X|d e  \|d e ! $D$zD$L$ @( $ЋD$L$P|d e  T|d Gve $ ppd +ve $\ `pd ve $. \pd ue $ |pd ue $ xpd ue $ pd ue $v tpd e " $D$yD$L$ @( $ЋD$L$h|d e  l|d  e " $D$yD$L$ @( $ЋD$L$`|d e  d|d te $ hpd $(D$ yD$L$ @P $ЋD$\e te $0 lpd te $ pd $D$#H D$L$ |d e  |d $D$ D$L$ |d e uu |d $e  $D$JxD$L$ @( $ЋD$L$x|d e u ||d 藚"ve Í=||d U׍=|d F낍=|d 7<=pd %=lpd =hpd d=d|d ￿6=l|d ݿ=tpd ˿~=pd 蹿P=xpd 觿"=|pd 蕿=\pd 胿=`pd q=ppd _j=T|d M<=\|d ;=$|d )=L|d :=Tpd =dpd =hd ᾿=,|d Ͼd={d 轾={d 諾={d 虾=4|d 臾<=D|d u= |d c=Xpd QL={d ?=<|d /=|d 蕦e ;aD$$L$L$#D$L$Q$D$,D$L$Q$D$D$.D$ L$Q$D$D$L$Q$D$D$L$$ $D$D$D$ץBe ;aRD$H\$k391ɄH S kp91ɄKP9KPhs9tt1ɄtjK P hs9t;1Ʉt1H(@$S([$9t 1D$É$\$L$D$ 1݉,$t$T$L$ D$\$1뤉,$t$T$L$ D$\$l1e1^4$L$T$SL$ D$\$1 $L$l$*L$ D$\$ce ;av9 Yu6t$$t yD$L$L$(D$, & 뮍|$$9;u‰#e ;av0Yu-D$ t$D$D$% 詣뷍|$ 9;uˉ#e ;avD$,D$lge ;avD$,D$,7e ;av"D$,D$D$D$ 跇e ;av-pb$D$D$5D$ L$L$D$le ;avHe ;avSġ$FD$ d c c c T$\$L$D$D$ D$$ֆe ;av'D$tHD$L$ D$D$ 蒆e ;av(D$tH @D$L$ D$D$ Qe ;av7D$tHP@D$T$ L$D$D$ D$e ;av[d b $D$D$D$ qd pb $D$sD$D$ G~e ;a$D$($KD$ 3 $D$%XD$ D$ L$L$T$\$($D$T$L$ yD$L$T$u0|PL$9wHT$ T$,D$0L$4D$8D$<$D$,D$0D$4L$8T$<$p 虄$e ;a4D$8HL$@T$< X$L$l$Dl$D$ \$\${D$L$@9)\$D)!Ët$<|$8/w9KD$t$(9t$l$t$WD$L$(ȋL$8Q T$@9B\$<i $T$t$Dt$@D$ l$l$D$L$@9)\$D)!Ët$<|$8o w9D$l$(9t$t$l$订D$L$(ȋL$8QYYT$(\$0l$|$$L$,D$ D $D$L$< $T$@T$\$D\$l$ El$ D$D$D$L$@9D$T$,$T$D)‰!‹t$<T$)L$l$ D$L$T$D$HT$LL$P4Qt 9slD PIt$9sQD(D$HD$LD$P49s&D(ڋl$D$L$zd e u zd +vYe Í=zd ~v܍=zd ov^e ;avCXe vu ޼ Xe Lw}HXe ^e ;avpD$$L$L$GD$L$Q$D$0D$L$Q$D$D$L$ $D$D$D$ D$]te ;aD$HT$Z*091ɄH Z jp9tV1ɄtLJZhp9t1Ʉt@J9D$1$t$L$`L$ D$T$1‰,$t$\$=L$ D$T$1뉉,$t$\$L$ D$T$M]e ;avYD$$L$L$D$?D$ L$Q$D$蘝D$L$ $D$聝D$D$\e ;aD$T$9uxJX9ujH Xj r9t;1Ʉt1HZR@9t 1D$É$D$\$D$ 1݉4$\$l$♺L$ D$T$11[Qe ;avQ D$$L$L$臜D$L$Q$D$pD$L$ $D$YD$D$ X[e ;aD$H\$k39tt1ɄtjH Pks 9t;1Ʉt1H@S[9t 1D$É$D$\$ۘD$ 1݉,$T$t$L$ D$\$1뤉4$T$l$蝘L$ D$\$lZ1e ;aD$$L$L$D$D$ L$Q$D$$D$L$Q $D$ D$L$Q$D$D$L$ $D$ߚD$D$YYe ;a D$T$8HXjr91ɄHX j r9tt1ɄtjHXjr9t;1Ʉt1H Z R@9t 1D$É$D$\$-D$ 1݉,$\$t$L$ D$T$1뤉,$\$t$L$ D$T$l1e4$\$l$ƖL$ D$T$)1"Xe ;avpD$$L$L$gD$L$Q$D$PD$L$Q$D$9D$L$ $D$D$D$ D$Xte ;aD$HT$Z*091ɄH Z jp9tV1ɄtLJZhp9t1Ʉt@J9D$1$t$L$耕L$ D$T$1‰,$t$\$]L$ D$T$1뉉,$t$\$:L$ D$T$M#We ;avYD$$L$L$D$_ߺD$ L$Q$D$踗D$L$ $D$街D$D$Ve ;aD$T$9ujHXjr9t;1Ʉt1H@ Z R9t 1D$É$D$T$'D$ 1݉4$\$l$ L$ D$T$1U_e ;avBD$$L$L$觖D$L$ $D$D$޺D$ D$Ue ;avcD$H\$k39t+1Ʉt!KP9uK @ 9D$11$t$L$L$ D$\$Ue ;avBD$$L$L$ǕD$L$ $D$D$8ݺD$ D$Te ;avbD$HT$Z*09t*1Ʉt HZ9R @ 9!ȈD$1,$t$\$;L$ D$T$'Te ;avpD$$L$L$町D$L$Q$D$ДD$L$Q$D$D$AܺD$ L$ $D$蚔D$D$Ste ;aD$HT$(r91ɄH Xj r9tW1ɄtMHZ9u?HZ9u1JRX@9t 1D$É$D$L$D$ 111Չ4$\$l$ܐL$ D$T$1눉$l$t$蹐L$ D$T$LR e ;av: D$$L$L$WD$L$ $D$@D$D$ ?Re ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$ՏD$ 1݉4$T$l$躏L$ D$\$Qqe ;av: D$$L$L$gD$L$ $D$PD$D$ OQe ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$厺D$ 1݉4$T$l$ʎL$ D$\$Pqe ;av: D$$L$L$wD$L$ $D$`D$D$ _Pe ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$D$ 1݉4$T$l$ڍL$ D$\$Oqe ;avQ D$$L$L$臐D$L$Q$D$pD$L$ $D$YD$D$ XOe ;aD$H\$k39tt1ɄtjH Pks 9t;1Ʉt1H@S[9t 1D$É$D$\$یD$ 1݉,$T$t$L$ D$\$1뤉4$T$l$蝌L$ D$\$lN1e ;av: D$$L$L$GD$L$ $D$0D$D$ /Ne ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$ŋD$ 1݉4$T$l$誋L$ D$\$Mqe ;av: D$$L$L$WD$L$ $D$@D$D$ ?Me ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$ՊD$ 1݉4$T$l$躊L$ D$\$Lqe ;avYD$$L$L$D$ԺD$ L$Q$D$HD$L$ $D$1D$D$0Le ;aD$T$8ujHXjr9t;1Ʉt1H@ Z R9t 1D$É$D$T$赉D$ 1݉4$\$l$蚉L$ D$T$1K]e ;av: D$$L$L$7D$L$ $D$ D$D$ Ke ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$赈D$ 1݉4$T$l$蚈L$ D$\$Jqe ;avQ D$$L$L$GD$L$Q$D$0D$L$ $D$D$D$ Je ;aD$H\$k39tt1ɄtjH Pks 9t;1Ʉt1H@S[9t 1D$É$D$\$蛇D$ 1݉,$T$t$耇L$ D$\$1뤉4$T$l$]L$ D$\$lFI1e ;avBD$$L$L$D$L$ $D$D$ xѺD$ D$He ;aviD$HT$Z*09t11Ʉu 1D$ÃD$B$D$ 苆D$ ׉,$t$\$tL$ D$T$`H{e ;aD$$L$L$D$кD$ L$Q$D$D$L$Q$D$D$eкD$ L$Q $D$D$L$$ $D$览D$D$GQe ;aD$P\$k9‹+9!фHP ks 99!ʄHSkp9tp1ɄtfHPk9‹k9!фtF@ K .u3z1H$S([$@(9t 1D$É$L$T$ԄD$ 111Չ,$t$T$豄L$ D$\$p1i1bFe ;avYD$$L$L$GD$L$Q$D$D$κD$ L$ $D$D$D$Fe ;aD$HT$(r9tW1ɄtMHZ9u?H Z 9u1JRX@9t 1D$É$D$L$荃D$ 111Չ$l$t$jL$ D$T$VEQe ;avD$@ D$(Ee ;a4D$8L$< ޺T$D L$LD$P4ÉD$L$ D$$D$(D$,D$0`&$L$DL$JܺD$L$ D$$L$(`&$D$HD$$ܺD$L$ D$,L$0cɺ$D$D$$D$D$ D$膫D$L$$T$ T$T$T$D$ L$ JL$D$‰ȉCe ;aL$T$ e L$ JBǂ ǂǂǂǂǂ ǂ$ǂ|ǂ e uAǂǂǂǂ&ǂǂT$Í1uZ뺍zD$ gZ7Be ;a4D$8 L1HL$0T$0؉ы Z9<94()Ս!ӅM||O9( $ى!ٍLL$)ډT$l$ zD$8ǀ| 9y)ʍ!ٍ\tD$0$\$T$`D$8 + L$ XRۇ݉ۇ!͍ll$ۇ݉l$t$ $ҋD$L$T$\$8ǃ l$ 艃=DDd 9B $ЋD$8$D$8u-$~ Aǀ$D$<4Ë TT$09ۉ!ˍ\$)ʉT$l$LD$ L$=utoT$8 $At* uC ǂD$<4ÉD$($D$D$D$(ԉD$(D$8 $A$D$D$>D$(D$<4ù>L$,T$$$L$d D$踉D$ RL$,T$$1Ut=_ 47D$9Vt$=`^ 4w~6~L 88ȗ~L ?L$0.ȹk        湼 >:e ;avX D$ǀ|ǀ$KD$uD$ ÉD$D$$D$L$D$=e ;avYD$ tD$É$vD$L$ =tщ $UD$L$ =e ;a|$C|$@ZL$L|$ht$@Y$D$($D$,D$0D$4D$8D$<$D$hD$!ӺD$ L$L$0D$40$D$(D$ԺD$ L$L$8D$<|ud 0  $D$ݺD$D$ D$0D$D$D$١|Í|$T1ET$\$TT$X +$T$\~&D$`D$d|$@t$TX ~HD$` D$dD$`D$d뻉 $$D$$D$Ѓ|; e ;a D$uRD$_u6t D$ É$2`D$t D$1؉$baL$D$뼋D$$D$D$D$D$ b:]e ;avbD$$_D$D$$HD$HD$D$L$T$$D$L$D$ uċD$D$ 9e ;av)D$D$ $D$HЃ vD$9e ;av2 D$.tD$ ËD$$~D$$rD$79e ;av[ D$euHD$$6D$-u,D$$!D$L$ $D$ D$D$ Ã+t݃Et8e ;aD$ 0jD$$D$xD$$D$L$1 $D$L$XЃ w=|ބtD$$D$(ÉD$ $TD$D$D$̍XwX붍XwX멻뢃Xd1%L$D$$D$7D$T$ щD$PЃ vϋT$tC.u4$D$D$L$ $D$9D$D$$D$(ÃetǃEt„$߻D$D$)D$L$ $D$@D$L$tC.u4 $D$iD$L$ $D$D$D$$D$(ÃetǃEtD$$D$(6e ;aD$L$T$\$ \$ $T$D$ XD$L$~jЃ w49|хT$$ÉT$ $/ʻD$D$ T$ ԍjwj뿍jwj벽5Ke ;aD$$D$f6\uD$$D$D$$ÍHvftۋL$ 9tӉD$UHЃvZUt$D$$/ʻD$D$4D$륋D$$RD$$D$D$ vD$tD$$D$D$ QD$Out:xxD$$D$$D$D$ D$D$$D$$D$D$ D$rnrtv04[e ;aD$$+D$L$T$1l$ ]l$t$9tX\$ t)|%\u$L$D$ʼn$D$뷉$ D$D$D$ D$É\$o3Je ;avT D$$oD$L$ $]D$L$`t"} $ D$D$ à 2e ;avD D$$D$'D$u ËD$$߻D$D$2e ;aD$/u7D$$D$L$ $D$L$ t}D$ËD$$[D$D$ |6D$$CD$L$ *u߃/uڋD$$%D$D$ËD$$D$D$D$ 1+e ;aD$$ D$L$ǁ|ǁ$D$L$ʉ !#h !ٽ ! #ÅÇ ݕu(ǂ,ǂ4Ƃx +$|ىD$$D$D$D$ cD$HЃ 'i./D$$oD$/utL$t\tǁ| $zD$L$ $eD$T$ +$L$ ËL$փ*tL$˃`u;L$€uD$ $D$L$랉 $"L$׋D$$D$L$rD$$D$HЃ wHL$u T$= $QD$L$ $D$D$L$΋L$T$ău"uFL$@uD$ $D$L$ $D$"L$̃'L$ uD$ $D$L$} $qL$ԋL$t $D$D$L$ ‰ȉ9 $ML$D$D$t$D$$D$L$I -e ;a|$1EL$\$T$  +$T$~D$D$Ë ~HD$ D$D$D$,Ue ;aD$ |W}(4,9upH|890$$ۉ!ˍDD$)ʉT$l$ 3D$L$D$$L$(ÍP|9 $ى!эLL$)Ӊ\$l$ dD$ |,(409wO$)؉!ЉD$)ىL$l$ 3D$L$L$$D$(D$$D$(%   @+Ke ;ae vuP e "m[Cn[$D$  $D$D$|$ Ge G $L$L$D$y|$ Ge f $L$L$D$:|$ Ge ٢ $L$L$D$|$ Ge Z $L$L$D$|$ Ge  h $L$L$D$}|$ Ge ̺ $L$L$D$>|$ G e utw  $D$D$D$|$ Ge u}ߺD$vd e Í}ߺF@=vd D$7@ٍw *@뇍̺@<h @?٢?Of??C(e ;avBD$$L$L$hD$L$ $D$D$ hD$ D$'e ;aviD$HT$Z*09t11Ʉu 1D$ÃD$B$D$ {eD$ ׉,$t$\$deL$ D$T$P'{e ;av9Yu6t$ t sDD$L$L$$D$( &뮍|$ 9;u‰#e ;avD$D$D$e&e ;av6Yu3D$ CLD$L$L$$D$(S&뱍|$ 9;uʼn#e ;av7Yu4獴$tCD$L$$$%밍|$ 9;uĉ#e ;a<$D$L$DL$D$D$(L$ L$8T$T$$$c|$D$(GD$$Ge kD$8|$,1 L$(A|$,L$D9.D$(L$@Z$\$"4D$ L$t $D$D$ D$ L$L$0$D$L$ D$4T$0!ua@\$,C BIL$ T$0$L$D$D$ D$L$ L$ |$4Oe D$0$L$D$D$ D$L$T$\$4K S e CL$,Qjq؋9%ji-e }){je e ;av: D$$L$L$AD$L$ $D$AD$D$ e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$%>D$ 1݉4$T$l$ >L$ D$\$qe ;av>Yu;D$t%H$L$+D$L$ D$L$袁 멍|$9;u#e ;av7 Yu4D$t$RD$L$L$D$ 9 2밍|$9;uĉ#e ;av D$$L$L$?D$L$Q$D$?D$L$Q$D$?D$L$Q$D$?D$L$ $D$?D$D$ ee ;a=D$H\$k391ɄH Pks 91ɄHPks9tt1ɄtjHSkp9t;1Ʉt1H$S$[ @ 9t 1D$É$D$T$;D$ 1݉,$t$T$;L$ D$\$1뤉,$T$t$;L$ D$\$l1e,$T$t$h;L$ D$\$)1"4$T$l$?;L$ D$\$(e ;avBD$$L$L$D$oD$ L$ $D$@D$D$e ;avrD$T$9u[JX9uMHZ9u?H Z 9u1JRX@9t 1D$É$L$\$GD$ 11117re ;avD$D$E e ;aLL$TT$P1111 @T$TˋL$T9׍‹JT$0S99T$ T Le u T$0L$ 몉ωËD$0؉D$,L$$\$(0$l$\$t$ T$Ͻl$D$t$PD$,L$$\$(|$Py@uD$\D$`!LÉ,$\$t$uɺD$ D$9D$L$D$4L$8D$<D$@D$DD$H0D$< L$@$D$4D$D$L$ D$DL$HȺ$D$D$D$H@$L$<D$ L$ $D$x D$L$ D$L$ËD$H@ $D$N D$L$ D$L$5`e ;aD$Hʁtt@t@wzuR3w2u L$À3u 4u5uԀ6uρǁ u 뤁@u딁`u넁u qeZe D$;A$.H$$ыD$D$$$Q$$ҋD$D$(L$L$L$Z$,$Ӎt$|$X$SD$L$(H e xL$LHD$8|$H e P<O׍t$XL$$ʁH@ 00$Q $$ҋD$L$T$8BJD$$t JJ@t JJt B B$H$$$ыD$L$ 9H$\$8K$H(K(H0h,K0 e Sk,D$4H8h4K8 e pP{Phdl$DkdS4pt$De1u+1CCHh K e qk se $4T$8L$4L$@|$l1 " $T$@T$T$lT$ D$l$胾D$ltbL$pPY\$ L$,l$8t$5"4$D$T$ |$D$Ge uD$,땋D$,k늋nd tI$$$D$D$8D$ ыD$ L$\$8$$$ËD$8$DŽ$DŽ$ËT$8{ e $T$8L$4$1 " $T$$T$蠺$$$te$Q X\$ D$0l$8t$5"4$L$T$ W|$D$ Ge uD$0댋D$0끋D$4\$8iT$8'l$T$82$Ze u$B z $t tD$83pD$84t T$86StVi$D$"D$D$ D$DD$L$DŽ$$$D$PD$T s$L$btD$L$ D$PL$T $D$!D$PD$D$ D$tDD$L$DŽ$$$ËD$85HPT$L$$ L$ D$D$L$T$8Be uJ|$Hm $T$D$XD$>D$8D$L:c$腛|$Ge u.wDŽ$p$$ÍwP۾;e ;ae ;av-D$$D$D$D$D$ D$le ;av^D$L$19}D}B}uD$ É$L$T$}\$ T$D$L$D$ 뾾e ;af4D$8$L$HP Z9)ډ!ك1Ʉw@5狴$ɾk$$$$u~ta$D$$$ D$ L$$e u$$Ítľމ$$Ë$D$$$\$D$L$ $e u$$Íþދ$D$$$D$ L$$e u$$ÍþލpT$dɾD$ʚ;D$at$$?ɾe $QhY|u($$ɾ1)ľ"ľ$$$$L$$L$ź$$L$ɺ$$D$ɺ@0 $D$l$L$ $Q1J$|$t$\ź$$$' 迪Ze ;a\$J@e \$D$D$  $ЋD$XD$L$T$$}thvd -lvd e uD$(L$, ͉艪T$(L$, É$L$lvd D$ݹD$ u D$$D$(D$, 踒e ;a D$,T$$Z9هÇ݋r 9Ç!9 L$09R111ۅu8ttvd pvd \$4L$8D$< É\$4D$8D$< É\$4T$8L$< ÈD$j@t$(t$\$L$ ,$Ћ\$D$$H)ًl$t$x H)߉x D$ˉZL$0\$,CS |e ;a(D$ D$$D$ D$,D$$$$D$ D$/+D$L$ $L$D$0D$D$4D$ D$L$T$\$\$8T$g|$ Ge _ ץ$L$L$D$f|$ Ge  ץ$L$L$D$f|$ Ge ' ץ$L$L$D$f|$ Ge uy ץ$D$D$D$Ff|$ Ge u",D$nd Je Í,脋=nd D$uԍh낍'[7K;=nd D$'>=vd =vd =|vd =lvd 劾D=\vd Պ=tvd Ŋ=dvd 赊l+se ;avLYuID$t3PX @ $T$D$\$ D$L$L$ D$$ r뛍|$9;u#e ;avLYuID$t3PX @ $T$D$\$ D$L$L$ D$$D =r뛍|$9;u#e ;av:B$D$D$D$ D$D$$D$ D$(D$D$,D$X?qe ;av:B$D$D$D$ D$D$$D$ D$(D$D$,D$踹pe ;av:B$D$D$D$ D$D$$D$ D$(D$D$,D$訵pe ;av7 Yu4D$t$蒕D$L$L$D$  p밍|$9;uĉ#e ;avUYuRD$ tL$LY-e CT$@e ;avN D$@$L$ $ЋD$L$@ݞ9u@D$ É $T$'D$Bӹ >e ;a,D$0$L$4L$c D$D$$L$ L$T$0$T$4T$D$udD$$L$D$$L$$L$9D$D$(L$ L$ T$$$T$T$9D$L$ T$(T$8T$ T$D$$L$L$0$Z\$$$1E94~tl$ 7+땍|$9;u#e ;ava Yu^D$$tHD$($D$,D$D$0D$D$4D$ D$8D$0D$L$T$T$ e ;avT$ ЋD$ $L$D${e ;avT$ ЋD$ $L$D$;e ;a``$黹|$|$Te t$xD$tL$d-T$TZ$j s11\$Dl$( $T$pT$D$D$ L$T$h$T$lT$D$L$ D$(D$D$DD$xD$ L$T$T$ $D$L$LL$D$ D$[L$T$T$tL$xdÉT$4L$8D$lD$,D$pD$0D$<D$@D$DD$H0$L$4L$ЌD$L$ D$ $D$L$LL$D$ D$FYL$T$$$ĤÉL$4D$8$D$,$D$0D$<D$@D$DD$H0$L$4L$D$L$ D$! D$p$T$tT$L$pD$mD$p$D$tD$D$xD$apD$D$(L$ L$X$T$dT$T$hT$T$lT$ D$HPj96JHLl$() e <Ӆu D$XD$XgD$\0$\$T$L$ l$0D$L$T$|$\We u ʉÉPb+D$p$D$tD$L$bHD$L$ $D$`D$ L$T$\$&$T$D$L$ D$D$DL$L$0$T$dT$T$hT$T$lT$ D$HPj96JHLl$0) e <Ӆu D$DD$D$D$\0$\$T$L$ l$D$L$T$|$\We u ʉÉtD$tƒ!D$t^$|$Ge u ͻͻipJVHL$tÅ҇Ç!݅ ՕxE $D$D$ ߾D$D$,L$ L$L$T$dT$T$hT$T$lT$ D$HPj96JHLl$,)<Ӌ e u D$LD$LaD$\0$\$T$L$ l$*D$L$T$|$\We u ʉÉu  ^$L|$Ge u ]Mu u AuL$tL^$Ǧ|$Ge u :uL$tuL$tL$tQD$p$D$tD$L$4D$ G$D$dD$D$hD$D$lD$ D$HPj9:JHL<Ӌ e u iD$\0$\$T$L$ l$2D$L$T$|$\We u ʉÉzHP L$t1ۅ…ۇÇ!Յ Օ:  1ɉ$L$D$ ۾D$D$$L$ L$P$T$dT$T$hT$T$lT$ D$HPj96JHLl$$)<Ӌ e u D$PD$P&D$\0$\$T$L$ l$︼D$L$T$|$\We u ʉÉu 11 u 1 u I u 1^$ߣ|$Ge u CCRuL$t1OL$t1A u L$t1/ uL$tY u L$t1 ^$G|$Ge u C=C-H `L$tZWf. Z$D$fD$ D$@gD$D$TL$L$ $T$dT$T$hT$T$lT$ aD$PXk96SPTl$ *e <مu D$TVD$THD$\0$L$\$T$ l$覶D$L$T$|$\We u ˉu ^$̡|$Ge u sͻtsͻBgu L$t^$耡|$Ge u sͻCsͻ6D$@G E$|$ l D$@G E$|$k D$@G E$|$k D$@G E$|$k D$@G E$|$k D$@G E$|$k D$@G E$|$ik e ;aS@D$HD$DH P$T$$ L$_D$DH$P T$L$ ` $}D$ L$$L$`D$L$T$\$ l$tID$8D$<L$8D$<?$D$D$8D$D$ D$ GD$D$0L$L$$ī${D$D@L$D$$Ae uD$0AL$Hf@ÍyD$0T$(\$l$ `$ D$D$4L$( $T$T$\$ \$-@l$ D$D$twī$؞D$D@L$L$,$D$(D$D$D$D$ D$ CD$L$T$,J e uBT$He@Ízī$aD$D@L$D$4@Ae uQL$He@Íye@2޽e ;a,D$D$ D$$D$(D$0L$ `& $uD$ L$L$D$ D$0D$0$6vD$L$ D$$L$( $D$D$D$D$ D$DD$L$L$4D$8,Oݽ*e ;a,D$4L$0 $D$ki|$D$ QL$89WGe ؿ|$$_*ftcjpGO$L$Y.D$L$T$\$tx9ugu B t d{d `{d D$<L$@D$D,É $ L$D$D$ tD$$D$G e u ؿ|$AHËD$DP@L$XT$\D$`D$dD$h AHÍxD$@*ѽi@H蔹/e D$;ApDŽ$DŽ$DŽ$$$vֽ$$D$OD$ L$ $D$D$ L$$ T$D$L$ D$ѾD$D$l|$D$\Ge uD$X0D$d|$hPËD$XýѺ뙋A I$@ $D$dD$hPQe ;aXHD$PD$8L$TL$뿉кED$@H P$T$$ L$&D$@H$@ D$L$`$CD$ D$8L$L$D $'fD$L$8 e u\L$DH$@D$D$LD$ªD$ L$L$H$t$LJý$D$H$.-ĀÍxD$DI뙐-ĀË$D$`T$dD$hD$l0$L$`L$>D$ L$L$hD$ld*$D$ D$hD$D$ D$ T$D$3>e ;aDŽ$DŽ$@$D$xD$D$\ ~ $D$ZD$D$x  $D$蟌D$PL$T$$8e D$;A$D$d$D$hD$lD$p0$D$dD$D3D$ L$L$lD$p,$D$D$lD$D$ D$D$D$`L$L$\|$t$薷  $L$tL$1D$L$ $L$D$L$T$\$,S@e u C8ʼnx|$ 訁h{d l{d D$4L$8\(ÐR(ie ;aPD$\D$`D$THL$L $貽D$LD$$WD$$xD$TH8L$HL$T$X$D$'L$TQ8T$DY<\$,l$X1111D$@1@T$Dl$X|$,ω\$@L$T\$,9 9o9=D$0D$@D$8D$0l$ e \$8,u L$ 띉‰P|$(D$$L$<$L$@L$|$t$ l$=D$L$t$iL$_D$HT$4J0 e uB,}z,lpO$l돉lbL$( tiGO W\$T$$D$L$D$ D$-[D$ L$T$4B e u J|$(l$D$T$臒D$ t L$(|$4|$4bcTe D$;ADŽ$DŽ$DŽ$$$ D$PD$T0$$D$XD$ L$L$PD$T$D$D$PD$D$ D$ںD$D$HL$L$<|$p$Zp|$X1k$D$pD$D$L$ D$XL$\$$D$hL$l$$ЫD$D$D$HD$ D$pe=D$,L$0T$49u t&DŽ$$$ٺİÍʫ$a|$$$O e u.DŽ$0$$ٺİi͉к`D$@H P$T$$ L$Ѻ$D$D$LL$@Q I$T$L$ ` $ D$ D$8L$L$D $D$L$8 e L$DH$D$D$LD$VD$ L$t&DŽ$$$غİËD$L$DŽ$DŽ$`غİÍxD$D{hq>غİË$H4P0X8$L$\$ dd `d hd T$ L$\$/D$$n|$GEe u4 `DŽ$p$$׺İÍ `gNj$H8P0X4$\$L$ Td Pd Xd T$ L$\$J/D$$|$G>e u4BDŽ$p$$ֺİÍB gO/e ;aDD$H$D$LD$D$PD$|$ t$T_lnD$4L$8T$<\$@u:t@ $ЋD$L$D$|$DD$|DŽ$DÉT$|$DNWe D$;A_DŽ$,DŽ$0DŽ$4DŽ$8$ut଩$;|$$Ge u@$DŽ$,DŽ$0P$4$8ZպË$we뻋$L$TD$XD$\D$`0$T$TT$PD$L$ D$\L$`[$D$D$\D$D$ D$ҴD$D$LL$L$P$$${j|$d1e S $$L$L$ T$T$dL$h$$$(L$tT$x$ $ ЫL$D$L$PL$ L$LL$|$t$d jG7L$,T$0\$49u t1DŽ$,DŽ$0$4$8ӺÍ଩$8 |$$Ge u@$DŽ$,DŽ$0P$4$8WӺË$tc뻉ػCA I$L$$ D$W˺u9DŽ$,DŽ$0DŽ$4DŽ$8ҺÐҺÍ$$h|$|5 h$ D$|$$$$$$$ $$$$$$$S$$D$D$L$ $$$$ЫD$D$D$PD$ D$LD$|$t$|gPND$ee ;a8$D$D$D$@D$ D$DD$)DD$L$D$ L$D$<$kʺD$D$|$5p,E[l(D$,L$0T$4tE9u2u t L$HD$L8Ë{d {d D$HL$L8ÉкNjH @$I$D$HD$L8p=e ;a%x $D$$$H$H e $HD$<$L$H$L$L  $D$KD$L$ D$@L$DD$PD$TD$XD$\0$L$HL$ոD$L$ D$PL$T0$D$@D$ԸD$ L$L$XD$\J$D$ D$PD$D$ D$xD$L$L$8|$`1TD$u t$$xË{d {d $$xÉк뻋H @$I$DŽ$DŽ$xÍx$R' ;e ;a6TD$dD$hD$l$D$D$D$\D$ D$`D$D$D$@D$ L$L$ D$D$X$ L$D$|$5,W$D$,L$4T$0ta9uNu tD$dT$hD$ltTD$d{d {d D$hL$lNTÉȹ뫉D$@H P$T$$ L$^`I$D$D$PL$XD$@H$@ D$L$`$ָD$D$HL$ L$8 $CD$L$8 e uiL$HH$D$D$PD$=D$ L$u"D$PD$dD$hD$lTTD$dD$hL$l:TÍxD$HXP댋A$$@$9p"$$D$D$L$ T$\$$$$$DŽ$DŽ$0$$D$袼D$L$ $$$D$ $D$D$ D$D$L$$$5`@$$$$QXY\$$Q`Yd$$$$I$$$ $ ЫL$D$D$ $D$|$$?RD$PL$T$$É$L$p$$X1.;$:$$d7 $$`$$L$L$pL$$L$ )L$$T$T$\$$X\$-l$D$ 2L$Yis9DkiLl$\) e <څ$$$$$$X$XD$L$$$DŽ$DŽ$DŽ$ DŽ$$0$$L$D$L$ $$0$$L$边D$L$ $ $$Ͷ$D$$D$D$ D$7D$L$$N8$0$T$\$l$ t$D$L$T$$We u ˉ‰j7$7 $$L$ @ $BD$L$ $L$莖D$L$ T$\$t$$‹$$L$lT$x$t1J8$8$$5 $$|$$L$L$lL$L$xL$ 'L$$T$T$`$$tl$5t$D$ 0L$Yis9DkiLl$`)<ڋ e $$$$$$t$wD$L$$$DŽ$(DŽ$,DŽ$0DŽ$40$$L$ D$L$ $($,0$$L$ݶD$L$ $0$4Ͷ$D$$(L$D$ D$VD$L$$m5$0$T$\$l$ t$3D$L$T$$We u ˉ‰j5HL$ @ $芶D$ L$ $D$֓D$ L$T$\$tD$d$ʉ$D$t$T$|$15$@c5$@$K2 $$$$L$L$tL$L$|L$ J$L$$T$T$X$$l$51t$D$ L-L$Yis9AkiLl$X)<ڋ e $$$D$d$$$D$L$$$ DŽ$8DŽ$<DŽ$@DŽ$D0$$L$XD$L$ $8$<0$$L$)D$L$ $@$DͶ$D$$8L$D$ D$袂L$D$$2$0$T$\$l$ t$D$L$T$$We u ˉ‰m]2$G$$$Íz\+2{d {d $$Étw1qAlx{d |{d $$Íy1&$$Ëp{d t{d $$Í@$|$$D$D45e ;aD$ H0tpH8P0@4uVD$(D$$D$,É$D$L$0d 4d 8d D$ L$T$D$tWD$(D$$D$,É$$D$ Te ;adDŽ$DŽ$$ظ|$|$He t$t5D$p$D$HD$'D$L$ L$<|$L10D$HH@L$\D$`$D$D$D$lD$ D$pD$D$D$T$D$D$|D$h$D$lD$t$D$D$T$ D$$D$9u\u0u{d {d $$XÁtڋA I$@ $ЋD$8$D$<$XÉػ׼e $P;A00|$h1 $$L$t $L$p$8 PD$8L$@`ȡ$|$|$LD$8Ge D$@$D$hD$ )L$D$ |$GGe 4D$LD$h$aD$L$$JT$D$ D$ L$ܻD$L$L$D|$P1$<D$`$@D$d$4$ЫD$D$D$DD$ T$|$t$PD$4D$HL$,T$0T$($]~D$D$HL$@Q I$T$L$ ` $[D$ D$8L$L$D $~D$L$8 e L$DH$D$D$HD$D$ L$t9DŽ$DŽ$DŽ$$$ EpËD$HP@$$$DŽ$DŽ$DpÍxD$DԼKDpDŽ$DŽ$DŽ$$$tDp&e ;aDHD$XD$\D$`$޺D$D$D$PD$ L$TL$»D$L$L$ D$D$L$D$D$|$5-ټD$,L$4T$09u|u tD$XT$\D$`CHÍ`˫$||$D$TGe u&D$PD$XD$\|$`9CHËD$P\ӼՉȹzD$ID$ L$L$PD$TD$P$D$D$˜D$L$ T$L$D|$p1XǼ$(Ǽ$L$|Ļ $L$x$$ $T$D$ L$ L$@T$T$8`ȡ$\n|$|$LL$8O e qD$@$D$pD$ "L$D$ |$GGe D$LD$p$cD$D$D$ L$t9DŽ$DŽ$DŽ$$$ pËD$HP@$$$DŽ$DŽ$\ pÍxD$DzK= pDŽ$DŽ$DŽ$$$ p諘&e D$;A$$ u)$DŽ$ $$+@,$$D$.D$ L$ $D$D$L$ $ZT$D$ $$T$ \$-ɺT$D$D$L$ xD$$L$(L$X|$\5藴$L$\$$L$lT$p$$L$tT$x$$$$$$$$$ $ L$D$D$ D$XD$|$t$\SD$PL$T$ $$Í̫$V|$$$Ge u$ $$É~e ;avlD$ H PtB $ЋD$L$D$$L$(ËHD$ L$$_D$D$D$L$D$$L$(핼xe ;apDŽ$DŽ$DŽ$DŽ$DŽ$D$xD$LD$|D$P$L$Tȫ$T$LT$/,D$L$ $L$[D$ L$$4޺T$D$L$ D$D$L$L$<|$X1~D$|D$h$D$lD$t$D$D$T$ D$HLMLff e PUH8P4X0U4M8 e ]0H\M\HUe M e P,ukU,H@PD$D$LzIe ${D$LD$D$L$8 e  L$@H$|D$D$LD$܂D$ L$$=D$D$HL$L L$  $ L$D$ D$L$@ $D$*D$L$ T$\$l$$L$T$D$ D$HD$D$L$t9DŽ$DŽ$DŽ$$$tËD$HP@$$$DŽ$DŽ$JtDŽ$DŽ$DŽ$$$tËD$HP@$$$DŽ$DŽ$tDŽ$DŽ$DŽ$$$tÍxD$@赓|$L裓{htDŽ$DŽ$DŽ$$$/t{e ;a2DŽ$DŽ$DŽ$|$`$Ø|$H1  $L$`L$2L$ T$T$HL$L$$T$XL$\$ $ ЫL$D$ oL$ D$|$t$HU|eL$,T$0\$4:L$T$Xt0D$`T$dD$h$$D$dD$nĸɉ΋D$`T$Xčʫ$%|$$$O e u0Y|ʹ:?ĸIeDe ;aPL$dL$|$ 1}D$D$fD$(L$L$ fD$@$L$8L$L$L$ $D$L$ t uPË$$ܽP dWe ;av-D$D$D$D$ $@ED$wLde ;a0D$HD$$ ׽yq$v yyM軦falN72&asW莄iTV?^e@˴Dl0&$D$,6D$ L$ @{d e D{d $D$D$ L$ `{d e ;d{d $D$!ƾD$ L$ H{d e L{d .ּ$D$ 莾D$ L$ X{d e \{d $D$6D$L$ T$ $d (d e W d ĩ$D$6D$L$ T$ 4d 8d e 0d ȩ$D$R6D$L$ T$ Dd Hd e @d ̩$D$6D$L$ T$ Td Xd e aPd Щ$D$5D$L$ T$ dd hd e `d %.$D$ D$L$ P{d e  T{d ?9$D$%ԼD$L$ {d e { {d i}$D$)蜼D$L$ h{d e 1 l{d ޼$D$ dD$L$ {d e  {d /V$D$ ,D$L$ {d e  {d $D$5D$L$ x{d e S |{d r$D$輻D$L$ p{d e   t{d Q$D$A脻D$L$ {d e  {d l$D$(LD$L$ {d e u {d T $D$D$L$ {d e + {d G$D$ܺD$L$ {d e  {d  $D$褺D$L$ {d e  {d i$D$lD$L$ {d e uT {d $D$#8D$L$ {d e u {d oe Í={d n={d n룍={d n]={d n={d n={d ~n={d ln5=t{d Zn=|{d Hn={d 6nW={d $n =l{d n={d ny=T{d m/=`d m=Pd m=@d mC=0d m= d m=\{d mK=L{d |m=d{d lm=D{d \msU]e ;av/ Yu,D$@I$ыD$L$D$L$ zU븍|$9;ủ#e ;avD$D$D$D$ _8*Ue ;av|$1lmL$ L$e ;avBD$$L$L$7D$L$ $D$D$ɷD$ D$Ae ;avbD$HT$Z*09t*1Ʉt HZ9R @ 9!ȈD$1,$t$\$~L$ D$T$@e ;av: D$$L$L$WD$L$ $D$@D$D$ ?@e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$}D$ 1݉4$T$l$}L$ D$\$?qe ;av: D$$L$L$gD$L$ $D$PD$D$ O?e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$|D$ 1݉4$T$l$|L$ D$\$>qe ;avBD$$L$L$wD$L$ $D$D$ƷD$ D$W>e ;aD$HT$Z*09tJ1Ʉt@H Xj9Ëj 9!لt HZ9R@9!ȈD$11,$t$\${L$ D$T$=^e ;avBD$$L$L$g~D$L$ $D$D$ŷD$ D$G=e ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$zL$ D$T$Yu;D$t%H$L$ hD$L$ D$L$ :멍|$9;u#e ;av>Yu;D$t%H$L$ hD$L$ D$L$肼 {:멍|$9;u#e ;aD$$L$L$#{D$L$Q$D$ {D$L$Q$D$zD$L$Q$D$zD$L$Q $D$zD$L$( $D$D$8·D$ D$9Be ;abD$HT$Z*09#1ɄH Z jp91ɄHZjp91ɄHZjp9tX1ɄtNH Z$j p$9t1Ʉt@(J(8D$1,$L$\$vL$ D$T$1,$t$\$vL$ D$T$1뇉,$t$\$vL$ D$T$K1D,$t$\$cvL$ D$T$1,$t$\$:vL$ D$T$#8~e ;av: D$$L$L$xD$L$ $D$xD$D$ 7e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$UuD$ 1݉4$T$l$:uL$ D$\$&7qe ;avYD$$L$L$wD$L$Q$D$D$XD$ L$ $D$zD$D$6e ;aD$HT$(r9tY1ɄtOHZ9uAH Z 8u1JRX@9t 1D$É$L$\$ۀD$ 111Չ$l$t$tL$ D$T$5Oe ;avh D$$L$L$wyD$L$Q$D$vD$L$Q$D$yvD$L$ $D$2yD$D$ a5|e ;aD$H\$k391ɄK Sh p9tt1ɄtjKShp9t;1Ʉt1H@S[9t 1D$É$L$T$mD$ 1݉4$T$l$rL$ D$\$1뤉4$T$l$rL$ D$\$l1e$L$l$L$ D$\$)?4e ;av: D$$L$L$tD$L$ $D$tD$D$ 3e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$uqD$ 1݉4$T$l$ZqL$ D$\$F3qe ;av: D$$L$L$tD$L$ $D$sD$D$ 2e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$pD$ 1݉4$T$l$jpL$ D$\$V2qe ;avBD$$L$L$sD$L$ $D$D$舺D$ D$1e ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$oL$ D$T$1e ;avQ D$$L$L$GrD$L$Q$D$0rD$L$ $D$rD$D$ 1e ;aD$H\$k39tt1ɄtjH Pks 9t;1Ʉt1H@S[9t 1D$É$D$\$nD$ 1݉,$T$t$nL$ D$\$1뤉4$T$l$]nL$ D$\$lF01e ;aD$$L$L$qD$L$Q$D$pD$L$Q$D$pD$L$Q$D$D$FD$ L$ $D$D$ 'D$ D$/Qe ;aD$HT$Z*091ɄH Z jp9tz1ɄtpJZhp9tA1Ʉt7HZ8t 1D$ÃD$B$D$ lD$ 1Ӊ$t$L$lL$ D$T$1랉,$t$\$lL$ D$T$f1_,$t$\$lL$ D$T$#y.e ;avYD$$L$L$7oD$L$Q$D$D$ 訶D$ L$ $D$qD$D$.e ;aD$H\$k39tj1Ʉu;1Ʉt1KSX@9t 1D$É$L$\$;xD$ 1ݍHL$K $D$ fkL$ D$\$랉4$T$l$GkL$ D$\$v0-;e ;avBD$$L$L$D$,oD$ L$, $D$mD$D$,e ;aveD$D$L$ $D$,jD$ t9D$H0@,T$Z0R,9t 1D$É$D$\$TjD$ 1D,e ;av D$$L$L$mD$L$Q$D$lD$L$Q$D$lD$L$Q$D$lD$L$ $D$lD$D$ +ee ;a=D$H\$k391ɄH Pks 91ɄHPks9tt1ɄtjHSkp9t;1Ʉt1H$S$[ @ 9t 1D$É$D$T$hD$ 1݉,$t$T$hL$ D$\$1뤉,$T$t$hL$ D$\$l1e,$T$t$hL$ D$\$)1"4$T$l$_hL$ D$\$H*e ;avQ D$$L$L$kD$L$Q$D$jD$L$ $D$mD$D$ )e ;aD$H\$k39tt1ɄtjH Pk s9t;1Ʉt1KSX@9t 1D$É$L$\$ tD$ 1݉4$T$l$@gL$ D$\$1뤉4$T$l$gL$ D$\$l)1e ;av: D$$L$L$iD$L$ $D$lD$D$ (e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$rD$ 1݉4$T$l$*fL$ D$\$(qe ;avpD$$L$L$kD$L$Q$D$hD$L$Q$D$D$1D$ L$ $D$ZkD$D$'te ;aD$H\$k391ɄK Sh p9t[1ɄtQKSh9h9!ʄt1H@S[9t 1D$É$L$T$qD$ 11ى4$T$l$dL$ D$\$1넉$L$l$UqL$ D$\$H& e ;avYD$$L$L$GgD$L$Q$D$D$踮D$ L$ $D$iD$D$&e ;aD$H\$k39t[1ɄtQHP k9k 9!ʄt1KSX@9t 1D$É$L$\$5pD$ 11ى4$T$l$fcL$ D$\$R%Me ;avpD$$L$L$fD$L$Q$D$hD$L$Q$D$D$aD$ L$ $D$hD$D$$te ;aD$H\$k391ɄK Sh p9t[1ɄtQHPk9k9!ʄt1KSX@9t 1D$É$L$\$nD$ 11ى$L$l$nL$ D$\$1넉4$T$l$aL$ D$\$H# e ;avpD$$L$L$wdD$L$Q$D$0gD$L$Q$D$D$ѫD$ L$ $D$fD$D$)#te ;aD$H\$k391ɄK Sh p9t[1ɄtQHPk9k9!ʄt1KSX@9t 1D$É$L$\$7mD$ 11ى$L$l$mL$ D$\$1넉4$T$l$E`L$ D$\$H." e ;aD$$L$L$eD$L$Q$D$bD$L$Q$D$eD$L$Q$D$neD$L$Q $D$D$D$ L$Q($D$hbD$L$0 $D$D$٩D$ D$H!#e ;aD$HT$Z*09c1ɄRJ X hr91Ʉ HXjr91ɄHXjr91ɄJ Z$h 9h$9!˄t`H,X(j,r(9t11Ʉu 1D$ÍJ0L$0$D$S^D$ ׉$t$L$<^L$ D$T$11몉$L$l$jL$ D$T$R1K$L$l$jL$ D$T$ 1,$t$\$]L$ D$T$14$L$\$JjL$ D$T$}>e ;aD$$L$L$3`D$L$Q$D$`D$L$Q$D$`D$L$Q$D$bD$L$Q $D$bD$L$Q($D$D$HD$ L$Q,$D$D$)D$ L$4 $D$RbD$D$ e ;aD$HT$(r91ɄrH Xj r9<1Ʉ+HXjr91ɄJZhp91ɄJ$Z h$p 9tk1ɄtaH(Z(8uQH,X0j,9j09!˄t1J8X8@4R49t 1D$É$L$\$!hD$ 111Չ$L$l$gL$ D$T$u1n$L$l$gL$ D$T$21+4$\$l$ZL$ D$T$14$\$l$ZL$ D$T$1$l$t$ZL$ D$T$]e ;avYD$$L$L$G]D$L$Q$D$D$踤D$ L$ $D$_D$D$e ;aD$H\$k39tI1Ʉt?HS9u1KS X@ 9t 1D$É$L$\$GfD$ 11ى4$T$l$xYL$ D$\$d_e ;avBD$$L$L$D$蟣D$ L$ $D$^D$D$e ;avJD$T$8u1JRX@9t 1D$É$L$\$OeD$ 1e ;avQ D$$L$L$^D$L$Q$D$^D$L$ $D$]D$D$ e ;aD$H\$k39tt1ɄtjH Pk s9t;1Ʉt1HS[@9t 1D$É$L$T$KdD$ 1݉$L$l$0dL$ D$\$1뤉$L$l$ dL$ D$\$lF1e ;aD$$L$L$\D$L$Q$D$YD$L$Q$D$\D$L$Q$D$\D$L$Q $D$D$/D$ L$Q($D$YD$L$0 $D$D$ D$ D$h#e ;aD$HT$Z*09c1ɄRJ X hr91Ʉ HXjr91ɄHXjr91ɄJ Z$h 9h$9!˄t`H,X(j,r(9t11Ʉu 1D$ÍJ0L$0$D$ sUD$ ׉$t$L$\UL$ D$T$11몉$L$l$aL$ D$T$R1K$L$l$aL$ D$T$ 1,$t$\$TL$ D$T$14$L$\$jaL$ D$T$}>e ;av: D$$L$L$WWD$L$ $D$@WD$D$ ?e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$SD$ 1݉4$T$l$SL$ D$\$qe ;aD$$L$L$cVD$L$Q$D$LVD$L$Q$D$5VD$L$Q$D$XD$L$Q $D$D$菝D$ L$Q$$D$D$pD$ L$, $D$XD$D$#e ;a{D$HT$(r9<1Ʉ+H Xj r91ɄHXjr91ɄJZhp9tk1ɄtaH Z 8uQH$X(j$9j(9!˄t1J0R,X0@,9t 1D$É$L$\$^D$ 111Չ$L$l$l^L$ D$T$u1n4$\$l$QL$ D$T$21+4$\$l$jQL$ D$T$1$l$t$AQL$ D$T$*ee ;aD$$L$L$SD$L$Q$D$SD$L$Q$D$SD$L$Q$D$nVD$L$Q $D$D$D$ L$Q$$D$D$D$ L$, $D$VD$D$H#e ;a{D$HT$(r9<1Ʉ+H Xj r91ɄHXjr91ɄJZhp9tk1ɄtaH Z 8uQH$X(j$9j(9!˄t1J0R,X0@,9t 1D$É$L$\$\D$ 111Չ$L$l$[L$ D$T$u1n4$\$l$OL$ D$T$21+4$\$l$NL$ D$T$1$l$t$NL$ D$T$ee ;av: D$$L$L$gQD$L$ $D$ TD$D$ Oe ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$ZD$ 1݉4$T$l$ML$ D$\$qe ;av: D$$L$L$wPD$L$ $D$0SD$D$ _e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$YD$ 1݉4$T$l$LL$ D$\$qe ;avYD$$L$L$OD$L$Q$D$D$D$ L$ $D$!RD$D$Pe ;aD$HT$(r9t[1ɄtQHZ8uAH Z 8u1JR X@ 9t 1D$É$L$\$yXD$ 111Չ$l$t$KL$ D$T$ Me ;avBD$$L$L$D$ϕD$ L$ $D$PD$D$' e ;avZD$T$8uAJX8u1JXR@9t 1D$É$L$D$sWD$ 11 e ;avYD$$L$L$gMD$L$Q$D$D$ؔD$ L$ $D$PD$D$0 e ;aD$H\$k39tK1ɄtAHS8u1KS X@ 9t 1D$É$L$\$eVD$ 11ى4$T$l$IL$ D$\$ ]e ;avYD$$L$L$7LD$L$Q$D$D$訓D$ L$ $D$ND$D$ e ;aD$H\$k39tK1ɄtAHS8u1KS X@ 9t 1D$É$L$\$5UD$ 11ى4$T$l$fHL$ D$\$R ]e ;av: D$$L$L$KD$L$ $D$MD$D$ e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$5TD$ 1݉4$T$l$jGL$ D$\$V qe ;av: D$$L$L$JD$L$ $D$LD$D$ e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$ESD$ 1݉4$T$l$zFL$ D$\$fqe ;avYD$$L$L$KD$L$Q$D$ID$L$ $D$D$聐D$ D$e ;aD$HT$Z*09tX1ɄtNJ X hr9t1ɄtJ@8D$1,$t$\$lEL$ D$T$14$L$\$QL$ D$T$5Pe ;avQ D$$L$L$GD$L$Q$D$GD$L$ $D$JD$D$ e ;aD$H\$k39tt1ɄtjH Pk s9t;1Ʉt1KSX@9t 1D$É$L$\$PD$ 1݉4$T$l$0DL$ D$\$1뤉4$T$l$ DL$ D$\$l1e ;aD$$L$L$ID$L$Q$D$lID$L$Q$D$UID$L$Q$D$D$D$ L$Q$D$D$׍D$ L$ $D$ID$D$/:e ;aAD$HT$(r91ɄH Xj r91ɄHXjr9tx1ɄuI1Ʉt?JX9u1H$@ Z$R 9t 1D$É$L$\$%OD$ 11ٍJL$H $D$LBL$ D$T$됉$L$l$NL$ D$T$h1a$L$l$NL$ D$T$%1,$L$t$NL$ D$T$e ;avxD$$L$L$wDD$L$Q$D$D$苷D$ L$Q$D$D$ɋD$ L$$ $D$FD$D$!le ;aD$HT$(r91Ʉt~HZ9upH Z 8t;1Ʉt1J(R$X(@$9t 1D$É$L$\$AMD$ 1ݍHL$J $D$l@L$ D$T$11떉$l$t$E@L$ D$T$X.e ;avpD$$L$L$BD$L$Q$D$BD$L$Q$D$D$AD$ L$ $D$jED$D$te ;aD$H\$k391ɄtzH Pk s9tK1ɄtAHS8u1KSX@9t 1D$É$L$\$KD$ 11ى4$T$l$>L$ D$\$1딉4$T$l$>L$ D$\$\e ;aD$$L$L$D$ 눷D$ L$Q $D$DAD$L$Q($D$-AD$L$Q0$D$D$螈D$ L$Q@$D$D$L$L $D$CD$D$:e ;auD$D$L$ $D$ =D$ :D$H$P \$k$s 91ɄK,P,h(s(91Ʉ1Ʉt}KDPDh@s@9tN1ɄtDKHPH9t1HPSP[L@L9t 1D$É$L$T$ID$ 11É,$t$T$<L$ D$\$1렍K0L$H0 $EL$D$\$W,$t$T$<L$ D$\$+1$$t$L$f<L$ D$\$D$\$1@ke ;avpD$$L$L$AD$L$Q$D$>D$L$Q$D$D$QD$ L$ $D$zAD$D$te ;aD$H\$k391ɄtzK Sh p9tK1ɄtAKP8u1H@S[9t 1D$É$L$T$GD$ 11ى4$T$l$:L$ D$\$1딉$L$l$GL$ D$\$\e ;aD$$L$L$D$D$ L$Q$D$$@D$L$Q$D$ @D$L$Q$D$?D$L$ $D$@D$D$Ye ;a"D$T$9JX8J Xjp 91ɄJZhp9tt1ɄtjJZhp9t;1Ʉt1J$X$@ R 9t 1D$É$L$\$DD$ 1݉$L$l$EL$ D$T$1뤉$L$l$EL$ D$T$l1e,$L$t$EL$ D$T$)1"1e ;avBD$$L$L$D$D$ L$ $D$X;D$D$We ;avHD$T$9u1H@ZR9t 1D$É$D$\$8D$ 1e ;av: D$$L$L$:D$L$ $D$`=D$D$ e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$CD$ 1݉4$T$l$ 7L$ D$\$qe ;av: D$$L$L$9D$L$ $D$pD$ 1݉4$T$l$j1L$ D$\$Vqe ;av: D$$L$L$4D$L$ $D$6D$D$ e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$E=D$ 1݉4$T$l$z0L$ D$\$fqe ;av7 Yu4D$t$D$L$L$D$ t 밍|$9;uĉ#e ;avBD$$L$L$5D$L$ $D$D$8zD$ D$e ;avbD$HT$Z*09t*1Ʉt JX9R @ 9!ȈD$14$L$\$;L$ D$T$'e ;av. Yu+D$@L$ $ЋD$L$L$ D$$ 빍|$9;u͉#e ;avBD$$L$L$D$yD$ L$ $D$84D$D$ge ;avHD$T$9u1JRX@9t 1D$É$L$\$:D$ 1e ;av* Yu'D$$D$L$L$D$ 뽍|$9;uщ#e D$;AvNYuH$1$ $t$|$` $t$` ļ7땍$9;u#e ;av* Yu'D$$D$L$L$D$ 뽍|$9;uщ#e ;av* Yu'D$$ȅD$L$L$D$ 뽍|$9;uщ#e ;av2Yu/D$$D$L$T$ L$ D$$T$(7뵍|$9;uɉ#e ;avJYuGD$ $D$,D$D$0D$D$4D$ D$L$T$D$8L$ud $膱D$$D$̻se ;a+$薌D$D$<$PT$P|$Xԓd T$81l$(]l$8D$<9}z-Гd 5ԓd 9+\$(D@I$ыD$$9D$XËD$0HD$hL$lD$pD$tO>XÍxD$,mλ#|$0[λ >XǶe ;adD$hHP$L$L$lL$ D$L$T$\$ tvtID$\D$`L$\D$`.Ӽ$D$ D$\D$D$ D$*D$L$D$TL$XD$h@ $D$TD$dÉT$\$,.غ@B$i@BщL$QL$ AT$\$,ND$ $\$T$qD$ D$0L$L$$T$T$(z$[u|$D$$GD$(Ge D$0G GGD$h$ L$|$vD$L$T$\$ u!х ʄdttBD$LD$PD$LL$PU.$D$D$LD$D$ D$D$L$L$DD$HD$h@ $D$DD$!dÉ닋D$0˻D$<D$@`&D$<ĈD$@*Խ$D$0D$e ;a$D$D$D$ D$D$D$ $D$,D$D$0D$D$4D$ ãD$L$D$L$ D$($D$D$D$D$8D$<D$@$Ie ;aTD$ L$X $D$AL$XQ D$ Y|$$1D$D$fD$,T$$L$ L$(fD$D\$ L$ uD$0L$41@)uh ΋e ;aFe vu  Fe 荤蘐n)zu谟|氾V$D$ ` $D$D$ }|$ Ge )f`$L$L$D$||$ Ge &`$L$L$D$||$ Ge .`$L$L$D$c||$ Ge <V`$D$D$D$$||$ Ge ^D$sd  $ID$ Ȉ$D$D$臢D$ $[e L$j d  $uID$ ̈$D$D$1D$ $e L$ d  $ID$ Ј$D$D$ۡD$ $诰e L$ d  $HD$ Ԉ$D$D$腡D$ $Ye L$2 d  $sHD$ ؈$D$D$/D$ $e L$ d Se $ sd @$D$߶e L$uc sd @$D$߶e L$u* sd |"Fe Í=sd *͍=sd 딍=sd X=d *=d 螻=d ֞Z=d Ğ=d 貞^袞=sd D$蓞V胞.sm&cfSɆe ;avD$@D$~虆e ;avD$@D$~ie ;avD$@D$.9e ;avD$@D$D$醁e ;av D$@D$D$D$y蹅e ;avD$@D$~艅e ;avD$@D$nYe ;avD$@D$)e ;av D$@D$D$D$ ^鄻e ;avD$@D${蹄e ;avD$@D$^{艄e ;avD$@D${Ye ;avD$@D$.)e ;avD$@D$le ;avD$@D$΀Ƀe ;avD$D${蚃e ;avD$D${je ;avD$D$/|:e ;avD$D$D$~e ;avD$D$D$D$vʂe ;avD$D${蚂e ;avD$D$|je ;avD$D$}:e ;avD$D$D$D$ o~e ;avD$D$yʁe ;avD$D$ox蚁e ;avD$D$yje ;avD$D$?}:e ;avD$D$i e ;avD$D$}ڀe ;avBD$$L$L$D$ D$ L$ $D$xD$D$we ;avHD$T$9u1H@ZR9t 1D$É$D$\$!D$ 1e ;avYD$$L$L$D$ OD$ L$Q $D$D$L$ $D$D$D$e ;aD$T$9HXjr99!˄tjHX jr 9t;1Ʉt1HZR@9t 1D$É$D$\$D$ 1݉4$\$l$ܼL$ D$T$11~;e ;av: D$$L$L$wD$L$ $D$PöD$D$ _~e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$ǶD$ 1݉4$T$l$ڻL$ D$\$}qe ;avLYuID$t3H P@$D$T$L$ ]D$L$D$ L$$d ]}뛍|$9;u#e ;av1Yu.D$ t$L$D$L$ |붍|$ 9;uʉ#e ;avJD$$L$L$D$/D$ L$ $D$D$D$ D$|e ;avPD$T$8u7JX8t 1D$ÃD$B$D$D$ 1 |e ;avYD$$L$L$D$ OD$ L$Q $D$証D$L$ $D$D$D${e ;aD$T$9uxHZhr99!لtXHZj p 9t)1Ʉu 1D$ÍJ $D$D$߉,$t$\$L$ D$T$11zQe ;avBD$$L$L$D$ D$ L$ $D$xD$D$wze ;avhD$T$9uQHXjr99!˄t1H@ ZR 9t 1D$É$D$\$D$ 11y|e ;av2Yu/D$$D$(D$D$,D$D$0D$ qy뵍|$9;uɉ#e ;avBYu?D$$D$0D$D$4D$D$8D$ D$Yu;D$@L$T$,T$T$0T$ $ЋD$L$ L$4D$8f멍|$9;u#e ;av&Yu#D$ @L$ $ЋD$D$ e|$ 9;uՉ#e ;avYuD$@ L$ $Ѓ{eɍ|$9;u݉#e ;avBD$$L$L$D$D$ L$ $D$D$D$ee ;avrD$T$9u[JX9uMHZ9u?H Z 9u1H@ZR9t 1D$É$D$\$蓢D$ 1111wdre ;av: D$$L$L$7D$L$ $D$ D$D$ de ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$赡D$ 1݉4$T$l$蚡L$ D$\$cqe ;av:1L$"D$ \$؉$L$L$D$ @|ىL$/ce ;aD$$L$ 1ST$l 4t$< t9t^ttD$(Ëlt | T 9t؉<$l$t$舠T$ D$$L$ \$벉T$<$D$D$l$Zl$ D$$L$ T$\$rD$(/b e ;a,D$0@I$ыD$L$D$L$ D$$D$(0$D$D$PD$L$ D$$L$(X$D$D$$D$D$ D$D$L$L$4D$8,iaDe ;a,D$0@I$ыD$L$D$L$ D$$D$(0$D$D$D$L$ D$$L$(n$D$D$$D$D$ D$D$L$L$4D$8,`De ;a8|$L1xL$< $L$DL$L$L$ L$T$T$4Y l$@l$l$Dl$l$Hl$ $ӋL$ $L$4L$t$|$ m}|$Lt$ `}8_Te ;avr4|$@1KxL$8 $L$Yu;D$t%H$L$D$L$ D$L$ö {A멍|$9;u#e ;av>Yu;D$t%H$L$KD$L$ D$L$ö A멍|$9;u#e ;avxD$$L$L$D$?ɶD$ L$Q$D$蘁D$L$Q $D$D$ ɶD$ L$ $D$bD$D$a@le ;aD$T$8HXjr9tj1Ʉu;1Ʉt1H$@ Z$R 9t 1D$É$D$\$}D$ 1ݍJ $H L$D$}L$ D$T$랉4$\$l$}L$ D$T$v1oy?$e ;av>Yu;D$t%H$L$D$L$ D$L$" ?멍|$9;u#e ;a$1L$ AL$49}XD$ L$0Zl$(,$t$,t$=|$=@e |$ T$\$dbD$L$tD$^e ;a< ʡ$ D$D$8 3 $D$D$D$L$ T$ L$0D$$T$(\$@$l$Dl$t$8t$D$ D$ԚD$L$D$8T$H8ta\$$kt$(9|$0늈L$#3$L$0L$\$t$ l$|$D$t$hD$8L$#T$H\$$>D$0D$LD$$D$PD$(D$TD$XD$\<Ëd 9t$D$LD$PD$TL$XD$\<ÉD$4L$, $D$d T$kD$ u D$4L$,D$LD$PD$TD$,D$XD$4D$\iD$$$t$l$\$ L$jD$L$T$\$0S e uCڋ|$,͉ƋD$$냍{B>y8>VL$8T$<(D$8D$<(&e $0;AP`$/D$D$8 3 $D$D$D 3 $D$D$H 3 $D$D$< 3 $D$D$@ 2 $D$D$L$13> @$T$<$$\$@$$l$D$$t$H$ $|$8wD$$wH$5q$ wL$$$(wP$,$0wT$4$8OX$< `$@$D $HL$L$L$T~64$|$$t$D$ D$ D$L$L$< L$ T$@|$x1<ʚ;L$ 1ۉ́wL$4$<$<$$L$4$w$ c $$$OA$$L$(fD$ $T$$X\$T$D$L$t DŽ$\$`$dPË$T$$XD$D$8D$L$(L$ D$L$T$8$\$`$dPË$TH$L$D$L$T$ u&f ËT$8Zaf@ÈZ`D$L@ DŽ$\$`$dPÍ$|$D$dD$;T$8\$,$D$D$ʚ;D$ D$L$ȉD$нʚ;l$,)ŋ\$Ήكiʚ;)Ǹȅ!ʅ „t#ʚ;L$1T$8މ͉^L$\$H+$|$D$xD$;1T$8T$0$D$D$ʚ;D$ D$L$ ȉÉнʚ;|$0)Njl$Ήiʚ;ыT$0)¸ȅ!ʅ „t ʚ;1ىT$@d1T$89DŽ$\$`$dP?e ;aD$ Hv{u^D$$D$L$T$ \$u2T$$J e uBD$,D$0Íz6T$,\$0ËЊd Ԋd D$,L$0ËD$$D$(%fD$L$ D$T$\$v$e ;a;HD$LP $T$2D$L$T$D$LHYI)х9L$ \$DP$T$D$D$ L$T$\$l$tD$PD$T\$Xl$\HÍ\$$$D$L$T$ {%D$L$D$ L$$D$DD$D$ D$#D$L$D$PL$TD$XD$\H11=D$PD$TL$XD$\HQ ze ;a$($)ݶD$D$ 3 $L$0ɉL$L$D$L$ T$|$WGe D$ D$$D$ |$$D$,H$L$D$ D$D$ D$D$L$tD$4D$8D$D$L$T$|$DŽ$$$|ÍxD$0"{ Fe ;a D$$H$L$D$D$L$ T$\$l$$L$D$T$ D$L$$L$D$D$ @ՠD$L$T$\$uV ȄuD$0D$4 ËD$(@D$$D$,D$|$ 5e &뺉L$0T$4 É\$0l$4 ^ e ;a$D$(H$L$D$L$T$ \$,t T$0L$4$D$D$ `D$CD$ D$(@ $D$D$D$D$ D$D$L$D$0L$4$De ;aG0$IȶD$D$#Eg@@ܺ@ vT2@@T@X@\D$ D$$D$(D$,L$4L$ L$8L$$ @ $ L$D$>D$ L$D$(L$,D$ $D$D$BvD$ D$L$L$6$tǶD$L$ e u;L$H H e uL$H D$<0Íx D$xD$.e ;aD$ ^ 9utL$ $D$D$ L$uLD$$L$L$WD$L$ t D$L$ ËD$$ D$L$D$L$ ÉL$D$ ËԊd Њd L$D$ fAe ;a8L$@QT$|$ 1  $ c L$)L$ T$T$ L$$L$@ L$ 3 $衝L$ T$T$(L$, 3 $L$L${L$ T$T$0L$4L$<I$L$L$ L$D$ D$L$T$L$DT$H8ue ;a,D$4H PX\$ T$$L$(  $L$ L$舡D$ L$ $D$D$4HL$@D$1\$SD$L$9}eT$D$\$0$D$pD$L$ u2D$@L$0 $>D$jD$L$ tD$8L$<,ÉD$8L$<,D$8D$<,me D$;AL$Hat!Ԋd Њd $$İH`u׍HL$$ $D$L$ T$\$D$ L$$$H0L$$ $D$L$ T$\$yD$(L$,$Z\ jG f\$T$DD$HD$L|$P1 3 $l$ l$蚶L$ T$T$PL$T 3 $T$$T$šL$T$ L$XT$\ 3 $T$(T$蜚L$ T$T$`L$d 3 $T$,T$vL$T$ L$hT$l$QDT$ 3$JL$ T$T$pL$t$QHT$ 3$L$ T$T$xL$|$QLT$5$L$ T$$$$QPT$ 3$L$T$ $$$QTT$ 3$莙L$T$ $$$QXT$ 3$\L$ T$$$  $T$DT$萚L$ T$$$ 2 $L$fL$蒘L$ T$$$$Q$T$T$PT$D$ D$ \L$T$t$$İË$H@L$D$$ D$ L$T$D$8L$ ى ʉс€׃ !ф?|$Pt$lL$TT$P  щʁ€׃ n…!х фt(d Ċd D$pD$tD$xL$|dÍ|$t$lL$T$ ډ щʁ€׃ ʚ;?؉=iʚ;ځ=!˅ ˄9|$(t$lrD$,L$(tM   n<$t$l6 $D$p?L$tD$xD$|dËD$0ċl$ L$-\$\L$XD$pD$tD$xD$|d1 T$Dl$HR]e ;a cD$D$$D$D$D$()A؉D$ SD$$@IT$\$l$l$\$T$ $ыD$L$D$,L$0 Ze ;a0D$4HP ID$D$D$ $ыD$L$T$L$$T$(D$,D$D$ $D$$D$D$L$ D$L$ D$4@ $D$D$D$D$ D$"D$L$L$8D$<0$e ;av D$D$e ;avYL$T$ 9sC\$,e ;a@D$DHL$ۺ)e ;av5L$D$D$D$D$}D$L$ L$ D$$ںe ;av D$H Hںe ;aS$D$(H J@ $ЋD$L$T$ \$-d 9tL$,D$0T$4\$8$ÉD$L$T$\$ $\$d D$$D$ D$(PI@ $Ћ|$(OWIOJOe ȅu.<$ D$L$T$ \$D$,L$0T$4\$8$͋D$L$T$\$ d d D$,D$0D$4L$8$ V U Bٺe ;av5M$D$D$D$D$}D$L$ L$ D$$غe ;avCD$HL$D$ 1#T$ ЋI[ $ӋD$PD$ L$9|كغe ;aW$D$4D$8D$(L$,L$$PT$WD$(HT$,$ыD$L$T$ \$ $\$T$0ЋD$ L$td 9tL$4D$8#_$ÉD$L$ $D$d T$a"D$ u D$L$D$4D$8^$Ë d 9tT$4D$8^$ÉD$ T$$D$ d L$!D$ u D$ T$D$4D$8q^$Ðg^$׺e ;avoD$HPI$ыD$L$ T$u6D$L$$D$tċD$D$D$ D$$D$T$ L$$zֺue ;a9$D$0D$4D$(D$$ RL$UD$($D$L$ T$d 9u~$T$,ЋD$L$td 9tL$0D$4]$ÉD$L$ $D$d T$V D$ tD$0D$4\$ËD$L$룉T$0L$4\$ÉD$L$ T$$L$d D$D$ uD$L$ T$0u\$պe ;avD$H@I$уԺe ;avRD$H P9}s9AH T$D$ D$Ëd d D$L$ D$>P gԺe ;av50M$D$D$D$D$D$L$ L$ D$$Ժe ;aK D$0D$4D$$L$(L$$PT$VSD$$HT$($ыD$L$T$ u~$T$,ЋD$L$tɋd 9tL$0D$4Z ÉD$L$ $D$d T$D$ u D$L$D$0D$4tZ Ëd 9tL$0T$4XZ ÉL$T$ $T$d D$D$ u L$T$D$0D$4 Z ÐZ Һe ;av D$HH ~Һe ;aD$ H T$(T$T$,T$T$$$ыD$L$T$ tT$0L$4D$8ÅtD$ $D$$D$T$D$ 3D$L$T$D$0L$4T$8Ѻ]e ;aD$(L$,L$ Q X$@ D$\$D$$$ҋD$L$T$ tD$0D$4L$8ËD$ $D$$D$T$D$,@D$ hD$L$T$D$0L$4T$8Ëd d D$0L$4D$8ÉD$0D$4D$8к e ;ame vuO me 2Jc$D$ 3D$L$ d e uT d |$D$2D$L$ d e u d me Í=d s=d dϺe ;ae vuN e "-訬D$ $ ؅d e ܅d R$L$Ѕd e uo ԅd wd wd d e u@ąd 0c 4c ȅd e u̅d e Í=̅d k=ąd ^빍=ԅd O눍=܅d BVκe ;at3$$D$D$jD$L$T$ $9tD$L$ T$0l$|9t$l$\$$D$%D$D$,L$xL$T$0T$ T$T$T$ T$D$$LT$D$8D$<D$@D$xHP I$ыD$D$4|$D1D$$D$(fD$LD$,D$DD$8D$HfD$dD$4D$\D$$D$D$D$D$ND$ t<ucD$xH@ I$ыD$L$DŽ$$$tËD$8L$@T$<$$$tÉ ̺(e ;a3$$D$D$臟D$ D$8L$L$T$T$ $D$ $D$D$4$L$T$8T$ \$\$l$ l$D$$-Ll$߸D$DD$HD$L$HP I$ыD$D$@|$P1XD$,D$0fD$XD$4D$PD$DD$TfD$pD$@D$hD$,D$D$P$D$LD$ urD$HL$LT$D$l$9~SD$(L$Yu;D$t%@ $D$D$L$ D$L$> 멍|$9;u#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8芻똍|$ 9;u#e ;avNYuKD$ @L$$T$(T$T$,T$T$0T$ $ЋD$L$T$T$4D$8L$< 뙍|$ 9;u#e ;a( $zD$D$$111[L$l$,t>|$vt$ $T$\$D$@L$ $ЋD$$$dD$HD$$l$09|tJH X@9wH$)ȉ!ЉD$)ˉ\$l$ D$L$D$8L$<(ù귺6 ﹺe ;av(D$H9sL$D@L$D$x5 衹e ;avFD$H9s1L$DI@$ыD$L$ T$T$ D$$L$( 5 3e ;av> D$H9s)L$DI@$ыD$L$L$D$ 4 ۸e ;av7D$H9s"L$ DI@$D$D$Y4 肸e ;avVD$ H9sAL$DI@$ыD$L$ T$\$l$l$(D$,L$0T$4\$83 e ;avFD$H9s1L$DI @$ыD$L$ T$T$ D$$L$(3 賷e ;a@(D$0L$Yu;D$t%HP$L$T$dD$ D$"6 멍|$9;u#e ;avEYuBD$t,HP$L$T$D$ L$D$L$ 5 褳뢍|$9;u#e ;avEYuBD$t,HP$L$T$$D$ L$D$L$ ;5 4뢍|$9;u#e ;avMYuJD$t4HP$L$T$D$ L$T$D$ L$$T$(4 輲뚍|$9;u#e ;avEYuBD$t,HP$L$T$tD$ L$D$L$ K4 D뢍|$9;u#e ;av D$D$e ;aL$T$9sj\$ ,ˋEu|L$9sQ4$ˉT$2Ru-e Lu$$\$e uÉɺÉȺ<- e`e ;a$D$4L$,9L$(@R$ҋD$L$T$8\$,9D$L$ D$(Ћ@I$ыD$L$T$9t9\$ $T$L$D$ wD$}D$<$øD$L$D$ $T$D$ t1NjD$L$T$>, ge ;a!8D$<@L$@ $ЋD$L$T$ \$l$T$ \$l$(l$,\$0T$4P$D$,D$MLD$D$L$ L$$ ױ$oD$L$ e ulL$$H 0| $D$r;@$to|$D$GD$ Ge uD$(|$DD$HD$L8ËD$(ƺݍxD$$ƺD$DL$HD$L8$e ;a4 $nD$D$ $D$[DD$8HI11ڋ@I$ыD$L$L$$D$(D$,D$00$L$$L$ GD$L$ D$,L$0$D$L$,L$D$ D$D$L$T$ $D$L$D$HD$8ĝ|/L$D$ $\$T$D$8H\$9wD$ $D$]9D$ tJH X@9wH$)ȉ!ЉD$)ˉ\$l$ D$L$D$e vuz+ e L(M e e ;av=Yu:D$t$HP$L$T$D$ D$- 蜫몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$D$D$("- 뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$, 褪뢍|$9;u#e ;a,D$0t6tuB˺D$4D$8,ÍʺD$4D$8,ÍO˺D$4D$8,D$$D$( `J $D$AD$L$ D$$L$( $D$D$$D$D$ D$D$L$D$L$ 0$D$D$,BD$L$ $L$84 聩e ;aD$ t]t?@ tD$$D$(D$,D$$D$(D$,D$$D$(D$,ËP t똍$D$!D$D$ D$D$L$D$$D$(L$,薨!e ;av-|$1|$L$L$L$L$ L$ L$$Le ;av-|$1|$L$L$L$L$L$ L$e ;aH8D$<$[D$L$T$ D$D$DL$D$L$ D$(L$,0$D$ D$?D$L$ D$0L$4޺$D$D$(D$D$ D$4D$L$L$TD$X8ËD$HL$LT$P$L$T$D$ L$!tA $T$D1 荦e ;a D$$HPj9?JHR<Ëe u t$(ú Íx$|$D$(D$x$\$T$L$ l$gzD$L$T$|$$We u ʉÉyHYu;D$t%H$L$D$L$ D$L$r k|멍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$ {멍|$9;u#e ;av>Yu;D$t%H$L$KD$L$ D$L$ {멍|$9;u#e ;av8 Yu5D$t$D$L$L$D$ ( !{믍|$9;uÉ#e ;av>Yu;D$t%H$L$D$L$ D$L$ z멍|$9;u#e ;av7 Yu4D$t$D$L$L$D$ Y Rz밍|$9;uĉ#e ;av7 Yu4D$t$bD$L$L$D$  y밍|$9;uĉ#e ;av?D$ L$T$1E}tLC9} ,11׉T$ye ;aFPL$TQQYy|$Ll$\9~yT$@l$X9t,$\$T$螘L$TQ Yit$@9)i)Q -e !uAt$dD$hD$lPË|$LC݉냋$tD$L$ T$\$l$t$%u =D`D$\9ЉL$0D$@\$yÍyD$D0y뛍yD$8"ypxD$@yx$xyD$0xx$xxD$LxADŽ$DŽ$$$DŽ$DŽ$$$`{e ;av>e vu߷ e l}"}ڻe {`e ;avaD$$L$L$D$D$ L$Q$D$裵D$L$ $D$D$D$ D$_e ;avcD$T$9uLHXjr9t1Ʉt@ J 9D$14$l$L$>L$ D$T$1v_e ;aNL|$X1w @ $L$PL$T$TT$L$T$\$ t|$X1w\$XT$\LËL$PP9D$TuP| 0뼍 $D$D$ 3 $D$D$1D$L$ L$T$|$ 1vL$L$ T$$\$(L$PL$,L$TL$0D$DD$H e u|$t$ c{D$U $D$D$L$ L$x1ո^e ;a +D$$Ph  P  XP PPD$$PL$(9PI$ыD$L$ d \$9t8tT$$Be uJD$,D$0 ÍztD$\$L$$L$d T$٧D$ t ̍d ȍd \$닋\$L$D$z !\$p t$x)ʉPB !؉t$ !Ɖ ! !\$,\$!ËD$(Hٽ ! ! ŋD$!݉l$0 [\Ve ;av#D$$D$D$'D$D$\e ;av( D$$D$D$D$ [e ;avD$H@D$L$ [e ;avE$ܻD$D$D$ D$ D$$D$MaD$L$D$(L$,4[e ;aD`5$D$D$$L$H $L$LL$}t$|$(*xe u#|$$t$(xD$PD$$D$TDÍ$D$$D$L$(L$uZYe ;aKD$L$ $D$D$hD$$D$D$HσL$Ai¶A,89D$$D$(ÉD$ 3 $D$,D$ L$T$\$8< e u4먍4 q뛍D$$D$(ÍD$$D$(É$D$D$=ZBu D$D$$D$(Ye ;aD$ H0H(tP$L$$L$L$(L$L$,L$ D$L$T$\$ k[tD$0l$4\$8ÉӉ$D$D$L$ T$ Zjt uB(D$0\$4l$8É͉ڋd d D$0L$4D$8!X e ;a#D$ L$T$1ۋ\9v4T9\u\u ǁTC벋HD@9,@PEPXu薉\ǁXXTЖ9u EX9ÉTs8T$C)ǁX9ۉ\$ËPH9ҷ ҷ ҷ Ve ;a:0D$4$L$8L$T$T$xzT$tl$@t$($$\$4D$8L$|D$tL$@$2|$099l=9xD.T. .l.$$$$G1ɉL$xD$0$$\$`L$fsTD$8uFf !=  L$| $$ĴËT$4빋T$8$k,t$|)9efL$&$D$P13ЕȕT4BT4GFL$8$L$&T$8$9}!c48m9rC1҉ы\$9\$,|$8CF fDJf11Ʌuuu,lfElt$0T2fUf\$TL$XD$\<É4$D$4D$l$D$$D$ D$P@D$L$D$T$\$,l$8lfUf\$TL$XD$\<Él$ 4$T$L$D$LD$ D$PHL$D$L$T$\$,|$8,fUT$Dl$ t$@"G @ 9 b=Me ;avyD$=Q 3 $D$D$ D$L$T$ \$1E9}9rT$ L$$D$(豸 0$0D$wǷ Yu;D$t%H$L$D$L$ D$L$R K:멍|$9;u#e ;avYD$$L$L$}D$L$Q$D$D$ hµD$ L$ $D$}D$D$9e ;aD$HT$Z*09ti1Ʉt_JZ h 9Ëh9!˄t?JX9u1HZ@R9t 1D$É$L$T$ۃD$ 111Չ4$L$\$踃L$ D$T$w8Yu;D$t%HP$L$T$D$ D$¸ 6멍|$9;u#e ;av D$~6e ;av D$P6e ;av D$ 6e ;aC03$D$D$D$L$ T$T$$Z99-D,l$4mD$,D$,D$-D$.D$/j9w89\$,\ L$8l$D$Jtzd 9tBJ$$|É$L$d D$qqD$ t0 ȍd ̍d $J e uB뤋|$D >뙋$B D$4J!L$0Z"\$,j#l$($4$$|$$|$ZD$4L$0 D$, ȋL$( D$ 9t@ wd wd $Je uB$$|Ë|$DU=㋌$l$#v|$DÉ5=É%=T{= P$9$u8H|- =$ e u Bz< $ D$D$< 3 $D$D$D$L$L$$T$ |$P1]=T$PD$$D$T\$X$D$\$D$`D$tD$xe u|$׸;IT$@\$8 o$|$B1T$@\$8.$e ;avC$D$($D$,D$D$D$ D$D$D$D$0$#e ;avS$D$($D$,D$D$0D$D$ D$D$'D$L$T$ D$4L$8T$<$V#e ;a$D$0H F$D$L$( e uWL$,HL$0HL$8HL$]D$L$ $D$D$ߡD$ D$NYe ;aD$H\$+s91ɄH S hs91ɄHSkp9tV1ɄtLHPks9t1Ʉt@ K 9D$1$L$l$BcL$ D$\$1‰4$L$l$cL$ D$\$1뉉,$L$T$bL$ D$\$M1F$L$t$bL$ D$\$ e ;a8D$(D$,D$0D$4D$e vuZ e LEC1،e  e ;avaD$$L$L$D$D$ L$Q$D$D$D$ L$ $D$YJD$D$X e ;avXD$T$8u?JX9u1H @Z R9t 1D$É$D$\$FD$ 11e ;av:1L$"D$ \$؉$L$L$D$ @|ىL$e ;aD$L$1S, 48؇ޕttD$ Ël t9tlt | T 9tʼn\$4$l$|$ET$ D$L$\$D$ ;e ;aD$tR$Pǵ|$Ge u"rD$$pD$(|$,Írٍ@$ƵD$D$$L$L$L$L$L$ L$ D$D$$D$(D$,0e ;av D$e ;a,z 7z 0z Ye ;a,\$8\ee ;aL$T$ 9\$ 9sqڅuD$ D$ D$D$É$)ˉ)ˉ1D$ )ȉ)1D$ $)ȉ)1D$وL$ÉՉډ뉉Љr߹5e ;aL$ɉ T$҉ѸT$T$҉ѸT$ T$҉ѸT$D$޹Le ;aD$ 9uD$$D$ D$(Ë@L$ $ЋD$L$T$ $L$T$D$L$T$\$D$D$L$T$\$$D$D${D$L$ D$$L$( ޹8e ;a e v u ] e S$ID$L$ pd e td S$D$L$hd e U ld S$D$L$Xd e  \d S$D$L$Pd e  Td R$D$L$0d e  4d R$YD$L$(d e M ,d S$)D$L$Hd e   Ld S$D$L$@d e  Dd  S$D$L$xd e  |d  S$D$L$`d e uL dd S$mD$L$8d e u t19}'9}D$L$ 9}L$T$9111뱋t$|$ 9Ç봋\$l$9-̹Xe ;avdD$L$ 9|Iu:T$9.D$9"D$L$9D$L$ 9D$$111D$$Ë\$l$9˹e ;av9D$ L$9}%T$\$9}D$T$L$\$ Éڋ\$ȋL$ P˹e ;aD$L$$9D$9}yD$L$(9iD$ 9t.$P^ fD$\eD$ L$L$,D$0Í$e fD$.eD$L$ D$,L$0111ʹDe ;av!D$D$D$D$D$ D$D$D$ Hʹe ;av,d (d L$D$ʹe ;avtd pd L$D$ ɹe ;av!D$HPX@L$T$ \$D$ɹe ;avmD$$D$D$D$ D$_D$ L$ T$\$L$D$T$\$p$D$D$%fD$ L$L$$D$(ɹwe ;aD$HPXht$ 99l$9t9Ät_X8)͋@ )֍D9sk T9s_T8T$T9sNT8l9sAD8L$L$L$T$D$D$1덋l$1녋l$1z D 4ȹe ;av D$ L$+AQ \$+YD$ǹe ;aw$D$(HPXht$,99l$099T$ \$ pd Itd X \$l$4l$l$8l$$ыD$ L$T$0\$ )ڋ\$Ӌ\$,l$),5p9AD$qD$yD$ t$(F>9s /F|9shD$D N|9sKL$LFT9s.D$D $Ã$1l$01l$01XB QB JB CB $D$D$E\ Nƹie ;aD$HPXht$99}xl$ 9l9tbH8)ՋP )ލT9suL$ X|9sY\$\ H|9s<L$L@\9sD$D 1땋l$ 1덋l$ 1MA FA ?A 8A aŹe ;aoPD$THPXhL$T$\$l$L$X $L$\L$L$`L$L$dL$ SD$ L$$T$(\$,9D$HL$DT$@\$9}D$ D$ 9ӇÇ> ùUe ;avLd Hd L$D$ ¹e ;av!D$HPX@L$T$ \$D$¹e ;aD$HPXht$9n9}bl$ 9V9ÄtIX8)͋@ )֍D59sJD$$D$D$_D$ L$L$$D$(11뫋l$ 1룋l$ 1= He ;avnD$HPXht$9G9};l$ 9/9Ät X8)͋@ )֍D59s#D$D$1ҋl$ 1ʋl$ 12= [ve ;avD$ L$+AQ \$+Y؉D$e ;a D$$HPXht$(99l$,99ÄtyL$T$ Hd ILd X \$l$0l$l$4l$$ыD$L$ T$,\$)ڋ\$Ӌ\$(l$)ڍ9u?L$$Y 9s( à 1xl$,1ml$,1b; $D$D$U e ;aviD$HPXht$9B9}6l$ 9*9Ät X8)͋@ )֍D59sL$ 1׋l$ 1ϋl$ 1G; p{e ;anPD$THPXhL$T$\$l$L$X $L$\L$L$`L$L$dL$ cD$ L$$T$(\$,9D$HL$DT$@\$9s /F|9shD$D N|9sKL$LFT9s.D$D $Ã$1l$01l$015 5 5 5 $D$D$O ie ;aD$HPXht$99}xl$ 9l9tbH8)ՋP )ލT9suL$ X|9sY\$\ H|9s<L$L@\9sD$D 1땋l$ 1덋l$ 14 4 4 4 e ;aoPD$THPXhL$T$\$l$L$X $L$\L$L$`L$L$dL$ D$ L$$T$(\$,9D$HL$DT$@\$9)‰!T$d)ËAiy T$09)Չl$Hۇ!l$`)Ћy iI9f|$D\$@t$)ى몉ى뤃u(~t>)ى‰wu&jT*)LuzT:)~t>)ى.e ;aHD$L$L$PL$T$TT$\$X\$ l$\l$KD$D$$L$T$T$0\$ \$4-3,$ȉL$<ʉT$(T$T$~D$4L$0T$<l$t$ I9A29*9"!L$(99|$8\$,D$Dt$@ $j|$D$H$L$D$$D$D$(D$ D$,D$D$0D$ D$D$4I( B됍|$ 9;u#e ;av^ Yu[D$$tEH$L$D$(D$D$,D$ D$0D$D$4D$D$L$D$8L$< ' 軥뉍|$$9;u#e ;avFYuCD$t-H$L$D$D$sD$ L$D$ L$$J' C롍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$& ۤ멍|$9;u#e ;avNYuKD$t5H$L$D$ D$D$$D$ KD$L$D$(L$,b& [뙍|$9;u#e ;avl(YulD$,tSPX@ $T$\$D$ D$0D$D$4D$D$L$T$ \$$D$8L$T>D>D>}D$@T$0$l$dl$,t$\L$4$t$49|$Pl$PߋY9'D$YA 9 8YI9i 9ifLu{T$iX)iҶ)uIiL$/u'Nw9o|$\9^ED$D@$t$$T$8\$0D$D$9JpP@ 9l$,)!ډ$)Ɖt$\A4\$D)ËA$ËQ0)y(߉)Ӊ\$dT$0$$D$8D$4$QƄ$ĬÃ'$D$|$D$  7  0  )  "           !|e ;av*e vu: e e Ϗe ;aD$$D$ L$T$uMD$H щHHHH u&@ HT$ 9|D$$D$(H ًd 9t L$$D$(ÉD$L$ $D$d T$ٴD$ u D$L$Í$c D$*D$L$ D$$L$(Ŏe ;aD$PL$9|kP)ډPX !X  !@Ή !ЍS!9}'!DD$ D$$D$(É\$$\$YD$ L$uD$L$\$gD$ L$$D$(⍹e D$;A$$t$0t$4<44t$0}!u 2rn,du$)/+$$$\$0 $t$l$D$ D$L$D$0$T$D$bD$0$$111 ŋ$|\$fo@l$0Ջt$|$ D$T$ !D$8rGD$(hF$$T$$؋$$\$$D$49}Ql$(C؉ !Ձ|$ t$$2 fT$\$01D$^CD$0s \$$1됍|$tt$4虨111At$tL$L|$8t$4iTi t$4T$HT$T L$Pt$,iN )\$,t$$iL$ )L$$t$<)t$8i)t$0))ˍ L$D,3iŀl$8l$L))iε4 tt$P|$<7|$,ˋL$$|$4)<| )t)TL$DT$8)LL$4T$L T$H)L\$X1l$T$P\$t`t$i5l$Li|/l$ ih 4$i)t$ ,l$H\$T$iTi TT$t$DՍ5 ,l$P T$Ll$iN )T$l$i$)T$l$)l$i)l$ )l$)Չl$LT$@iŀl$T )ދT$L)i׵€\@\$P|$ |$l$|$)<+|`))T$@\$)T$\$H \$D)A@Y @i0@s~q@sht@y@sUl$| i8@s>t$q(@s$t$ q@\           | u n g ` Y R {~&e ;avE$ D$D$D$ D$ D$$D$-D$L$D$(L$,~e ;avE$E]D$D$D$ D$ D$$D$̓D$L$D$(L$,}e ;aD$ 9~HJLHQLHǀǀHwhXRۇ݉ۇ!LL$t$t$ $ҋD$L$T$\$ ~11ɉL$$D$(ɉȉ y r 0$D$8 |e ;av{ D$9u%$D$L$tD$L$D$ Ás.TAǀT$D$D$  {ie ;aD$Q9\iǀuohLt1$xc D$$D$ L$D$L$D$ ÉǀD$D$D$ È\$D$D$ ǀ$hD$L$ T$L$ǁ $4D$L$T$ u\D$ǀt1$xc D$ID$ L$D$L$D$ D$D$D$ D$D$T$ ÈD$D$D$ D$T$L$   ye ;a$D$(tEP|3)ǀH|HHHHH H ǀL$,T$0\$4l$(t$,|$0D$ÉhE-9%)ۇ߇ۇ!l(9\$4T$L$,t$9t $l$t$UD$L$9T$()\$4)É!؋\$,؅tyL$0l$D$,$D$L$d 9t L$8D$<$ÉD$ L$ $D$d T$´D$ t̍d ȍd 뿋D$ L$D$8D$<$É  we ;aD$tEP|3)ǀH|HHHHH H ǀL$ T$\$ Љً)9ˉ)ʅtmT$ $D$L$td 9t L$$D$(ÉD$L$ $D$d T$D$ t ȍd ̍d 뿋D$L$D$$D$(ÉՉʉfve ;aD$ DL$$ ZǀD2$T$L$D$ XD$L$L$ 222ډ$22ډ 2D9u1F9}5 [e ;avV  $D$$D$$D$D$(D$D$ D$L$T$\$D$,L$0T$4\$8 Ze ;a$ $yD$D$ $L$(L$L$,L$D$ D$L$oD$ D  xd |d Jt0 $L$0T$4\$8D$$ !ЋT$x@^ ,@ $)$$ËD$lڋ$t$(|$pu l$xU$^ $ !ڋ$fNuNIfN\$$댉$D$D$L$ T$u$N fN볉$$É$$É#$$4i$D$ $\D$L$ T$$$T$;D$L$ T$uN$$؉$ !艄$t$(FT$p\$8$D$lN$$Í$H$É$$Ë$4i$D$$$D$\$(\$ l$$l$$ !t$6D$T$uD$lT$$$t$(|$p$$É$1_D$l%BD$lt1҉T$hD$lt؋T$lBl$h$ 9|\$(ЋT$p$9}l$XЉʋ\$hL$H?L$TA$\$@T$4L$T$T$T9}UR$$RT$|P\$XTT$,1D$H1bT$DB@T$tЃt1҅fL$4͉ЋT$t9|?L$"C1\$@T$DL$"$T$4$\$@9A1D$T1$$$$L$D$D$ D$L$$22\$"8u}SuqAA ADŽ$DŽ$DŽ$DŽ$fǁNT$t\$@l$<$|$8D$4됍$X$É$$ËD$4T$tL$"D$4L$"G\$"$9}|$81D$@1DŽ$DŽ$Ë,<$L$e ;aDL$HP DӃt؉D$$1D$4xD$,L$(T$0\$Hl$ t$8ًT$(t$0|$4 9}al$4917D$ $l$D$0D$ T$(T$:D$L$oL$LD$PDÍVt$(|$|$$T$0T$(|$0$9} t$01YB\$$؋D9RtԋTTT$(ljt؋PPtXD$\$8ƉЃt؉D$,l$ T$(D$<1D$0D$<>D$LD$PDJ C < 5 . WYu;D$t%H$L$諸D$L$ D$L$ 6멍|$9;u#e ;av>Yu;D$t%H$L$蛸D$L$ D$L$蒸 6멍|$9;u#e ;av+D$$D$D$D$ 迾D$ D$.6e ;av,D$D$D$$D$ sD$ D$5e ;av;1L$#D$ @\$$L$)L$D$ @|؉L$~5e ;av^D$L$1B}FR,49u3lt9u'l t8؇ޕul \ 8ؕtD$ D$ 4e ;a4 ʡ$D$D$(L$< $T$@T$D$D$ D$yD$L$D$$L$ T$(?uOD$<$D$@D$D$L$ T$8e uJD$$L$ L$DD$H4ÍzK‰$,D$L$$ɼT$D$D$ L$9D$L$D$,L$0$D$,D$ϴL$D$ |D$<$D$@D$TD$L$ T$T$ \$\$$-`,$D$L$дD$ L$T$8e uJD$$L$ zJD$<$D$@D$D$ L$`$L$D$`дD$ L$T$8e uJD$$L$ zNJL$DD$H42e ;av/D$t HuDwd @wd L$D$ ÉD$L$ j2e ;avD$t@u D$ÉD$,2e ;avD$t@ uD$ÈD$1e ;av^<|$D1;JL$@tQu!|$(N|$Dt$(N<ËЍ|$N|$Dt$N3T$D$ L$ D$!D$L$L$ D$$$D$ D$茷D$ L$L$8D$<(>e ;aPD$\L$XT$T11111D$LD$\-)\$\)É!؋\$T؉‹\$@D$DD$Lt$,\$Hl$,t$(D$\L$XT$T$L$D$D$ L$T$\$\$Dl$,u׋T$(9UD$0D$HD$@D$0T$,T$@\$<e u AL$X9;|$<ʼn1׉D$ L$8|$$@$L$HL$l$T$ t$D$L$T$qL$8\$Dl$,|$$D$@D$ aD$HD$`D$,D$dD$(D$hT$l\$pPÉ\$L譖 Qe ;aD$}$11ɉD$L$PD$ (D$$Í$\ٴD$L$ \$} ҋl$MۇK9v넅tJPVP e хuHl$D$D$ D$$Íx‰L0ԀsO\$} @i*l$uۇu\$Pl$Tt$XD$\DÉt$,D$< $T$D$<\$0l$@t$,ƉT$4L$(CL$T$,$Ћt$ D$L$(T$4\$0l$@됍خ$ƴl$D$@t$0T$4L$(W $T$+D$L$ T$\$u^D$8T$0\$@s3$wƴD$ pˉŋD$@t$0T$8 P $DƴD$ PD$PD$TT$X\$\DÍղ$ƴl$D$@t$0T$4L$(wot=f$ŴD$L$&u@<ŋD$@t$0T$4L$(H$Ŵl$D$@t$0T$4L$(u $T$D$L$ T$\$D$8T$0\$@l$&ÇݕD$'s;$ŴD$L$'H4 0ˉŋD$@t$0T$8 P`$ĴD$L$'H< D$PD$TT$X\$\DÀ th t6 7$Ĵl$D$@t$0T$4L$( ٮ$YĴl$D$@t$0T$4L$(ϩ$,Ĵl$pD$@t$0T$4L$(w@ t 8$ôl$D$@t$0T$4L$(ht:E ٮ$ôl$ED$@t$0T$4L$()Щ${ôl$D$@t$0T$4L$(D$PD$T\$Xl$\D[6e ;avD$HwD$ÀtD$e ;av,D$wuD$ÀtD$Àtte ;avYD$w%tt D$D$D$Àtt uD$ D$D$Pe ;aD$ tkt>v11ɉD$0L$4ËD$$$D$(D$D$,D$D$ L$΋D$$$D$(D$D$,D$L$ pm릋D$$$D$(D$D$,D$fD$ L$Be ;a$4$9D$D$0L$8 $T$pD$L$ L$D$D$0$ @$D$L$(L$pD$ L$D$L$D$0$ D$0H L$$D$D$D$ T$($D$L$T$$9t$L$D$D$0H2P3 H1 H0 P,T$ x-|$P.x/H4   ׋L$ ϋL$  ωx8,ømѸ=e ;a0D$8$L$D$L$D$4L$8$Ŝ`e ;af(D$<H d d 9; $~D$D$ L$L$$T$4Z\$-@,$9D$L$ L$D$D$8$L$ыD$4@D$ @ $L$ L$T$$T$_9D$ L$D$L$D$8$D$$D$,D$D$0D$薤D$ H T$ \$l$T$\$l$ T$$$ыD$ D$@D$$D$DD$HD$L(D$@D$DD$HرD$L(1 ?ze ;a$D$D$ D$(H0@,D$L$`3$2D$ L$D$L$ $D$D$D$D$ D$D$L$D$,L$0$萚[e ;a$D$(@,D$D$ `3 $D$D$F2D$ L$D$L$ $D$D$D$D$ D$HD$L$L$,D$0$ߙZe ;av4D$HIw@D11fD$L$ T$Í 1腙e ;a8 D$$HD$$HP D@ $D$ D$L$ T$\$t{d 9t&p9tD$(D$,T$0\$4 ÉT$\$$\$d D${D$ tD$$HI|}HpTT$\$돉D$(L$,T$0\$4 Ëd d D$(D$,L$0D$4 ÍTRIH\$(T$,D$0D$4  -e ;a L$$Q Yi u9B]Y \$( e |uD$,D$0D$4 ËD$,*`$T$l$\$ t$kD$L$T$\$$Se uC ͉‰u{ ׮PD$0D$4 8e ;a L$$QY)r93ZYL\$(| e u D$, ËD$,S`ը$l$T$\$ t$#kD$L$T$|$$We u ʉʼn耖Ke ;a|\$)VD$D$@L$d $T$hT$D$D$ D$D$L$D$@<L$d $T$hT$D$D$ D$D$L$D$@T$` HJɀ<H $D$L$T$`BD$@HP3$ ʉT$0J L$L$6hD$L$ T$\$`C Se ;K2C KSJH~T$@9t $T$D$TD$0HT$`Zj9L$,L$d $T$hT$\$4\$<\$D$ t$O~D$L$lD$`HPX l$,9L)!)2 D  D D D D $L$*D$L$ D$lL$p\ÉD$lL$p\Í0$D$           ٍde ;a 7 0 Yve ;a 0D$4$D$L$D$L$,D$8H T$4Zj rt$l$\$ \$<$ыD$8@D$D$D$ L$< $ЋD$4L$T$\$}N͉l$$T$(\$ 9t$T$L$D$(D$@D$$D$DD$ D$HD$D$LD$,D$P0É͹D$@D$DD$HD$LL$P0(ue ;aTpD$t$ D$ L$T$\$te $D$xD$D$|D$cD$ L$T$\$l$D$\\$@l$<$~C$L$D$D$ L$L$d$Z\$LT$8@D$HL$til$-,$D$ L$L$D$D$8D$D$LD$D$\D$ D$D$L$T$ \$D$ L$$T$,B$l$ t$|$iۇՉ,$hl$t$D$@$HT$,T$T$ T$T$$T$ $$ыD$L$>$H$ZL$D$D$ $ $ӋD$L$$QD$0D$4D$8fD$<A8Q,Y0I4T$0\$4L$8fD$<$$$D$D$0D$D$ D$ D$L$$$ĀÀk|$@1$QhY\i`qd\$@l$Dt$HfT$LQxYlipIt\$Pl$TL$XfT$\$ $$L$L$@L$D$ D$cD$L$>|$`13$QHY$L$HT$D\$x3$D$D$1$T$\$l$ 1IOt$$MEME E׋T$$ шML$$ ΖEUL$HT$D9Q$L$HL$xfD\| |1e ulŋ\$Ht|$H\$0$8$$\$\$x\$T$ L$1t$D$T$H$\$0$|$HTxË$Ut$Qص ص ص xص \e ;aT1$ID$D$0L$\ $T$`T$D$D$ D$FD$L$5D$0QL$\ $T$`T$D$D$ D$ED$L$kD$0L$\ $T$`T$D$D$ D$ED$L$L$0\$XQi i i Չw5e {ȋ c L$,1swCk C e D$,CD$\$L$`L$t$D$ D$DD$L$D$0HP H H P8|$$x|$ @|$XO   ֋D$  ƋD$$ ƉwD$\$L$`L$T$0T$D$ D$DD$L$D$0T$XJ ɀ:H $MD$L$T$XB$B(L$\ $\$`\$D$D$ D$CD$L$UD$XH udD$\$D$`D$XD$L$T$ \$l$t$|$XW0O4 e uG,fo8\$dt$hTÍO,ptKD$\$L$`L$WD$L$T$\$ l$t$|$X_@WDe uxof@$;GD$L$$ДT$D$D$ L$}TD$L$D$8L$<$D$8D$7D$L$ D$PL$T@Àu 1u u  uֹ D$PD$T@ÉD$PL$T@ʵ Me ;a$F'3$L$L$] D$D$DL$L$@T$ T$`$k$L$D$$t$ $t$$t$u֋$H ])3$L$L$D$D$LL$L$HT$ T$d$+$l$`l$l$@l$l$Dl$ [JD$L$ $D$D$dD$D$HD$ D$LD$诙D$D$hL$L$T$Z -3,$\$\$/D$D$u , u  ‰$5BD$L$$ДT$D$L$ D$wOD$L$L$xD$|$D$6  $L$xL$#D$L$ DŽ$DŽ$DŽ$T$6$$$ĀÀu Zw  1u w 1L$`$L$@$L$D$$DŽ$DŽ$ĀÀu 1u u  uֹ õ HMe ;a$L$(u:T$,Qe uD$0AD$4D$8$ÍyD$0$_ލ ʡ$tD$D$ L$, $T$0T$D$D$ D$D1D$L$u-L$  u L$(gD$4D$8$ÉL$4D$8$Ge ;a7lD$t>T$|9L$pYi  9\$#$D$xD$T$$D$ 6DD$L$T$pZjr t$l$ \$ $D$D$#D$m!D$L$T$pZj2OD$,L$$l$(\$0$D$D$8#Eg@@ܺ@ vT2@@T@X@\ T$pZ jR\$l$T$ $ D$$D$\D$,D$`D$(D$dD$0D$h$BD$D$4  $L$\L$T߳D$L$ T$4e uYJ J e u5D$8B 0F$$DŽ$DŽ$lÍz D$8U\čzI\랉L$LD$Pl$T\$XD$<D$@$D$LD$޳D$L$ D$D$L$T$ \$l$D$ l$$$\$T$L$ >D$L$|$,Oe $L$|D$L$ T$\$l$t$|$,O e uWG_ e u3Ww e uoD$ D$8D$$D$<(ÃNOωÉM뼍OM|$,MZD$8l$<(A6e ;aD$ HT$$$\$(\$D$ L$ C*D$L$t D$,L$0ËD$ @L$D$$>D$$@L$ T$\$L$T$\$ L$( $ЋD$L$L$,D$0}5He ;a&HD$PL$L111111҉T$(1҉T$$1҉T$ l$(t$$݉։ʉËD$PL$L9w=Ju-Ӿ(ul$(t$$릃uT$ މl$(D$\$$v\$ӋT$ ĉT$4l$t$|$,\$0 $D$PD$T${D$ L$T$4\$0l$t$|$,‹\$$H9@98\$$|$,)!ƍ1$T$QBD$L$ T$,\$(9l$P9D$DL$4)ډ!ӋL$L$D$AD$ L$T$$\$ 9l$P9D$0L$@)ډ!ӋL$Lى $D$AD$L$ T$DT$TT$4T$XT$@T$\T$0T$`D$dL$hHÃu‰׋\$$u ‰‰\$$   /2e ;ae vuF e #ɴYm襇`W{QGr'ͭEcNnok`8{ajLLBHMe ;1e ;av&D$D$fD$D$ D$80e ;avD$D$D$o0e ;avD$D$D$D$ _0e ;avD$D$D$D$ _J0e ;avD$D$g0e ;avD$D$D$D${/e ;avD$D$D$ D$~/e ;avD$D$D$D$nZ/e ;avD$D$D$D$s/e ;avD$D$D$D$韀.e ;avD$D$D$D$.e ;avD$D$D$D$hZ.e ;av0Yu-D$ t$a+D$D$ .뷍|$ 9;uˉ#e ;av1Yu.D$ t$q*D$D$误 -붍|$ 9;uʉ#e ;av1Yu.D$ t$Q*D$D$O H-붍|$ 9;uʉ#e ;avxD$$L$L$D$D$ L$Q$D$mD$L$Q $D$D$ID$ L$ $D$rpD$D$,le ;aD$T$8uxHXjr9tI1Ʉt?H Z 9u1JRX@9t 1D$É$L$\$vD$ 11ى4$\$l$iL$ D$T$1+Oe ;aviD$$L$L$D$D$ L$Q$D$D$D$ L$ $D$D$ ᳳD$ D$P+{e ;avfD$T$8uPJX9uBHZ8u2H Z 9Zh9!˄t@J8D$ 1111*e ;avh D$$L$L$kD$L$Q$D$pkD$L$Q$D$YkD$L$ $D$BkD$D$ A*|e ;aD$H\$k391ɄH Pks 9tt1ɄtjHPks9t;1Ʉt1HS[@9t 1D$É$D$T$gD$ 1݉,$T$t$gL$ D$\$1뤉,$T$t$_gL$ D$\$l1e4$T$l$6gL$ D$\$))e ;avBD$$L$L$lD$L$ $D$D$ HD$ D$(e ;avwD$HT$(r9t?1Ʉt5JZ h 9Ëh9!˄tJ@8D$11,$L$t$rL$ D$T$"(me ;avYD$$L$L$kD$L$Q$D$kD$L$ $D$D$21D$ D$'e ;aD$HT$Z*09tj1Ʉt`H Z jp9t11Ʉu 1D$ÍJL$$D$2!eD$ ׉4$L$\$qL$ D$T$1뮉4$L$\$qL$ D$T$v&;e ;av>Yu;D$t%@ $D$;D$L$ D$L$r k&멍|$9;u#e ;av^ Yu[D$$tE@ $D$D$(D$D$,D$ D$0D$SD$L$T$D$4L$8T$< ⧳ %뉍|$$9;u#e ;avBD$$L$L$WiD$L$ $D$D$D$ D$g%e ;avbD$HT$Z*09t*1Ʉt JX9R @ 9!ȈD$14$L$\$oL$ D$T$$e ;aH$D$,L$0T$(11C94z u Bؖ uх9\$ rI |$4)|$ ۇ!lj|$)\$\$ \$ 4$ыD$(PI c - c 5c t$l$\$ $ы\$kD$,L$0T$(@7B+9wLR[ t$4)ۇ!D$)L$|$ $ӋD$0D$8D$<D$@$[ T }#e ;avHD$ @IT$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8#e ;av#D$PI$ыD$@"e ;av D$ @I$ыD$D$"e ;av D$ @I$ыD$D$I"e D$;A3$$$$1111$1D$| $l$,׉ڋ\$0ŋD$4$l$|]\$xUT$tUT$pS8[49Ë$9!ڄW9=$ e ll$lll$hl l$d,L$L ;l$xl;l$tl;l$pl; l$,EL$091@$$$$׉$$$9D$4ll$LUj8R499݇Ç!Օ$l$L]m\$0D$@1D$,D$@D$L7|$lŋD$x7|$hD$t7|$dD$p7ȉ|$(6$$L$|$t$ T$\$D$t$PD$4$l$||$(zL$L$Ӊt$$|$ L$LQ$118 ` $T$$T$P1D$H$ $D$H$Y$ @I ttT$ ZD$L(pϋL$$9D$8$D$`D$8\$0L$,L$` \$\\ \$X\ \$T\ \$Pe u2lt| D$4$$T$`|$0t$, |$\+6|$XÉ6|$T6|$P6뫉l$xt$t|$p6$$l$T$L$ \$D$L$T$Yl$xt$t|$pD$`ыD$LT$ A $$$$Ĵe ;aTD$X$D$\D$D$`D$D$dD$ D$hD$[D$L$D$,T$l1111\$lT$l\$(T$PY\$LY\$HY R~T$(B9|Ɖl$pt$t|$xTËu݉L$Dl$@AT$ltJttt!8t L$Dl$@sN9l$@L$$e L5L$''ø YD$0g L$0y D$(U 떋I$ыD$L$$T$D$ L$ D$D$L$L$8D$<P$D$8D$WD$ L$L$PD$T@ËD$D>D$D,L$HQ)qߍ^97VQL9| e uD$PD$T@~`ը$l$t$T$ \$NܶD$L$T$|$HWe uΉŋD$,|$ y'к1L$PD$T@ÉD$4L$$ $D$d T$RD$ KD$4L$$T$,\$ W׉Éw(#e ;aH1D$(L$P $umD$D$ L$ T$\$\$,-d 9= P9 t (\$4D$L $L$TL$\$BRD$L$ uID$4t(\D$(SL$( $D$D$t D$41D$((I$ыD$L$$=[T$D$L$ D$ D$L$D$8L$<P$D$8D$象D$ L$L$\D$`HÍPD$\hD$`HËL$PY)q׍V9'VQLLe 9L$(T$LZ jrȍN9hNJ ve |\tu(T$TTT$XTDD$\D$`HÉD$TxߋD$Xmdˍ ׮$l$t$\$ L$4ٶD$L$T$\$LS e uCډΉŋD$(K{ PD$\pD$`HÉ`ը$l$t$\$ T$ضD$L$T$|$PWe uΉŋD$ |$,ڻKA$ЋD$L$$=[T$D$D$ L$ D$L$L$@D$DP$D$@D$膟D$ L$L$\D$`HÉL$$T$0 $T$d D$$ND$ D$ L$$T$0\$,M(e ;avo@D$Ht[L$DtJ(u D$L@Íp|$,\ |$D$DpL t$,A 训D$(D$L@D$L@D$L@ue ;aphD$lH $L$pL$T$tT$ D$L$ /L$lQ|$81 ` $T$L$8L$ݳ D$8$^D$8D$<D$(H $L$pL$T$tT$D$L$ D$(HP Y l$lu}|$$L$\$t$ L$xL$ēD$L$u>D$(@ $D$pD$L$tL$D$L$ ?L$|$hÉL$|$hÉL$|$hËD$lHPL$$1 l$4U ÉT$4\$ BD$0 L$,j,$l$pl$t$tt$D$ L$D$lHL$L$0 $T$,T$T$xT$ 肓D$L$u_D$0$D$pD$L$tL$ D$ L$u(D$ @L$$9KD$|DŽ$hÉD$|$hÉD$|$hÉD$|$hÉL$|$h%pe ;a\D$` $L$dL$T$hT$8D$L$ L$`Q|$,1; ` $T$L$,L$]۳V\$SD$L$(9}7T$$D$dD$\$h\$D$L$ t‰L$lD$p\ÍD$,$ݳD$,D$0D$H $L$dL$T$hT$D$L$ uPD$H $L$dL$T$hT$iD$L$ uD$HL$(@D$18L$lD$p\ÉL$lD$p\ËD$`H@~}L$1 \$$ ‰؉D$$T$X\$ $L$dL$l$hl$7D$ L$uUD$ $D$dD$L$hL$躑D$ L$u!D$@L$9|D$lD$p\ÉD$lL$p\ÉD$lL$p\ÉL$lD$p\e ;aa@D$PH7D$DHL$ ` $L$HL$T$LT$ D$L$D$(L$TtQuT$ $it$|$, $D$D$$L$PQRPT$ Pxe )t$,RL$PQe 4T$DIL$$L$HL$L$LL$T$ L$TL$賎D$L$L$(QYir99ji e D$ uD$$L$@T$8\$P9c c DŽ$$$tÍy$ 0$8D$} ;e ;a$D$8$D$D$ T$D$0D$4 ÍyD$,롋L$$Q Yir97ZY \t$(3e |u D$,dD$,L$Q Y9sJP P\$9e u A(D$ Íy(D$ ÉL$ Ë\$R ַ6e ;avQD$u 1D$ËD$$)D$$L$L$D$D$ L$ $)D$ hַe ;avq|$(1L$$uËD$ $)D$ $L$$L$rD$uD$ $N)ĉ$D$$D$t$|$(=շse ;avYD$L$T$1 |$͉9}*)<*9s 9L*ΉȍED$7Q `շe ;aY4 $ D$D$0 O $T$< ыD$ L$D$8$(D$0T$8JH`$L$L$輧D$D$ L$L$T$ T$$\$01ht$0D$ ډs[9Dt$,l$ʲ$SD$ e |$T$8\$,, t w5e ol o l ol t T wo-e uqWT $l L o$W(e u|$,H9 e  ·e ;a4D$D$ $D$H u uà u {e ;a411ÉȉىD$(L$$T$8$gD$8P$Y9X h0I щL$ 8\$$D$D$8$D$# J"##uDD$8$D$L$T$8ZH\$ \$D$L$ D$$L$(i$D$HL$$L$D$ D$Vl$0TD$L,D$L,øW" 耦e ;a D$0L$( $T$,T$D$D$ L$( $L$,L$L$0L$D$ D$&D$L$T$\$$$D$L$T$ D$4D$D$8D$D$j$D$HL$(L$D$ D$l$4D$P0D$P0ù ѣ,e ;a D$0L$( $T$,T$D$ D$ L$( $L$,L$L$0L$D$ D$$$D$L$T$\$$$D$L$T$ D$4D$D$8D$D$#|$e u L$,D$,zߴ xd xd D$ D$$D$ L$$$D$ D$D$ L$ $D$ be ;a\L$Q, e B A,Ae BT$L$T$ $AD$D$@$D$uJD$ @ $D$D$Ȓd Ēd d \$L$ D$АCÍ$D$4D$D$ D$a놐 Íz-y*y, y$m!|$e u L$D$x0ݴ Yae ;af4T$\  $ |$e L$LGG Ge G|$(T$TWe hD$XGD$@$L$DL$T$HT$D$ L$@( $ЋD$L$@P $ЋD$D$$1.\$($l$QD$P$1D$D$ $HD$ $LD$?D$$L$L$4T$0Z($,$ӋD$L$@P $ЋD$u7 e u\B$i$\BPP٥$od D$$<D$)D$ HT$9)A D$DL$0Q($$ҋD$L$$8$T$DT$L$D$ $D$L$4L$$PT$wD$$$ 8L$D$ $L$ L$4L$ 'cL$D$y>D$ D$,L$$$|$$ D$,Ge $D$0@($ $ЋD$L$@P $ЋD$  $ od L$D$&D$ $  $QD$ %S e ut$H pH e u"$ H $H$_x $ Ny$|N$nN*x$VN끋$FN$8H L$ إ $$<L$%D$ @@ $8H L$ إ $$<T$%D$ @ @ D$<$8Q T$إ$$<T$k%D$ @ @D$HL$0QL$$ҋD$D$LL$$$$CT$D$$HT$ $L\$;D$L$L$D$$8$L$Hvwe L$X9D$`HËe L$X9D$`HË0e L$X9D$`HÃFuD$t D$ u D$`HÉD$4D$HTT$($ыD$L$4Q9t 1D$`HËD$@(L$( $ЋD$4@ D$ D$L$D$\D$?D$ƒD$t D$ @ u D$`HÉD$0D$HLT$($ыD$0H L$ L$L $T$\T$D$u 1D$`HËD$@(L$( $ЋD$0@D$ D$L$D$\D$D$‹ e L$X9D$`HÃt.t D$`HË,e L$X9D$`HËD$H(T$($ыD$L$@P $ЋD$٥$od D$D$XD$D$ HT$t|9unL$,D$@(T$($ЋD$L$ $D$貥D$H @T$,u 1D$`HËR T$ T$L$D$L$D$\D$sD$1뎋D$ t @|1e L$X9D$`HD$`H1y1J1L$X9D$`HW&e ;aeD$D$ `e $k`e D$$WD$艥٥$ od D$D$D$D$ HD$@ D$إ$D$D$D$ tID$L$ ȬËHtIHtIҋH tIċHtI붋HtI먋@t H똹 H당 H{@ $ЋD$L$L$D$ 3Ð)${e $;A$HL$PT$8$[D$D$l  $D$D$ED$ L$T$|$lOW e *D$8T$P$ыD$D$\L$L$@$1w<$W<$$/9$$$$L$8L$T$PT$$\$ $l$PD$|$p1<$;$L$|8 $L$x$ $$L$L$8L$L$PL$ L$\L$T$@T$\$p\$3L$L$X$8T$D$ T$\T$ T$@T$'cT$D$;)L$ L$,T$T$L$|$L$,O e L$LL$lYl$Xme u`׉1:* pJ e u2ZD$l@ $DŽ$DŽ$ĀÍz9ʼn|$hl$dT$` $T$~@|$`D$dq9\$hyD$L]9:$$$D$n$HT$T$T\$ \$<@ IP$ыD$u e $9$D$D$D$\D$ D$@D$D$D$D$TD$D$L$0ߕLÍ{@ʼn%"D$P$D$TD$$讕LÐ褕LK&e ;aD$$L$ L$D$L$T$ \$S<-e uoK@udD$C D$إ$D$ D$D$ t@uD$D$D$$תËD$D$D$$譨Í{@ʼn$r -e ;a=`&D$cD$ D$ I$ыD$ B LBe uyHd \d 3D$cD$D$tK I$ыD$ u'LB e u pd Í=pd $@uJXB11뵍=Hd #=\d #v@u4B XBJ11 0$@D$ٖ 0$8D$迖  e ;avOD$$D$ D$'D$ L$T$ $D$T$^D$ L$T$D$$L$(T$, e ;aHP`$I˲D$D$ @ $L$TL$T$XT$D$ D$XL$TT$J e B ղe $D$H ղe $D$H$ղe $u\D$H(3$D$ D$ ݵD$L$ T$\$S4C8e u K0\$\PÍ{0!T$z(!뛋T$z$!oT$z !?z !L$TP9D$XuP| P $ɲD$D$ 3 $D$D$ܵD$L$L$T$ |$$1!"T$$D$D$(\$,D$TD$0D$XD$4D$HD$Le u|$ t$$&D$ T $D$ D$L$$L$#׸- e ;a D$(@}d$ȲD$@ e u0 | pT$$J< e uB@ Íz@- Ǎ| NjL$$Q T$إ$D$D$ q$AȲD$ d   d e d D$L$D$L$QӃ uʀ\$$$-4e l$L$D$ T$D$$HgBe ;a(D$,H PX0h8p4\$t$ l$$L$ D$L$T$ \$$t)L$,Q<e u Y@D$0(Íy@a=@!څ фt3 hxd lxd T$,J< e u B@D$0(Íz@L$, $D$"D$,@<D$0(fe ;a{$D$(HHP9G@@HT$,9PHPXh9p x<$t$)!ډT$)L$ t$bD$L$T$(J ^z pT$0J< e uB@B@JD$@$L$ʁ\$݁ ى   މʁ Ή ։t$ ف ͉l$L$8T$@\$$WD$P<ù"e ;a D$0tuL$( $T$,T$D$$XD$ L$( $L$,L$L$0L$D$ D$(wD$L$T$\$$$D$L$T$ $D$D$4 D$4 Te ;aB(D$0$D$4D$D$8D$SD$L$ v9@L$$D$T$,1C9\$W.u z jtZD$D$ L$$%́   % ف% ؉ L$  މt$D$L$$T$,\$W/D$<(D$<(ùe ;a D$0tuL$( $T$,T$D$VD$ L$( $L$,L$L$0L$D$ D$uD$L$T$\$$$D$L$T$ $D$D$4 D$4 Te ;a?(D$0$D$4D$D$8D$QD$L$ @v9@L$$D$T$,1C9\$Wf.u z jtD$D$ L$$%́   % ف% ؉ L$  މt$D$L$$T$,\$W2D$<(D$<(ùe ;a D$0tuL$( $T$,T$D$SD$ L$( $L$,L$L$0L$D$ D$rD$L$T$\$$$D$L$T$ $D$D$4 D$4 Te ;a D$($D$,D$D$0D$OD$L$ ҟ9uh@uXL$D$T$$1C9}:\$,u rt$l$l$D$L$T$$\$D$4 D$4 ù ;e ;a D$0tuL$( $T$,T$D$tRD$ L$( $L$,L$L$0L$D$ D$xqD$L$T$\$$$D$L$T$ $D$D$4 D$4 iTe ;a D$($D$,D$D$0D$+ND$L$ @ҟ9um@u]L$D$T$$1C9}?\$,Yfu rt$ʼnD$D$pD$L$T$$\$D$4 D$4 ù6e ;a D$0tuL$( $T$,T$D$PD$ L$( $L$,L$L$0L$D$ D$oD$L$T$\$$$D$L$T$ $D$D$4 D$4 Te ;a D$($D$,D$D$0D$LD$L$ ҟ9uh@uXL$D$T$$1C9}:\$,u rt$l$l$D$L$T$$\$D$4 D$4 ù ;e ;a D$0tuL$( $T$,T$D$tOD$ L$( $L$,L$L$0L$D$ D$xnD$L$T$\$$$D$L$T$ $D$D$4 D$4 iTe ;a$D$,$D$0D$D$4D$+KD$L$ ҟ9HuyL$D$ T$(1C9}[\$,؋ut$mÇ߅Ç u rtƉ$l$D$D$PD$ L$T$(\$D$8$D$8$ùmxe ;a D$0tuL$( $T$,T$D$MD$ L$( $L$,L$L$0L$D$ D$lD$L$T$\$$$D$L$T$ $D$D$4 D$4 Te ;a D$($D$,D$D$0D$ID$ L$ӟ9urA ubL$D$T$$1C9}D\$,u rt$Ç݉D$D$D$L$T$$\$D$4 D$4 ù1e ;a D$0tuL$( $T$,T$D$TLD$ L$( $L$,L$L$0L$D$ D$XkD$L$T$\$$$D$L$T$ $D$D$4 D$4 ITe ;aDD$L$D$PD$D$TD$ HD$L$ @9BH.D$@L$ T$H1C9 \$0,؋uml$4u zt؉t$$$t$t$K D$HHL$8Q\$$,l$,q99wq9|$uT$(CuT$(.uT$( BD$G E$|$a Nֶe ;a*D$,D$ ubD$(1ɉD$ L$… ӄt4D$ $L$L$D$ $D$ D$D$D$nËT$ Zuu T$(1떃 u T$(1농^$^|$Ge u CDC7 u T$(1: uT$(J' uT$(1D$G E$|$_ Զe ;ag D$4 D$0ZWf.uD$D$D$L$L$ T$($\$$\$D$($D$ T$  ʉف  Ёˁ ʉ Ӊ\$  ͉l$ ËD$(H2u D$0D$^$蘓|$Ge u sͻ sͻD$G E$|$%^ nӶye ;a10D$DD$@HZZWf.!f.!!фmD$8HYD$ L$$L$T$ T$ L$(\$,\$l$(l$$t$4t$D$8$L$ ʁ\$݁ ى  Ӂ މˁ Ή \$ с ͉l$D$8$D$%T$Ӂ ‰  % ʼnЁ Չ% D$ ʁ Ӊ\$D0ËD$8uD$@HND$^$>|$Ge u  D$G E$|$[ Ѷe ;a@8D$D$D$HD$D$LD$D$D$ L$ L$,D$@$L$.$D$D$D$ D$=뿐rM0ËD$$$L$L$8 e T$LBuL$0AJHËL$0yǶ|$<ǶD$8Ƕ뽉T$$3$t$T$|$ l$}t$|$D$0L$4T$$\$ l$()aǶD$LENjD$PHǶƋ|$<8Ƕ`$o|$e uL$LT$,\$ |$<+D$LƶD$X$D$\D$D$`D$U D$L$  $L$D$ND$ L$@ $Ћ\$T$D$L$D$X$D$\D$D$`D$ D$L$ `$L$D$8ND$ L$@ $ЋL$D$\$T$&D$X$D$\D$D$`D$ D$ L$@$D$L$MD$ L$@ $ЋD$T$\$L$+ D$@D$DD$@L$D$D$@D$DD$L$ $L$8 /e ;atD$x$L$|L$s,D$HQD$4D$xD$lL$|L$p$$\$l$ll$?|D$ D$4HL$P T$8@D$$YP$ӋD$D$  $m|$D$ } e d |$Xtwt$D$$$tËD$xt@D$\D$`D$\D$|D$`x$D$D$\D$D$ D$3$|$X돋D$xD$dL$|L$h$$T$\$d\$茀|$ e D$XD$HPT$8$ыD$Tt;u0 e uBL$X|$XBoöL$XD$H(T$8$ыD$L$ $D$$D$$D$ D$D$TL$L$,T$R(\$8$ҋD$L$@P $ЋD$ ` $ od L$D$蛚D$ D$D  $#kD$ )S e uJL$THL$,H e uL$DH L$Xx D$Du¶|$Xj¶xD$TU¶뫃D$$L$8L$R)D$$$D$ D$$D$8D$_D$D$@ @ $AjD$ +S e uL$@HL$X4xD$@|$XD$H(T$8$ыD$L$@P $ЋD$u1 e uCL$X|$XCFD$H(T$8$ыD$L$ $D$$D$$D$ D$D$PL$L$0T$R(\$8$ҋD$L$@P $ЋD$ ` $ od L$D$uD$ D$H  $hD$ (S e uJL$PHL$0H e uL$HH L$Xx D$HO|$XDxD$P/뫋D$HLT$8$ыD$L$ $D$$D$$L$ D$D$D$0HD$8L$<,Ppe ;av/:$L$ $D$cD$ L$L$D$oe ;arPD$TMHL$ ٥ $T$XT$N`D$D$THL$ ٥ $L$XL$aD$ D$TPL$T$$ g8L$ D$ JuD$L$T$TZ\$(R T$41D$@L$XL$<$ЋD$L$ D$8L$e ;aTD$XD$LL$\L$PT$LT$@\$0$ЋD$D$4L$L$DT$0Z`l$@,$ӋD$>11ɉD$[e ;avg0B JZ\$,jrR|$8 L$ $T$t$|$ L$e ;avP$BJ ZRl$,uD$4$l$D$0D$D$4D$ D$8D$T$L$\$ $=e ;av3BJD$ $D$ D$D$$D$ D$(D$OV=e ;av?BJT$$$L$D$T$ D$(D$D$,D$D$0D$c$BD$J RX\$8D$0$D$4D$\$hD$L$T$ D$8L$4T$0\$,ktI$D$(D$_[D$,@D$ $D$D$D$0D$ D$4D$D$8D$:$É$L$D$|D$ u\$,똃$ÅtRD$D$ T$L$ $D$D$D$D$ D$6\$8D$8L$4T$03e ;avCD$uËD$D$ D$ D$`$$od D$D$ D$ 4e ;a&He vHu0 e P㋷9dL?d$D$*ID$L$ xxd e  |xd  $D$D$D$ D$$  $D$D$7%|$ e -A $L$$L$D$$|$ e A $L$$L$D$$|$ e A $L$$L$D$ $|$ e OA $L$$L$D$O$|$ e A $L$$L$D$$|$ e $B $L$$L$D$#|$ e qA $L$$L$D$#|$ e 'B $L$$L$D$g#|$ e  B $L$$L$D$-#|$ e B $L$$L$D$"|$ e I,B $L$$L$D$"|$ e dB $L$$L$D$ "|$ e 8B $L$$L$D$ E"|$ e kDB $L$$L$D$ "|$ e !PB $L$$L$D$ !|$ e lBD$$ od  $D$D$D$ D$  $D$D$k!|$ e RA $L$ L$D$1!|$ e A $L$ L$D$ |$ e A $L$ L$D$ |$ e tA $L$ L$D$ |$ e *A $L$ L$D$I |$ e (B $L$ L$D$ |$ e A $L$ L$D$|$ e LB $L$ L$D$|$ e B $L$ L$D$a|$ e B $L$ L$D$'|$ e n0B $L$ L$D$|$ e $hB $L$ L$D$ |$ e $D$d L$D$ D$D$e &$D$ e `٥$D$L$C|$ e $Ce `٥ $T$T$D$|$ e E$C0e `٥ $T$T$D$|$ e $Ce `٥ $T$T$D$|$ e $Ce `٥ $T$T$D$S|$ e a C,e `٥ $T$T$D$|$ e  Ce `٥ $L$L$D$|$ e  CD$od  $@e D$D$L$ `xd e b dxd $D$D$L$ hxd e  lxd `$D$D$eD$ D$ ` $D$D$|$ e  tB`$L$L$D$|$ e d B`$L$L$D$|$ e  B`$L$L$D$ U|$ e  B`$L$L$D$|$ e  B`$L$L$D$|$ e < B`$L$L$D$|$ e  B`$L$L$D$m|$ e  B`$L$L$D$3|$ e ^ B`$L$L$D$|$ e  B`$L$L$D$|$ e  B`$L$L$D$|$ e  C`$L$L$D$ K|$ e 6 B`$L$L$D$ |$ e B`$L$L$D$ |$ e B`$L$L$D$ |$ e I CD$od `$D$D$D$ D$( ` $D$D$7|$ e xB`$L$(L$D$|$ e B`$L$(L$D$|$ e ?B`$L$(L$D$ |$ e B`$L$(L$D$O|$ e B`$L$(L$D$|$ e aB`$L$(L$D$|$ e B`$L$(L$D$|$ e B`$L$(L$D$g|$ e B`$L$(L$D$-|$ e 9B`$L$(L$D$|$ e B`$L$(L$D$|$ e C`$L$(L$D$ |$ e [B`$L$(L$D$ E|$ e B`$L$(L$D$ |$ e B`$D$(D$D$ |$ e nCD$(od 3$D$ D$ }D$ L$T$ Ԓd ؒd e Вd d  $D$iD$L$ @( $ЋD$L$xd e  xd d  $D$D$L$ @( $ЋD$L$xd e P xd .$D$  d @L$D$ D$D$ e  $D$ dўT$L$ D$ D$(e  $D$ d@ўT$L$ D$ D$$e  $D$ dўT$L$ D$ GD$ e  $D$ dОT$L$ D$ D$e  $D$ dОT$L$ D$ D$e  $D$ $d@ОT$L$ D$D$e  $D$ (d ОL$D$ D$WD$e |$,1[4$D$,D$蜲D$L$ $L$D$L$ $L$DD$4e 3e HÍ=xd 2=xd 2H=Вd 2C2=od D$(2B21B2B2Cu2SBe2 BU2BE2uB52+B%2B2B2MB1B1B1oxB1% C1=od D$1B1VB1 Bv1Cf1xBV1.BF1B61B&1PB1B1B0rB0(B0B0tB0J=lxd 0=dxd 0C0=od D$s09 Cc0 CS0$CC0K$C30$C#0$C0g=\xd 0o=xd /=Txd /=xd /_= od /=$od /=xd /=txd /]pBy/=od D$ j/TBZ/HBJ/hT$ D$L$ 붉 $D$D$R>T$ D$L$ 넃}1m $ΝD$D$>T$ D$L$ A $D$D$=T$ D$L$ }c1҄t+t vm~d ~d L$u7$$D6D$L$T$\$ l$pED$8t$X|$yD$teje ;aXD$\$D$`D$sD$L$T$\$l$ t L$hD$lXÉT$,\$(l$$ "$աD$D$0@$~D$L$0 $D$D$D$ D$$D$D$D$4|$81|$8HND$8D$8$D$dD$D$0D$D$4D$ D$,D$D$$D$D$(D$D$L$ D$hL$lX7e ;a'D|$,L$PeL$HNd 6 d e D$Ld L$D$L$~d e  ~d `&$|fD$赥D$D$DL$ L$|b`'$_ ډT$脥D$D$@L$ L$x&$`cT$\D$D$D$ D$<$D$t$$L$PL$$T$D$ D$8$D$p$$L$PL$$T$§D$ D$4$D$l$$L$PL$$T$脧D$ D$0$D$h$$L$PL$$T$FD$ D$,$D$d$$L$PL$$T$D$ D$($D$`$$L$PL$$T$ʦD$ D$$$D$\$$L$PL$$T$茦D$ D$ $D$X$$L$PL$$T$ND$ D$$D$T$$D$PD$$L$D$ e D$Pqd Ƅ$DŽ$DŽ$DŽ$J$$D$OhD$L$ $L$苠D$D$DL$ L$|$D$LL$D$L$|$ ` $D$$L$L|$ e DNL$L qd $D$ D$D$ D$H  $D$D$±|$ e LN$L$HL$D$|±|$ e O@N$L$HL$D$B±|$ e DN$L$HL$D$±|$ e DN$L$HL$D$|$ e qDN$L$HL$D$|$ e 'DN$L$HL$D$Z|$ e DN$L$HL$D$ |$ e DN$L$HL$D$|$ e IDN$L$HL$D$ |$ e DN$L$HL$D$ r|$ e DN$L$HL$D$ 8|$ e urDN$D$HD$D$ |$ e u DND$Hqd e ĴÍDNG=qd D$H8֍DN+뉍DNCDNDNDNeDNDNDNDN=DN@NLN~_DNn=qd D$L_=qd D$PK=~d 9=~d )=qd $@̵e ;avBD$$L$L$G D$L$ $D$D$TD$ D$'̵e ;avcD$H\$k39t+1Ʉt!KP9uK @ 9D$11$t$L$ L$ D$\$˵e ;avLYuID$t3HX@ $\$L$D$ D$L$D$ L$$DM =˵뛍|$9;u#e ;av: D$$L$L$ D$L$ $D$ D$D$ ʵe ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$eD$ 1݉4$T$l$JL$ D$\$6ʵqe ;aG,D$0HIT$4\$8l$ Ml$4t$0|$8|>hp9L$ D$($T$\$D$ tD$(D$<,Í$|D$L$8H e L$4L$0QZi q9%ZY e D$L$T$\$$K S e u C\$0 Í{k䥵e ;a(BL$8T$@ttT$D$,D$D$0D$D$4D$ L$D$e ;av9`e vu# `e ռ}`e pe ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8똍|$ 9;u#e ;av: D$$L$L$D$L$ $D$D$D$ 菣e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$%D$ 1݉4$T$l$ L$ D$\$qe ;avUYuRD$ tD$LH T$T$DY iI,$\$L$ L$ D$4D$D$0L$L$@111t$DL$,AՉƋD$0ʋL$@\$(l$$t$<9T$,ыX\$ D$4$\$ D$ L$uL$$Q\$(99D$Yu;D$t%H$L$D$L$ D$L$ b멍|$9;u#e ;av>Yu;D$t%H$L${D$L$ D$L$ a멍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$2 +a멍|$9;u#e ;aD$$L$L$ӡD$L$Q$D$輡D$L$Q$D$襡D$L$Q$D$莡D$L$ $D$D$D$ D$n`Ye ;aD$HT$Z*091ɄH Z jp91ɄHZjp9tV1ɄtLJZhp9t1Ʉt@ J 9D$1$t$L$貝L$ D$T$1‰,$t$\$菝L$ D$T$1뉉,$t$\$lL$ D$T$M1F,$t$\$CL$ D$T$,_e ;av{ve vuD޲ ve !-$D$"{D$L$ pd e u td ve Í=td v^ie ;avq D$D$D$D$D$$D$D$(D$D$,D$D$0D$|$D$D$%D$L$ $L$ ]se ;av D$D$]e ;aL$T$9sj\$ ,ˋEu|L$ 9sQ4$ˉT$2Ru-e Lu$$\$e uÉtÉtز %]`e ;avZD$(L$9sD\$Ë(@t$,9s0 Y L$\$ ,$D$T$$ЋD$D$0ز \e ;av9ke vu۲ ke  g⌼ke P\e ;avDYuAD$t+H P@$D$T$L$ D$D$ݰ [룍|$9;u#e ;avUYuRD$ t$H$$э$$>$H$$ыD$D$8$19$$L$úD$L$ $$$$D$蔺D$L$ $$5$D$8D$xD$L$ $$$$D$D$D$ $D$D$D$lD$+$H$$э$$=$H$$э$$n=DŽ$DŽ$DŽ$DŽ$$$L$kD$ L$$$$$D$H,T$D \$(h(p0999t$$l$4)ۇ!΍L5L$T$\$ 0 $L$@L$T$L$HL$j/D$(L$ $$$$L$hD$l$l$\T$X$4$L$D$\$ T$l$D$/$$9 T$l9 \$X,t$h9 D$p$L$C$|$$e L$l$)щ$!ы$щ$t$h)$B5`D$C$$T$T$pT$\$ b D$L$$Be J$$D$D$XD$D$\D$  D$L$$J e BD$CB$$D$$D$$D$ D$L$$B e u'J$ DŽ$DŽ$Íz3Ѝz)oz$|$`D$$\$lD$X* $$|$$e 55t$$D$$D$$D$ D$L$$Be uJ$$D$$D$$D$ gD$L$$Be u'J$ DŽ$DŽ$ÍzЍzu $|$5D$$$$L$$T$$\$ $l$$t$$|$.D$ L$QY)֋Q׋QT$TQ $QT$LQ$Q T$PQ(T$DQ$$Q,p$T$HA8D$dQ4T$`I0$$$l$\$t$ $\$\$L\$\$P\$$\$l$ $$4D$<$L$8L$|T$4$$$$\$\$T\$$\$ $\$\$D\$\$H\$$\$$$D$D$x1D$h1$D$xD$h9&$T$|$D$ $L$|$t$ưD$lL$4LL$ T$09$9l$t9T$$$t$p)T$p!֍3T$)L$L$pL$  $$t$D$D$hD$ưD$$L$ $\$t$$\$\$t\$T$ L$s}\$T$D$lL$ 5t$h$$D$D$D$ |$)}D$L$$\$4l$0t$h|$lD$h$D$t$j$$D$l$hD$ tD$0L$,$|$4^L$l$t$LT$<\$@$D$8$$$$ĸ$ # # $ $ $ $ $ # # }# 覧ae D$;A$$$$$$$1111D$%1D$&1t$l1|$01|$p1핈D$'111ED$lT$0$$9l$,\$PT$L$TmT$HT$HT@9}D$%uAT$&u8111D$p1D$dD$L$L$\1ɈL$%1ɈL$&D$dL$\X`$rn L$T9b ཡ$wQD$$, H e x$(NP$$HD$$L$T$TT$ D$L$$,Be J$H$ 9  $$<K щL$D$l$  $$Dl$D$$D$CD$tP$$<$-$T$D$D$ L$d\$T$$$4$(蓧臧$D$6|$\t$P$H$L$$D$$T$t$$D$`$t $E$TLT$L$$ $ݘD$L$P$\$ l$T9$H 9 $Hl$T $\$D$胮$hD$tH$$$D$|$X$D$P$D}$$$&$$H\$L$l$ T$bt$l$$L$P$$$.$TLL$T$$ $輗D$L$X$\$ l$\9wq$L 9 l$\$L $\$D$f$pD$tH$$$D$$o$$ &$$L\$L$l$ T$at$l$$L$X$$ =J9,Rl1 t$tFˉщq9r9jT$t$L$dT$t)щ$l$h)Չۇ$!݅f$1$1$L$$9$LT$L$D$ $l$L$|$,$L$tTT$0\$h9$}9u$9f\$D$H$)$!L$)T$$T$ $$L\$D$$D$胣L$DT$0$H$$L$$L$\$ T$Zl$\$$L$tT$0$$$D$D$D$ L$ZD$L$T$t$$t$h$$$L$$<$(V$CX $$ D$T$ïL$ $l$#$_1XʉQʉHu$$$ĀË$$D$L$\$ DD$L$\$뻉1薜$$l$L$\$ T$ZYD$L$\$Q$3    ~ w p i b [ T M F ? 8 1 * #         e ;av{D$L$ T$111 C|$ʼn4$9}IsK<[D<9tƗt%9~ʗul$Ë$)*D$É1E nie ;aV< $CD$D$4L$HT$D1 l$8U ÉT$8\$,BJ*D$' $D$D$L$ $L$5D$D$  ~L$D$ D$D$ D$(L$L$0T$';ttD$,@L$H9XD$4tNH X@9_$)ȉ!ЉD$)ˉ\$l$ 賉D$L$D$PL$T<Í귺D$4$ vL$D$!任D$4$L$0L$L$(L$ȻD$4$ ɺL$D$誻/D$4$ ɺL$D$臻D$4$L$0L$L$(L$kD$4$ ޺L$D$MD$4$ UL$D$!*D$4$L$0L$L$(L$D$4$ ɺL$D$u e ;a, $@D$L$8~ID$ T$41 T$(\$jl$$rt$:tdC9|ÅtNHX @9?$)؉!ЉD$)ىL$l$ 覇D$L$D$@L$D,Í귺$ L$D$۹D$ $L$$L$L$L$迹D$ $ (L$D$衹D$ L$8T$(\$3$l$t$|D$ L$8T$(\$$ 뻺L$D$MD$ $L$$L$L$L$1D$ $ (L$D$D$ L$8T$(\$ e ;a$ $>D$L$0~$D$T$,1 *rzu`C9|tJHX @9wu$)؉!ЉD$)ىL$l$ ߅D$L$L$8D$<$Í 귺T$ \$$|$t$D$L$0T$ \$s ~e ;a$ $=D$L$0~$D$T$,1 *rzu`C9|tJHX @9wu$)؉!ЉD$)ىL$l$ D$L$L$8D$<$Í 귺T$ \$$|$t$&D$L$0T$ \$s }e ;avxD$~eL$ 1111 <$ ͉ $y uL=B9|9~ 3D$Éu9~11؉uɉ111|le ;a@ $)lj裎$$L$T$l$ \$lKt$D$l$XD$0$T$HxT$HZl$L9>$RDTЋe u L]ljO$$L$T$l$ \$Jt$D$l$XD$0$T$H$D$D$"$D$ D$uu=9*}UM\u9EMt6`$D$$DŽ$DŽ$ĐË$$\$0\$l$$l$D$ L$D$PD$L$T$ \$0\$8\$$\$h$1Z$t$\$l$ T$%t$\$D$$$1L$G$$$$S$9S$[ T$lTl e $LL$\\$L9,9$$D$L$)!؉D$ T$UD$t$$T$l$D$L\$`l$H1$f1g$t$\$l$ T$#t$\$D$$$1L$G$T$\$DŽ$DŽ$˱ ˱ Ne D$;A`$D$$w$111\$H l$(ډϋL$8\$D$ L$T$$kt$,9$T$L$D$ 脖D$L$T$$$Ml$lD$TL$P$$$D$t1D$h1D$HD$t $L$hD$HD$TL$PKSu6t+D$HȋL$hA9|ŋD$pL$8$l$XD$HՉ$$D$'t$dL$`$$$$L$T$PT$\$T\$ l$Hl$D$L$'t%D$d$$l$l׉ƉȋL$`;T$0Yl$d9MD$D\$4$$$L$T$PT$\$T\$ l$Ht$`<.|$#D$L$4ȋT$D)ЋT$d9$$\$L$)‰!؉D$ L$KD$T$L$',T$0Ѕ\$d9$$L$D$$T$ T$`T$)É!ÍD$l$KD$ T$L$'$$D$TL$P$$T$L$D$ D$*D$,*^$Hf.v"L$p$ $$D$TL$P$$D$|\$($ $D$t$蝂D$ D$0{$9l$$$$$\$T$L$ ED$L$T$0\$,Ӌ$9$$t$T$L$ D$)݉ۇ!ݍ .L$D$GJt$ |$D$|\$(t$,$P*$$*D$辤D$,L$09~$9o)ȉ!ȋ$'$Q\$,)9XD$\D$L4()։t$ $$T$$t$)݉l$lۇ!달$\$ \$l\$D$u‰ȉKL$\9},$$L$$t$T$ \$D$D$ ׋$$J $ID$$$$$$DŽ$DŽ$ 龱 ⾱ ۾ Ծ ; ƾ 追 踽 豾 誾 Ae ;a`L$dIL$$11HD$ $D$D$M$D$LD$D$(D$ZGD$ @\$T$L$$T$L\$(9~l$lt$h1kT> ʉT> T>ʉT>@T$L9}r<-.vTཡ$D$ L$(He  T$LP\$hkut$@;SD$DD$ 7 0 ) "   =.e ;a\|$$F $D$D$L$h~VT$d1 l$ UÉT$ \$|$@K|$$t$@KD$$$^D$$gD$@L$h9|D$tJP X@9wH$)Љ!ȉD$)Ӊ\$l$ 4D$L$L$pD$t\Í 귺 *-e D$;A`$D$$D$|$$L$5D$D$ F!D$D$8L$L$X $D$$?D$D$h$1DL$8T$h\$Xl$|111t$DD$090‹+[@ED$/K $T$ L$D$ T$D$D$;;D$ L$ $D$wD$D$pL$ L$LT$/-$$j΋$9GJ$ R t e |uD\$0CL$8T$XB$\$T$L$ l$\$T$D$$$D$pt$Lt+$$j΋$9;J$ R t e |u DH2B>$\$T$L$ l$\$T$D$$$D$pt$L냀 $$k΋$9;K$ [ t e |u DA$T$\$L$ l$[T$\$D$$$D$pt$L냀@D$@HT$D9\$xL$@-e k<z$FD$8L$hl$Xt$@|$01L$8݋|$@T$DT$h\$X9Qt$0l$x|$@D$thL$l$$ED$ $1}AL$tQ L$T$L$h $jL$T$ L$HT$lBJ $L$ĴD$$L$HT$lZj H$DŽ$kBJ$L$dĴD$$L$H:L$lQ$Y lH$DŽ$D$0@L$8T$X\$dT$P $|$$D$`BT$P\$d` $l$xl$D$T$ L$1\$D$T$HD$@D$T$‰D$D$3$<ֻD$D$ȺD$D$D$pD$D$LD$ .D$$D$`L$(L$4$|$D$4Ge uBD$`D$x$D$@$D$D$p$$ĜËD$`P>빃u0uDŽ$H$A$I $D$´D$$`u0uDŽ$H$BJ$L$P´D$$L$HT$lD$tHD$ L$$D$D$ ,D$D$\L$L$<$|$D$e ;aD$(L$9}_)!l$ $\$戴D$ L$(ȅ|lL$9wdL$ $D$D$ D$D$$D$ P D$D$,ËD$$L$D$ D$D$$D$ $ D$D$,D$, @#+e ;aD$$HT$89~gL$()щى!ʋL$ щ $)D$\$D$,D$ D$0D$D$4D$D$u D$<ËL$8ȉD$<ËL$ $D$D$(D$D$,D$ D$0D$D$4D$D$D$<D$<L"e ;avDD$L$9u+T$\$1E9}49s<9tD$D$D$輝 !e ;a(D$0L$<)ȉD$T$@\$8l$,t$41%D$ xD$L$@T$<\$8l$,t$4ыT$@9`|e9wa9w]|$ )t$$ۇ!t=4$L$t$$t$\$ L$T$D$tD$ D$D(D$D(۝ !e ;ae vu e ✻-QyNYHe ;aD$L$1B}mR4 8ؖttD$ Ë\t|l9t؉T$$l$t$X\$ D$L$T$D$ Ue ;av81L$ D$ T$‰$L$<[L$D$ @"|ۉL$1e ;avkD$L$1\$S\$l$؉"};Ѝ,ыum{9uT$$l$|$WD$ uD$ D$ ye ;av;1L$#D$ @\$$L$L$D$ @|؉L$>e ;aD$L$1B}mR4 8ؖttD$ Ë\t|l9t؉T$$l$t$V\$ D$L$T$D$ Ue ;avS$D$($D$,D$D$0D$D$4D$ D$0D$F'D$L$T$ D$8L$$D$ D$\D$D$ D$kD$L$DŽ$$$ļÉ뎉$DŽ$DŽ$ļÉT$L\$@ $|$D$dD$T$L\$@l$H.D$DT$L $D$HD$$L$D$DT$Lqe ;alH|$X1aL$L"T$PZ9<\k59ta$¯|$Ge u1A|$X5 p$$HÍAʉl$ $T$D$TD$OGD$L$ L$|$1D$D$T$ D$L$$HPL$(T$,H L$0p|$4M|$Xt$DŽ$DŽ$Hý|$X5@d DŽ$DŽ$H`} te D$;A `t$$D$D$3ԲD$L$ T$T$($D$$L$4$1 T$@ՉƉl$@t$,|$lG|$Tt$l:t$T/6D$L$ T$\$,l$$9VT$0΋ e l$4TDD$0uHC$9m$$D$($DŽ$DŽ$ĄÉt$D$ uD$*$HDŽ$TDŽ$XzDÍzd |$L$D$8D$TD$L$T$ u$H1c\$+$D$L$D$+D$ D$D$D$ED$ L$RQY iWA 1treetHu=authu Af=ort1$H$HH $\$T$l$ mQ1ҍ$$\$T$l$ D$L$$L$Z|$d$$Hxlt$d1yZl$DT$@$u 1gpgsqfigYu1pareu qfntt`  $ L$D$/D$ $HH8 $$L$L$@L$L$DL$ aP1$$\$T$l$ D$L$ $D$K|$P$$Hj9J ŲD$L$T$$He uʉË$H덍 拄$HH`h\l$L$$\$ T$ 5L$D$D$ L$$HB`e u J\z\2D$L$ $D$sκT$D$ ,D$D$L$T$@$l$DD$L$T$@$l$D111$L$D$8D$D$ D$ PD$L$T$$Hk\$s`t$L$T$L$D$ D$L$L$ D$$$D$D$LD$D$L$$HB`e uJ\D$(L$)z\M勔$6L$4$&D$<$T$$XuDÍ$1 3 $D$D$ML$L$HT$ \$$1$$L$H$L$0$$$DŽ$DŽ$$$ $ʹ\uDÐ uDËtd pd $T$XtDVi e ;av8D$$D$ D$D$$D$D$ *D$L$D$(L$,!e D$;ADŽ$DŽ$$HD$$$ы$@($ $ЋD$L$ T$\$$$DT$\\$($\$T$ʼnD$L$ L$D$ $D$$ @RD$k$plw $D$L$$$DŽ$DŽ$0$$L$_D$ L$$$@$L$(L$T$\T$D$L$ $D$D$D$ $D$D$D$ZQD$ L$$$$$$3T$01 T$dщÉL$d\$,|$HR|$4t$HEt$4:D$L$$$DŽ$DŽ$0$$L$"D$ L$$$@$L$(L$T$\T$辇D$L$ $D$%D$D$ $L$D$D$PD$$L$ $$$D$,@L$09DŽ$DŽ$0$ $ @ $T$(T$\$\\$D$ L$$L$$D$D$ D$RD$L$$$$@$L$(L$T$\T$臆D$L$ L$D$$H $ID$L$ $$gDŽ$DŽ$0$ $ @ $T$(T$\$\\$D$ L$$L$$D$D$ D$QD$L$$$$@$L$(L$T$\T$臅D$ L$D$L$$H8 $HD$ L$$$M$H`t$D$hD$ldD$0$4D$L$ D$hL$l@$D$(D$D$\D$քD$ L$$L$D$D$ D$hD$D$D$8MD$ L$$$$$t anĸÐTnĸDŽ$DŽ$0$ $ @ $T$(T$\$\\$D$ L$$L$$D$D$ D$0OD$L$$$$$H\P`Z9)ډ!Ӎ:1҄)U9 $T$5D$D$ vڻD$L$T$$L$T$ D$ D$D$L$D$pL$tD$xD$|0$L$pL$~D$L$ D$xL$|@$L$(L$T$\T$贂D$ L$$L$D$xD$D$ D$MD$L$$$$u $2ElĸÉL$`l$0$5D$t$"T$ $L$`l$01kĸÐkĸÐkĸÐkĸÐkĸÐkĸÐkĸÐkĸÐkĸ` `  e ;avO nd L$$ $ L$D$;D$L$T$\$ l$\$(T$,L$0D$4l$8 e ;a@D$D$D$L$ T$D$4$5D$L$D$D$HD$D$LD$D$4D$ ӜD$L$T$t$D$PD$TD$XL$\D$`@ËBJ R$L$T$aD$ L$T$D$PL$TT$XD$\D$`@ÉT$(\$$l$<D$,T$ `$LD$L$ e [L$,HL$$H L$(H e #L$L$ HL$H L$H e L$$HD$4@L$,T$(\$-;,$(D$ Px e L$4HD$0L$H e uxL$(H <$ݍD$ /V e u;L$D$ T$0H0$4$ыD$L$T$ \$D$ \$0$HL$ID$ HT$0$ыD$ D$ ³e ;a |$tNQY -`9u^Y t19t-e uT$D$D$ Éٳ1ϋd d D$L$D$ É$l$'D$ W Me ;aL$$\$ l$$t$ +7uȋM 5`9<Mm 9 e +11=d 9ut$ыD$L$d 9tsL$(D$,ÉD$L$ $D$d T$ D$ u D$L$D$(D$,Él$(L$,ÉL$l$T$,$L$d D$A D$ uD$$L$T$\$ l$5`2߉׳1-d =d ȍ5`1 $t$'D$MU Qe ;av |$ e u1`׳ٿe ;a<\r$D$PL$l~pT$h1 l$XUËD$PT$X\$|$<ܳ|$t$<ܳ|$(t$ܳ  $D$l$(l$wD$ D$@L$l9| $|$|$Te uyD$dD$PG $~e |$uEL$`L$TA Ae uy0wD$tL$x\ÍQ'ֳD$`ֳ붋D$dֳOϋD$Pֳxye ;akT|$9e ;aD D$,D$0D$$D$$ QL$y$D$$$D$L$ T$u~$T$(ЋD$L$t͋d 9tD$,L$0+ ÉD$L$$L$d T$$D$ u D$L$D$,D$0+ Ëd 9tT$,L$0+ ÉL$T$$L$d D$D$ u L$T$D$,D$04+ Ð*+ ѣe ;av5L$QA Ae uAÍy1te ;a0D$4HL$,D$|$t$D$L$ u(Ãt9;ET$899D$$D$0$L$T$\$ D$D$L$T$$T$L$D$ 譧D$L$|$,Ge D$ @L$$9T$89$)‰!‹t$0T$)L$l$ FD$L$T$,J e uCBD$$L$49}-wI$T$8)‰!‹l$0T$)L$\$ ~(Ízⶳ붉ٶF(   6!e ;a8D$(D$,D$0D$4D$<D$ 0 $o7D$ L$L$(D$,D$}ie ;a0D$4HL$,D$|$t$$t$p.$@$ $ЋD$L$T$ \$$$L D$4$L$D$L$D$ L$D$L$ $D$$ @RD$ `$D$4D$$LD$yD$L$ P9 É$hL$8 h $PL$$t$P$D$ wD$L$T$T$D\$ \$@l$$T$$t15d 9 $L$d D$ĮD$ $T$D$@D$D$DD$ںD$L$ T$c\$+ $T$D$D$+D$ D$D$D$ʺD$ L$ Q+ftakgBu typetbd $9 $$D$d D$îD$ DŽ$DŽ$ĤÃ! AQI L$T$D$ $$D$L$ftaQgu611ɺ$SP$$ĤÃublobu 11ɺ빃u=treeu 11ɺ렋d d 1됃뻃붉D$,$Du#commuQfitu11ɺM t/u $ L$D$D$ t11ɺ $wT$D$̴D$ t11ɺD$, $D딉 $D$HT$D$ 7D$D$,$D}D$,$D!IAQI L$T$D$ $}D$L$$Be uJz臍p\Tu+objekfctt[3tagg%SferAQI L$D$T$ $H $hkAQI L$T$D$ $$$|D$L$ $D$B|$\$t耒$xQt$\mx7T$X$pD$0$H$T$TD$D$ ~D$D$0$HT$X$pD$0$HT$X$pP$$PD${D$L$ T$\$l$$$D$TL$P$\$$щD$D$|$\$L$PL$T$TT$^D$"$$5D$D$|$\$D$PD$D$TD$1ƺD$L$D$<11$l ʉËD$<鉌$lT$X\$*il$Lqt$H9$X\$$^D$D$|$X$L$HL$T$LT$uD$$HLPHT$L$$ qL$ D$xD$L$$BLe u9JH1L$XA\$<9 DŽ$DŽ$ĤÍzH뾋$HLPHT$L$$$XL$ L$HL$ 5L$D$xD$ L$$BLe u JHD$*QzH{ꍄ$$щD$D$z$X$L$HL$T$LT$D$th$HLPHT$L$$ L$ D$}wD$L$$BLe u JHzHʈꋄ$HDP@T$L$$$XL$ L$HL$ 5L$D$bwD$L$ $JD e u B@D$*%z@Q$$\D$D$PD$D$TD$ (xD$L$$BDe uJ@z@ĤÐĤÍ $-0D$$d 3 $D$D$CD$L$ $`T$$x1v$`$x$|$D$8$$h$DŽ$DŽ$e u%$d$x軌P$d $$dD$$xL$ӉȉøTĤÐĤËpd td $$kĤ     ne ;av8D$$D$ D$D$$D$D$ *D$L$D$(L$,ne ;a`tDŽ$DŽ$D$|HD$$$ыD$|@($ $ЋD$ L$T$\$$$L$,T$($T$L$B D$L$ L$D$ $D$$ @RD$AD$xpQD$L$D$HL$LD$xHP8$T$L$vD$ L$T$D$PT$TL$X|$\1袅0$L$HL$D$ L$L$\D$`$D$PD$D$ L$L$dD$hD$xHL$ 0 $SD$L$ D$lL$p@$L$(L$T$,T$ D$ L$$L$׼D$D$ D$\D$D$D$WҹD$ L$$$$$|@$L$(L$T$,T$t D$ L$D$L$D$xH $D$ L$$$D$@D$D0D$@ ȶL$D @ $T$(T$\$,\$D$ L$$L$D$@D$D$ D$ԹD$L$$$$zD$8D$<D$xH@L$ 0 $D$L$ D$8L$<@$L$(L$T$,T$MD$ L$$L$D$8D$D$ D$qӹD$L$$$$$u tD$0D$4D$xHD$0$D$L$ D$0L$4@$D$(D$D$,D$D$ L$$L$D$0D$D$ D$ҹD$L$$$$N(tÐtÐtÐ tÐtÀuAк8uH#%uu wu htÐ^tie ;a0D$4HPHh|$PlIL$,pQD$$L$,ыD$ L$T$$\$(tD$8T$<\$@0ËT$4ZhRl$T$L$D$ iD$L$T$T$8D$ge ;avr,D$0HPt td pd D$4L$8D$<,Í|$pQHlL$(@h6$D$(D$PD$ L$$T$T$4D$8L$<,fre ;a0D$4Hh|$PlIL$,pQXPă\$$L$,ыD$$L$T$ \$(tD$8D$<D$@\$D0ËD$4Xh@l$D$L$T$ [D$L$T$\$\$8D$D$L$VD$HH L$8PT$T@D$4 $g"|$D$4GD$8Ge D$TD$\D$`D$\|$`X$D$\D$=D$ D$PL$L$0T$LT$dT$(T$hT$,T$l~$T$dT$OD$D$R)e ;av|$1jL$q |$_oQe ;avD$Qe D$;ADŽ$DŽ$$H$$$D$$H$$эt$|$8n$x t$8n$Q $$ҋD$L$!$GG e G($@$ $ЋD$L$T$ \$$$L$ \$L$L$\$D$ L$D$L$ $D$$ @RD$ϰ`$D$ D$D$LD$D$L$ P9É\$dL$$hD$PD$P$D$ /QD$L$T$ \$0B$D$D$L$T$ D$,D$P$D$PD$L$T$ T$(\$\$\t9D$TL$0-d 9 $D$d T$D$ ]$D$D$h P $T$PT$D$D$ D$D$L$L$(I&L$4|$l1>g|$xt$hlL$,L$tL$\L$lL$4L$p$Yi΍K9EKN e <ut$lku$|$D$lD$h1T$T$\$l$ L$"D$L$T$$We uˉ1nre쉄$$,հĸËD$0$D$T$ հĸÉ$$԰ĸËd 9t$$԰ĸÉD$TL$0 $D$d T$D$ u D$TL$0DŽ$DŽ$u԰ĸÍ $ D$D$` 3 $D$D$D$L$ L$XT$$1?eL$X$$$L$$$L$d$DŽ$DŽ$ e u|$`$iPD$`f $D$`D$$L$f1̉øuӰĸÐhӰĸ1cO(1~cDŽ$DŽ$-ӰĸËtd pd $$ӰĸzȰ sȰ Ke ;apDŽ$DŽ$D$xHD$T$|$ыD$x@(L$| $ЋD$L$T$\$ $$D$4L$($L$D$XD$L$ L$D$ $D$$ @RD$WʰN$ D$L$tID$e ;avGD$@P9s0\[uP|9sD$D$p i >e ;av,|$GG e u1UM>e ;a$D$(PI$ыD$L$T$ \$u\D$\$ H$$D$uD$(H @$L$D$D$D$ D$ BD$L$T$T$,D$0L$4$D$,T$0L$4$=He ;av|L$=D$ 3V e u3L$HT$PIRD$ $ҋD$ L$L$D$ ÍxD$Ty‹D$xTȉD$dL$hPD$dD$hPl{ e ;aD$L$  $T$ T$\$$\$ D$tGD$D$$D$ D$D$$D$ D$H P@D$(L$,T$0D$(D$,D$0Ie ;a D$$L$  $T$(T$\$,\$ D$uHD$$$D$(D$D$,D$D$0D$ D$4D$D$8D$RD$L$D$ $ Ptd L$L$ L$T$$T$ D$t D$, $ Ptd L$L$ L$T$$T$ D$ $Ltd D$D$ D$D$$D$ rD$t8D$$D$(D$D$,D$D$0D$ D$L$D$4L$8ËD$,~؋d ܋d D$4L$8ËD$,hċd d L$4D$8Ë̋d ȋd L$4D$8ËD$$D$(D$D$,D$D$0D$ D$L$L$4D$80e ;av8D$D$$D$ D$D$$D$ D$D$(ae ;a 8D$<L$  $T$@T$\$D\$ OD$D$<L$  $L$@L$T$DT$  D$D$ $L$L$#T$D$ D$ $L$L$AT$D$ D$ $L$L$T$D$ D$ $L$L$'T$D$ D$ $L$L$WT$D$ SD$ $L$L$wT$D$ $D$ $L$L$T$D$ D$ $L$L$T$D$ D$ $L$L$3BT$D$ D$ $L$L$"T$D$ hD$ $L$L$ yT$D$ 9D$ $L$L$4T$D$ D$ $L$L$3T$D$ D$ $L$L$MWT$D$ D$ $L$L$1T$D$ }D$ $L$L$úT$D$ ND$ $L$L$mκT$D$ D$ $L$L$_FT$D$ D$ $L$L$T$D$ D$ $L$L$wT$D$ D$ $L$L$OT$D$ cD$ $L$L$ںT$D$ 4D$e SD$Htd $D$  $D$T$D$ D$ $L$L$OT$D$ D$ $L$L$ںT$D$ D$e D$Ptd c$D$  $D$ ںL$D$ 8D$e /D$Ltd $D$MD$L$ ȋd e  ̋d !$D$MD$L$ d e  ċd  f$D$MD$L$ Ћd e uT ԋd $D$OMD$L$ ؋d e u ܋d je  Í=܋d =ԋd 룍=ċd ]=̋d =Ltd D$=Ptd D$d=Htd D$}e ;av>Yu;D$t%H$L$[D$L$ D$L$k 멍|$9;u#e ;avfD$uD$ D$$ËHPK$\$\$T$L$ |$e uD$밋D$ze ;aJhD$p'L$tuYHPK$\$l\$L$T$ _|$e uD$pD$xD$|hËD$pHPK$l$ll$T$L$ &D$u D$ppD$d|$(1L$dq |$(r|$L$tq |$Y|$Pt$(L|$e ;aD$tUL$ QY i5c 9)Q)Y e !ލD5uAQD$$ÍybD$ $HD$D$D$ D$D$D$$É$D$D$D$ D$D$D$$+G Tʲe ;apD$tH PX$T$L$pc hc lc L$ T$D$D$L$tQYi {KYMi y|$l5e ۇQ$\$D$(c ,c 0c D$ L$T$D$ZD$L$ 2HL$(PT$,\$dh pPL$tqQ e iD$D$䪺D$D$ѱD$d$L$(L$T$,T$D$t1L$tQ0e AuB QD$xpÍz D$tp|$0@0@D$h$L$dL$L$(L$L$,L$ ϱD$L$D$L$  $D$hD$خ|$t$0r|$l߲D$t$_D$D$D$ D$D$D$xpÉʼnL߲5D$t$0̻D$D$D$ D$D$D$xpÉ$|DD$D$D$ D$D$D$xpD 9Dze ;a D$$H0IP Xhl$\$T$ $D$L$t_t@D$D$D$L$D$$$=1D$D$D$D$ D$D$D$( ÍQD$( rƲ=e ;aVlD$p$+D$.D$pH PX$T$L$ Hc Lc Pc L$ T$\$D$D$pH PXh0ml$`$T$L$ @c в0$L$4L$>PD$L$ D$dL$h0D$l жL$p$D$,D$ PD$ L$L$tD$xZ$D$ D$dD$D$ D$D$L$D$<D$@D$D$D$L$ L$(T$T$ $D$T$Lc -Hc 5Pc l$ \$t$hD$t@D$0$L$(L$L$L$L$ L$ +D$L$GD$ $mK|$|$ e 0D$(_$CKe |$|$$D$ $KD$L$$AA e A$JD$L$$AAe qApXQe DA D$8L$  $#T$D$ ӗD$D$$ $ #L$D$D$ D$D$~D$8L$  $WT$D$ dD$D$$ $ WL$D$ D$ D$D$D$8L$  $T$D$ D$D$8L$  $wT$D$ 辖D$D$8D$$D$D$ 臖D$u D$$D$<4Ë L$,D$0D$$ $ L$D$L$,L$ D$D$릋D$$ $ wL$D$ D$ D$D$܉6D$$ $ L$D$ D$ D$D$蟉D$8L$  $'T$D$ 耕D$TD$$ $ 'L$D$ D$ D$D$+D$8L$  $T$D$ D$qD$$ $ L$D$ D$ D$D$跈4y y瞲yڞCD$ ̞D$(辞4oe ;aD$ HtX$D$L$u8D$ $D$L$t D$$L$(D$$D$(ÉD$$L$(Íл$D$D$D$ D$vD$L$D$$L$(]8e ;a D$L$H e u_L$(L$ H L$$H e u/L$,H T$LJ e uBHÍz跕xD$,觕ƉNjD$(蘕~Je ;a((D$,HAH $pD$L$,ZjBiY e y|$$uhA$l$\$c c c D$ L$T$NٹD$L$T$ \$,KS e u CD$0(Ë|$$蹔貔딋L$,B RQe uKAt D$0(É $D$D$D$ D$D$D$0(ÍyD|e ;a&PD$T$D$D$TH PX$T$L$ c c c \$ T$L$CϹD$tD$THPX $T$\$ c c c L$ T$\$׹D$L$T$ \$TKS e C$lt$|$8D$|$$t$8 D$THQYkA 9ZCAȸD$L$$Be uJ DŽ$İÍz wܯ ۯ _e D$;A$HQYI $\$T$|$@1 x$HQIL$(1 $UÉ$\$$|$T||$,t$T|D$@$D$D$L$,L$ D$D$ߜD$t^D$$@L$(9|$D$ BW e u$H$ĴÍx$,vݍ|$|t$,{DŽ$DŽ$$L$|L$D$L$ $$$ $ 6L$D$ $T$ D$D$kOD$L$u|$@t$,`{$L$ |$ht$,C{L$ tI$DŽ$DŽ$DŽ$DŽ$$D$hD$1D$ L$$$$$$$$D$$D$D$ D$.ŸD$L$$Be uJ DŽ$ĴÍz st\e $\;A=$$"u$(Qr R Z{l-pX9.uQ$=D$ CW e u$(H$,$Íx$(s݉l$$D$`D$d`&$l$D$L$ D$`L$d$( $ "L$D$ L$`L$ D$D$LD$L$L$4t@D$<DŽ$DŽ$DŽ$DŽ$ `d $L$$L$D$L$ $$D$<$D$4$$D$$D$D$ D$¸D$L$$(J e uB DŽ$,$Íz 4r䋌$(;t$8L$1s X9$w$$w X9$$w$r$$tS  Љ׉$€׃ $$%?$DŽ$DŽ$$$w$$v$$v$$  ȁ׃ nD$XD$\ '$L$T$D$L$ L$XD$\$( $ ЌL$D$L$XL$ D$D$JD$L$CL$0$$ut@D$ $M|$|$ e oD$(±$#e |$;L$ |$$GG e GD$8L$  $T$D$ aD$uyD$8D$$MWD$D$ `D$u D$$D$<4ËD$$ $ MWL$D$ D$ D$D$T뺋 D$,L$0D$$ $ L$D$L$,L$ D$D$e D$;A@^ $90$D$$ 0 $D$$ 5 $D$$$1 $t$ |$|$e uQD$D$Í_$|$t$N3e ;avBD$ H PXh$p(@,l$ t$D$$\$L$D$D$$G3e D$;A1$~E$$1|$|SP|$,t$|FP$+1필tC9|Ƅ$ĘƄ$ĘÉ$\$$1 $jƉ$t$|$hO|$t$hO|$Tt$,O|$@t$OL$T $L$@L$D$7pD$ u+D$@$9|1$\$ŋ$($1e D$;A[DŽ$DŽ$$$$$$HP$T$L$|$,1I$PT$(1$щÉ$\$$|$TN|$@t$TuND$,$D$D$L$@L$ D$D$nD$D$$@L$(9|$t$@uDŽ$DŽ$Í$$D$L$ttIDŽ$DŽ$$$$D$!$D$D$ D$D$L$$$Í|$|t$@QMDŽ$DŽ$$L$|L$gɭD$ L$$$$$ L$D$$T$ D$D$ D$L$u|$,t$@L$L$ |$ht$@LL$ tI$DŽ$DŽ$DŽ$DŽ$$D$hD$ȭD$L$ $$$$$$U4$D$$D$D$ D$舖D$L$$$f.e ;aD$ HP I$ыD$ T$T$ L$  $\$D$ @;D$t6D$  $D$L$A,D$A-L$$ËD$ D$$#D$D$ :D$-$e ;avED$ $D$L$H$ e uL$H(D$Íx(D$D$-e ;ar``$D$hD$L$lL$IʭD$L$ P9/É\$0L$XhID$,L$dY,Q-T$Q$D$9D$ L$$D$hD$D$lD$ɭD$D$ L$ L$w$D$ P e uiL$,HL$H e u?L$ H MT$dJ$ e uB(D$pD$t`Íz(RCx D$ BC붍xD$,0C댉D$pL$t`É $T$D$`D$L$ u D$,L$dL$pD$t`Í $=D$D$( 3 $D$D$'D$L$ L$$T$|$41CD$$D$4\$8T$&!e ;a#ie vuP ie rWǹB5VBź堳PCVLqN#;exz$D$D$L$ $D$D$D$ D$we ;aD$H\$k39tO1ɄtEKP8u5H S 8u%K P 8uK @ 8D$1111$L$l$DL$ D$\$Ye ;avNYuKD$ @L$$T$,T$T$0T$ $ЋD$L$T$\$ \$4D$8L$Yu;D$@ L$T$$T$T$(T$ $ЋD$L$ L$,D$0k멍|$9;u#e ;avNYuKD$ @$L$$T$,T$T$0T$T$4T$ T$8T$ $ЋD$L$L$e ;a$D$($L$,L$L$0L$D$ L$T$\$tD$4D$8T$<\$@$ÉD$ L$D$(@ /$L$D$脈D$ L$@T$ T$T$T$ $ЋD$ L$T$\$D$4L$8T$<\$@$[&e ;a$D$01ɄmD$(H L$PT$ `$੭|$D$Ge &L$ L$0O e D$,GD$($|$D$D$ ED$L$ $D$!D$ L$L$,D$0T$($\$4\$\$8\$D$L$T$\$ t L$Ue vu ` Ue Ue e ;av/ Yu,D$@I$ыD$L$D$L$ :븍|$9;ủ#e ;av/ Yu,D$@I$ыD$L$D$L$ ߱븍|$9;ủ#e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$8Z߱똍|$ 9;u#e ;av_$Yu\D$(@I T$,T$T$0T$T$4T$ T$8T$T$Yu;D$@(L$T$(T$T$,T$ $ЋD$L$ L$0D$4[ر멍|$9;u#e ;av. Yu+D$@,L$ $ЋD$L$L$ D$$ ױ빍|$9;u͉#e ;avNYuKD$ @0L$$T$0T$T$4T$T$8T$ $ЋD$L$T$T$4D$DD$HD$LD$P.>4Ð$>4É $D$'D$K 賶e ;aD$HL$ $D$ D$$WD$5uP e u*D$@@@@ p=ËL$y1ͱy1ͱ̐J=Le D$;A$H$ $%$D$$WD$5u$H$H $$ыD$D$L$L$$Z$,$Ӎt$$|$8xұ$t$8hұ|$`$Xұ$L$`$$QT$$$\$KD$ L$$T$9Xl$9݇Ç!9 Ζ$tIP$L$$L$軥D$ $$t$8ѱ  $$T$MD$ L$$$$HL$  $$T$ |$ e $D$L$$Z؋Z BˉZ D$(@$ $Ѝ|$t$б|$Lt$tб$L$L$$QT$$$\$*$BL$ )ȋJ BD$$J BJ 9Z9هÇ!9 ŕBH1$HP V$T$L$RD$ D$(L$$P $ҋD$D$ L$L$$$Z$u9}u e um7M5e ׋Uu$QEEEKIKxωɱ1zɱMpɱ}1fɱD$ UɱBB 9Ë@$"ɱ8É$HP V$T$L$PD$ L$@ $ЋD$D$4L$)L$0\$\$,$u4$$t$D$L$4)ȋD$L$,ȋ$tI$J e u$JD$0&z$Jȱ@@  $D$D${e L$ ur$H@$TpD$ e u9@@ e u$A$yDZDZHDZ빋$zDZ념Q7e ;a.LD$hD$lD$pD$PHL$@ $-D$@D$$WD$/|$t$Ṯ|$(t$̱D$DD$(D$HD$PHL$  $L$DL$D$ L$tVD$ h訅3e ;av D$@0D$|e ;aviD$ L$A $D$D$&XD$ L$T$\$K$S( e uC D$$D$(Í{ w{e ;avD$D$ 踄e ;avH$D$($|$t$,塱D$@D$D$DD$D$HD$ D$XD$\$Qe ;avMD$x t$w@0$=D$ L$t L$,D$0D$,D$0܃e D$;AT $H0 e$oCD$$ e ] $A4A D$$D$L$ $L$$1 DŽA}r  $BD$$Q$Y $T$@1$lC$9} rF ]\$<$\9/T$,L$(L$D9T$,4Rt$8|GD$4T99$T$0;$L$D$裡$\$,9L$8l$4ll$0l<-e $,T$\l$`ÇޅÇ!Ç $@@ @P  $D$T$N$HXh 9$))!͍ *T$,9D$8lTT$4t<9p9ht$0$/$L$\$]$\$,92T$8l$4ll$0l<-e O$,$@@ @P  $D$T$XT$M$HPh 9$ ))!͍ +\$,9tl$8|\$4t9\G9?t$0$8$L$T$I$ \$,9 L$8l$4ll$0l<-e $,L$l뜍|$ 9;u#e ;av:Yu7D$$cD$L$ T$\$T$\$ L$$D$(k뭍|$9;u#e ;avKYuHD$ $D$$D$fD$L$ T$\$l$T$(L$,D$0\$4l$8nk뜍|$ 9;u#e ;avCYu@D$$D$ D$lD$L$ T$\$T$$L$(D$,\$0k뤍|$9;u#e ;av* Yu'D$$D$D$D$D$xX j뽍|$9;uщ#e ;av"YuD$ $XD$D$gjō|$ 9;uى#e ;av* Yu'D$$(aD$L$L$D$ j뽍|$9;uщ#e ;av* Yu'D$$cD$L$L$D$ i뽍|$9;uщ#e ;avJYuGD$ $D$$D$D$(D$XkD$L$T$\$ \$,T$0D$4L$8Oi띍|$ 9;u#e ;av: D$$L$L$׬D$L$ $D$D$D$ he ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$5D$ 1݉$L$l$L$ D$\$Vhqe ;avNYuKD$ @L$$T$0T$T$4T$T$8T$ $ЋD$L$T$T$sO\t1E?tpx9s%uT*ˋpx9sT$ڮ ڮ ڮ ^xe ;aD$L$ 1һBh09}Ms],t$݉Ӌ$qy 9s6p P<9s)Ӯ 7Ӯ 0Ӯ )Ӯ "Ӯ Ӯ Ӯ Ӯ Ӯ Ү Ү Ү Ү Ү We ;a|$D$D$x$ $$T$$T$$T$ $T$D$$L$ T$\$l$t$x=e TF$T$0\$Tl$,$$\$l$T$ 11111|$LGƉωщ\$ll$<|$,9 D$LT$@t$D|$T<|$\$D$ e L$\T$L$L$t$1111T$pL$t݉Ë$T$p\$4l$,t$(|$l|$Ln|$8t$Ln$D$|$|$tt$8nD$$L$ T$\$@T$`\$0$D$L$0e T$`PD$dH e x|$hP4$L$T$D$D$d@ e n@L$(Q\$,9l$l֋e |DD$4@$9$t$(\$,l$lD$|$l$t$\$ D$L$t3DŽ$DŽ$DŽ$$$xËD$l$D$($D$,$DŽ$DŽ$xÉ$$$DŽ$DŽ$xf`.$l$ll$L$\$ T$#l$D$\$PD$dL$(|$h1fD$d|f-x‹D$`vfÉЉDŽ$DŽ$DŽ$$$xËD$|$|$tt$8l/T$\$L$ D$$W111.zNe ;a0D$4H`$T$L$D$L$ T$tFIL$,D$|$t$8lk$D$,ЋD$ L$$T$(\$\$LD$PL$TT$X0ËD$4$|$t$8+k8D$L$T$ \$$D$LL$PT$T\$X0M*e ;avR0D$4@IL$,D$|$t$8j$D$,ЋD$L$ T$$\$(D$LL$PT$T\$X0'Me $\;AY$|$<1ke|$X6eL$XL$H  $$0T$\$<\$L$L$8T$ T$41\$CL$8T$4$09}kD$$,T$0$3|$t$8i $L$4L$T$T$} |$ e uD$0뉋D$0c{1L$AT$4$09}FD$$,$(,$T$\$HD$L$ t$8$<$DŽ$8DŽ$<$Ke ;a0D$<PI$$D$|[D$L$Q Ae uAAD$D$ Íy_ۉL$D$ e ;aD$(L$ 9L$$%D$L$,T$ 9D$D$$$D$L$8D$(L$$$D$D$L$,T$$$D$L$8~ D$0ËD$(L$$%&D$D$L$L$T$,\$$&D$L$T$9Ël$9!9 ؈D$0D$0) R=e ;aTD$lD$pD$tD$xD$\@L$` $ЋD$L$ T$\$T$H\$,$ CD$RD$d@L$h $ЋD$ L$T$\$L$ Re ;aD|$L10L$L$@T$HZj ujB uRB 4$L$D$㶬D$L$ T$t\I$э|$t$@[5|$Lt$N5DÍr,|$L>5DËE$Ѝ|$,t$@%5|$Lt$,5DÍ0$D$N e ;aD$HP ubH uHH4$D$L$D$L$ T$tJI$ыD$L$L$ D$$ËH(@$D$ L$$ËB $ЋD$L$D$ L$$Í0$D$胡 7e ;avD$@D$e ;avDL$ T$ e uD$BD$B@@BÍzD$-zD$-5e ;a>`$D$0D$L$4L$YD$L$ $D$JD$D$$D$ `D $լD$L$  e L$$HL$(H e L$,H L$0H e uSL$4HL$HL$8H e uL$\ËD$`HP L$T$  $qTD$L$ L$D$ D$tD$$ @RD$s6 hc $D$L$9D$8QT$,IL$0\$`k [\$l$`$SD$ L$D$L$ D$d$D$hD$D$8D$L$,L$T$0T$D$ L$T$$\$(L$lD$pT$t\$xD$8D$PD$,D$TD$0D$X$D$PD$ OD$L$ D$L$hc $k%=\Ð=\ËHT$L$ ` $ SD$L$ $D$XD$L$T$ \$D$tL$xtut@D$@D$DD$@L$D:$D$D$@D$D$ D$1D$L$D$lD$pD$tL$x[<\Í@9$\$T$RD$ L$T$`Be uJ z F̰$T$'D$I 褴?e ;a(D$,Hu@PID$D$D$ $ыD$L$T$\$tD$8D$D$L$D$L$ D$D$ øe ;avdD$ HP I\$$\$\$(\$\$,\$ $ыD$L$ ‹l$t$yljyT$0l$4t$8蕰e ;avPD$t%8td D$D$ L$D$ ËD$HD$L$D$D$ )e ;av D$4D$8D$<D$@D$0u L$,‹\$(ۇÇ!D$$HT$L$ ` $LD$$HL$$ @L$/uSD$$@IT$(T$T$,T$T$0T$ $ыD$L$T$\$\$4T$8L$Ie ;aD$HT$Z*091ɄJX9HX jr 91ɄuQ1ɄtGJ$Z(h(9Ëh$9!˄u 1D$Ã,$B,D$D$ܫD$ 1ӍJL$H $D$`ܫL$ D$T$눉$L$l$L$ D$T$`1Y1R4$L$\$L$ D$T$e ;avBD$$L$L$D$L$ $D$D$(&D$ D$藝e ;avbD$HT$Z*09t*1Ʉt JX9R @ 9!ȈD$14$L$\$L$ D$T$e ;avaD$$L$L$D$ _%D$ L$Q $D$D$L$ $D$D$)%D$ D$蘜e ;aD$D$L$ $D$ [ګD$ tVD$HP \$ks 9t1Ʉt@K8D$14$l$L$L$ D$\$ċD$\$1뛰Ve ;av: D$$L$L$ܫD$L$ $D$ܫD$D$ 菛e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$%٫D$ 1݉4$T$l$ ٫L$ D$\$qe ;avJD$$L$L$D$?#D$ L$ $D$D$, #D$ D$菚e ;av@D$T$8t 1D$ÃD$B$D$,5ثD$ )e ;aD$$L$L$D$)k"D$ L$Q,$D$ݫD$L$Q4$D$}ݫD$L$Q<$D$ګD$L$D $D$OݫD$D$~Ye ;a0D$D$L$ $D$);׫D$ D$H,T$Z0j,p091ɄH8X4j8r49tt1ɄtjJ@ZYu;D$@L$ $ЋD$L$T$ \$\$@D$DT$HL$L+멍|$9;u#e ;av>Yu;D$@L$ $ЋD$L$ T$\$\$@D$DL$HT$L軑멍|$9;u#e ;av>Yu;D$@L$ $ЋD$L$ T$\$\$@D$DL$HT$LK멍|$9;u#e ;avK(YuHD$,|$@ L$0L$$t$TVL$$ $ЋD$ L$T$L$hT$lD$p(ΐ뜍|$,9;u#e ;aTY$1 L$XT$\I$$\$$\$$эt$ |$,蹭L$ L$(T$$|$@t$,蠭$t$@萭L$($$TR|$X9;j#ce ;avS,YuPD$0|$@(L$4L$(t$XL$( $ЋD$L$$T$ \$\$lD$pT$tL$x,膏딍|$09;u#e ;av=Yu:D$t$HP$L$T$PD$ D$# 몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$4PD$D$( 蛎뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$4O+ $뢍|$9;u#e ;avBD$$L$L$D$_D$ L$ $D$ѫD$D$跍e ;avXD$T$9uAJX8u1J XR@ 9t 1D$É$L$D$ثD$ 11Ae ;avYD$$L$L$ЫD$L$Q$D$ЫD$L$ $D$D$QD$ D$e ;aD$HT$Z*09tV1ɄtLH Z jp9t1ɄtJ@9D$14$L$\$֫L$ D$T$1‰4$L$\$֫L$ D$T$Re ;avV YuSD$$@L$(T$8T$T$$$D$L$\L$TD$ $HL$DD$|$$뢰$ $T$DҋD$$L$ T$\$(|L$pT$<$$$\$T$L$ D$L$T$\$%tJA= &DU=I>9$y= &Du9ZD$ $n2|$|$e D$$-=$D$ !=$D$ ` $,2D$D$  $2D$|$GG e D$GD$ GD$G$1D$L$A A$e AD$,PX T$\$ $輜D$ L$uND$H $ce u#D$L$,AD$0D$4D$8(ËL$,yD$Ԉ֋T$,$D$L$D$L$ tD$0L$4D$8(Íy薈K茈Oω‹D$zzD$ nzD$bD$$T]L$0D$4D$8(pe ;a8d L$@9d 99urD$DtL$HD$DD$L8ËHP @L$T$D$ D$$wD$L$$L$D$uL$@묋(d ,d D$HL$L8ø닉 $D$DD$d T$zD$ tXD$<Hu8$ D$L$t D$HL$L8Ëd d D$HL$L8D$HD$L8ËL$@ $D$DD$d T$D$ u L$@D$<@!$tD$L$t L$HD$L8Ëȍd ̍d D$HL$L8nJe ;aQD$HT$ \$9T$PL$ \$$ D$d$l$hl$D$ ?D$L$ T$0$L$D$PD$D$,L$ T$(\$ l$$9"t$P]9Ut$Pl$$$\$D$=gD$,L$ DL$$9T$PT$PD$ L$$\$(\$\\$l$`D$ l$dl$l$hl$$-Ql$ƭuDD$\H@ IT$PT$T$ T$T$$T$ $ыD$L$D$lL$p`έXÐVέXÍ3$T$PT$T$(T$L$ D$LT$D$L$@)\$T3$\$P\$L$l$ T$t$l$D$,L$ T$(\$TD$ -3,$T$D$\$ L$T$D$\$HD$ uAкuH%uwguw Ru =d d L$lD$p̭XËd d L$lD$p̭XN­ wEre ;a$D$0L$(A$T$4Q(\$,$D$T$D$L$ T$(J e BD$D$D$D$ B JL$D$@$4D$L$ L$D$D$(HL$  $ޫD$ L$L$D$ D$$D$D$D$ L$T$(Be uJ$Íz[z[6ADe ;a D$$H L$,X$9ڇÇ݋p(9Ç!9 L$09T$hpm|$(|$\$L$ 4$ՋD$L$$Q$)‹l$t$y(Q$)ljy(tT$4l$8t$< D$td d T$4D$8L$< ËL$01od d D$4L$8D$< ο Be ;avB0|$81K[L$4QI $T$jt$|$ `|$8t$_0Be ;avI D$HP I$ыD$L$t D$L$ ËD$@ D$D$ 0Be ;a_ee vu@ ee &in$D$hD$ L$ d e d $D$0D$L$ d e  d $D$D$L$ d e uT d j$D$1ģD$L$ d e u d ee Í=d ^X=d OX룍=d @X]=d 0X@e ;avQ D$$L$L$7D$L$Q$D$ D$L$ $D$ D$D$ 8@e ;aD$HT$Z*09tt1ɄtjH Z jp9t;1Ʉt1H@ZR9t 1D$É$L$T$kD$ 1݉4$L$\$PL$ D$T$1뤉4$L$\$-L$ D$T$lf?1e ;aD$$L$L$D$L$Q$D$܂D$L$Q$D$łD$L$Q$D$讂D$L$Q $D$D$OǫD$ L$$ $D$D$0ǫD$ D$>:e ;a<D$HT$Z*091ɄH Xj r91ɄHXjr9ts1ɄtiHXjr9t:1Ʉt0J X 8u J$X$9R(@(9!ȈD$11$L$l$uL$ D$T$1륉$L$l$RL$ D$T$m1f$L$l$)L$ D$T$*1#4$L$\$L$ D$T$9=e ;a\x`$|$|$Te 5@PZD$|HPI\$T\$D$D$ $ыD$D$,L$L$P`$e |$|$L5PYD$|HPI\$L\$D$D$ $ыD$D$HL$L$(`$|$|$De 5~YD$|HPI\$D\$D$D$ $ыD$D$$L$L$@`$|$|$<e v5YD$|HPI\$<\$D$D$ $ыD$L$L$8|$X1SD$PD$XD$,D$\D$HD$`D$(D$dD$@D$hD$$D$lD$8D$pT$t1L$,AD$,L$|Q\Xkl$\$0qR@\$l$4$ҋD$L$tD$ L$4$L$D$tLD$|HPI \$0\$\$\$D$ $ыD$L$^$$xËD$ $D$4$xDŽ$DŽ$xÍ`$|$D$Tt`$|$D$uT`$|$PD$TT``$|$@D$3T9e ;aLL$PQ8|$1Q  $T$L$L$11D$T$L$ $yD$L$T$t?D$L$ D$ @I$ыD$L$tT$ tD$멉‰룋T$ e u/T$PB8t L$TD$XLD$TD$XLËT$Pz811P118e ;avKD$ H@IGкT$D$$ыD$ L$T$\$D$$L$(T$,\$0.8e ;avKD$ H@I$GкT$D$$ыD$ L$T$\$D$$L$(T$,\$07e ;avKD$ H@IT$D$$ыD$ L$T$\$D$$L$(T$,\$0N7e ;avKD$ H@I$T$D$$ыD$ L$T$\$D$$L$(T$,\$06e ;avKD$ H@IT$D$$ыD$ L$T$\$D$$L$(T$,\$0n6e ;a$D$(H@I$T$D$$ыD$ L$T$\$teT$\$ $\$K۳D$t$D$,D$0D$4D$8$D$,D$0D$D$4D$ D$8$ÉD$,L$0D$4D$8$5$e ;avL$e u`A4A,A0e u5A(AI $D$_D$L$ T$T$L$ D$$Íy(1}Lƍy41qL4ee ;aD$te$DD$L$t$D$ D$$D$(D$,L$0ËD$H,P0@(D$ L$$T$(D$,D$0É$?D$L$ T$\$l$\$ T$$L$(D$,l$049e D$;A`$|$$e l5&Q$HPI$\$D$D$ $ы$HT$\$@I,\$T$$ыD$L$T$\$ UT$($D$$1111\$4C͉Ɖ׋$T$(ً$9l$ t$$L$4$ˋT$,@$j$ՋD$L$Q9)щ!ȃU1uD$$L$ $_D$,@$ $ЋD$L$Q.%ȉ$T$V|$8$O|$Lt$8O|$`1J$t$LlO|$tt$`_O$ $L$tL$D$oD$ tD$$L$ $D$ HT$$9'$L$ ,DŽ$DŽ$DŽ$DŽ$DŽ$ĴDŽ$DŽ$DŽ$D$0$$$ĴÍ`$|$D$J~  )0e ;aHt$PZMD$L$L$0D$4D$dD$(D$hD$,D$8D$<D$@D$D0$L$0L$1ȫD$L$ D$8L$<0$D$(D$ ȫD$L$ D$@L$D%$D$ D$8D$D$ D$荖D$D$$L$L$`$|$|$ e uo5;VLL$T$ J e uAD$$BD$LH@IT$D$D$ $ыD$L$D$lL$pHÍzD$$ F븍`$|$;D$H{x.Se ;aTDD$HH8$|$|$@t$LKD$L$D$H$|$@t$LiKL$`L$T$dT$D$$D$(L$ L$4T$HZ8\$$L$D$ ;D$L$@>D$HHPI$\$4\$l$(l$$ыD$L$T$\$ D$HHtL$duL$` packt\$hT$lD$pD$tDÉT$8\$,@8D$$D$4D$D$(D$ =D$L$,e u T$8P똍xD$8^DD$+Ie ;a4D$8$|$|$0t$<]H D$L$tD$PD$TD$XL$\4ËD$8$|$0t$<H1D$D$7D$ L$$T$(\$,D$PL$TT$X\$\4~*Ie ;ak`L$de EA4A,A0e A( $|$|$4t$hcGD$D$D$ L$$L$,|$8t$|3GL$<\$8 Ӊ ˉفÀ׃ !لZ?L$dQYR4D$D$,D$$ҋD$L$ t$$`ËD$d$|$4t$h|F 1L$D$D$dH@I4T$ \$$T$\$$ыD$ L$$$`ÉD$0L$dQYR@D$l$,l$$ҋD$L$ T$\$u^I$эt$|$LEt$LE|$t$|EԲD$(t D$0DŽ$DŽ$`É$$`1L$@l$Dډzy(1?y41t?'ue ;avL$e u`A$AA e u5AAI $D$bD$L$ T$T$L$ D$$Íy1>ƍy$1>J'ee ;a$D$(te$$D$L$t$D$,D$0D$4L$8D$<$ËD$(HP @D$,L$0T$4D$8D$<$D$D$D$ D$D$ @YL$L$L$$D$D$mD$L$ t$D$,D$0D$4D$8L$<$ËD$L$T$ D$,L$0T$4D$8D$<$ &e ;aPD$T$D$L$D$TH@~aL$ 1 \$L‰؉D$LT$|$8B|$$t$8Bt$$BL$XӋD$L$u!D$@L$ 9|D$\D$`PÉD$\L$`PÉL$\D$`PÉ$D$XD$%D$ L$L$\D$`P$e D$;A$HPI,\$D$$ыD$L$T$ \$-L$ $D$$1l$8]$L$ $9\$8ڋL$$@$i$D$tD$$H$$ыD$uD$$H$$ыD$L$ $D${CD$gD$$@$ $ЋD$D$0L$$`$e |$$5@L$0$J e $B$HXIT$D$D$ $ы$HPI,\$l$l$\$$ыD$L$ T$\$/D$,$1\$4SD$,$9ZT$4ы@[$ӋD$L$$$$T$\$0\$L$ D$(D$L$$L$|$P$?|$ōp$l$\$T$ t$ٮD$L$T$|$8We u ˉʼnaD$@D$D0ÉT$@D$D0He ;ak0D$4$D$D$L$L$D$D$d$D$L$$$$(tRsÉ$#D$L$$$$($ $L$,L$L$hL$L$4L$ L$lL$6 D$L$$$$($$T$09D$t1\$ $D$D$D$ ׷D$L$T$RJщ $HD$\$Ͽ$HT$T$,\$ \$PhI<,$ыD$D$@L$L$``$萢|$D$@Ge uYL$`L$,O e u,D$PG<$D$D$%ϿL$ D$Oω‹D$PŋD$`뢉D$$L$L $D$D$ T$ D$$L$L0$$d 9$$t<DŽ$DŽ$DŽ$$$hĴËD$l$D$8$D$<$DŽ$DŽ$hĴÉ $D$d D$+D$ K11PshĴDŽ$DŽ$DŽ$$$7hĴÍ`$|$P;D$4] e ;avD$H@D$L$ ve ;avKD$L$1B9}4kЕ vkwuD$ ÍkD$ e ;avhD$H@D$L$ V$+}D$ L$$L$D$D$ WD$t D$D$߯|e ;a,D$4HT$8$ыD$D$ L$L$(T$D$L$$$]ĔÉ$$$]ĔÉ$$]Ĕ3֯~e ;aKX`$ٕ|$|$Te 5@D$\HT$TT$D$D$ T$`$ыD$\HHT$\$T$\$T$ D$ T$`$ыD$ L$T$\$rT$D\$,C$ЋD$\H$T$`$ыD$L$T$\$ &D$H\$0@$D$,D$L$DL$hrD$ D$$L$L$< h$T$0T$\$H\$:rD$ D$(L$L$@$D$T,D$D$P @ $~D$L$$ e iL$e ;avFD$ @$D$$D$D$(D$D$,D$ 4D$L$T$D$0L$4T$8ϯe ;aD$D$ D$D$$ 0RL$NTD$H $2 D$L$#D$ D$D$H< $L$ L$K2D$L$ tQ9u0td 9u11ɅD$H PI$ыD$L$D$HPI$ыD$L$uWD$H8tI0u"$D$L$L$D$ UÉ$D$L$D$L$ yUÉL$D$ gUÉD$L$ UUÉL$D$ CUÉL$D$ 1UÐ'UͯIe ;av;D$HPI$ыD$H@I4$ыD$ L$D$L$ nͯe ;a?`D$@D$DD$dH L$  $fD$ L$L$@D$DK$D$D$@D$D$ D$.4D$D$$L$L$4`$蠌|$|$0e ~5p;L$$T$0J e ID$4BD$dHXIT$D$D$ $ыD$D$ L$L$,L$XD$\D$8D$<0$\$X\$dD$L$ D$8L$<yȺ$D$D$8D$D$ D$-3D$dHPI\$l$l$\$$ыD$ L$T$\$ZD$L$(@$D$L$hD$ L$D$L$D$d$iD$ L$D$@L$( $ЋD$L$t D$hL$l`ËD$dHPI$ыD$D$4L$L$$T$,T$HT$ T$LD$PD$T0$T$HT$icD$L$ D$PL$Tݺ$D$D$PD$D$ D$1D$dH@I8T$\$l$4l$l$$l$T$ \$$ыD$L$L$hD$l`ÉD$hL$l`ÉT$h\$l`ÍzD$4`$|$p;D$lʯe ;avnD$@8$AD$ L$T$t L$(D$,ÉT$D$ $D$$D$&D$$D$D$$(D$ L$D$(L$,{ɯve ;aD$0D$4D$8D$ D$L$0L$ $ D$u D$0hOÐNǯe ;av&D$ $D$D$Sǯe ;av&D$ $D$D$ǯe ;avPD$ $D$uËD$ H $D$D$ @($"cD$P Ưe ;aD$H $D$D$ L$L$T$Z$D$L$T$9Ël$ 9!9 ؄uËD$H $D$D$@($D$^)ůRe ;a0D$@uJL$4QI R\$8\$\$<\$D$ $ҋD$L$T$\$\$DT$HL$LD$P0ËL$4QY Rl$8l$l$ʯL$q|$ϯ諱e ;aD$(D$,D$ $yD$L$ T$\$L$(D$,T$\$$\$T$ND$ L$D$L$ D$(D$$ @RD$0u`@$D$D$D$D$;ND$ L$$L$7D$$D$$D$蓩D$L$ D$(L$,7Ð7Ð7耰e ;aLD$TD$XD$\$pD$D$(L$P $xD$ L$T$\$D$XT$\tI$T$=UD$t"D$(D$TD$XD$\7LD$T7LÉL$,\$$\$L$LD$L$ L$D$ D$XD$$ @RD$.`$D$D$D$,D$LD$ D$L$L$$$oD$D$0#Eg@@ܺ@ vT2@@T@X@\ @ $ L$D$%LD$D$ L$ L$J$nD$L$ e L$$HL$H e uyL$ H D$4|$81Ư|$8Ư L$8L$4L$< L$@L$0L$DL$8 $L$(L$pL$ T$T$XL$\L$(L$TR5LÍx D$ půyxD$$[ůL5LŭPe ;a$D$($D$,D$D$0D$D$L$T$\$ tD$4D$8L$$gD$ @Y e uBL$H|$ e u$MD$|$ D$$D$(Ծ׍xD$ľD$D$ D$$T$(D$D$ D$$L$(e ;aH|$X1GD$lD$pL$PQ$\$T$L$u5d d L$(|$X5e ïL$(L$lD$p-HËD$PH$T$T$D$tD$L@ $d~D$L$ T$T$lL$pD$@ L$D$ L$lL$$ @RT$%D$PHT$T$ыD$L$T$ \$T$lD$pL$D\$$$\$L$CD$ L$D$L$ D$lD$$ @RD$%&D$PH$T$T$D$D$#L$PQ \$T$ҋD$@L$T$$\$#\$T$L$ \D$L$L$lD$p`$D$$D$D$DD$FBD$ L$D$L$ 0$D$@D$D$L$D$lL$pt|$X5e +HËD$P@L$T $Ѝt$|$,|$Xt$,+HÍ|$X5e +HÐ+HÍ|$X5e w+HÐm+HÍ|$X5e hT+He ;awLD$hD$lD$PH $|$|$Ht$T D$L$T$$\$ \$hT$l$T$HD$D$P$D$L$ukD$P$|$Ht$T-D$DL$@!Ȅtd d D$hL$lY*LD$hD$l?*LÉL$hD$l-*LÐ#*LÍ$L$D$@D$ L$D$L$ D$hD$$ @RD$"uD$hD$l)LÐ)L^ie ;a,D$HD$LD$PD$TD$0@ $|$t$4^;D$L$ T$$\$L$PT$Tt] $T$#GD$t.d d D$HD$LD$PL$T(,D$HD$L(,Í ` $D$\$>D$L$ $D$ND$L$ T$L$PT$TutD$( PL$D$ L$PL$$ @RL$ u6D$($`OD$L$T$ \$\$HT$LD$PL$T*(,Ð (,D$HD$L(,譠Xe D$;AxDŽ$DŽ$DŽ$DŽ$$$eD$L$$$|$$$rt$$]D$DL$@L$H|$\$AT$H!لMD$L$H $$t$\sD$L$T$$\$ $$$L$T$L$D$D$@ $@D$ L$T$\$l$T$ L$$D$(\$,l$0Kue ;av@4D$8@ $|$t$D$  e u L$(H뫍xD$(gPi[e ;aDlBD$dJL$?R T$`X $|$t$p솯=D$ L$T$\$$t(DŽ$DŽ$$$lÉL$hT$DD$dH QT$\IL$@|$Ht$p聆HL$  $L$HL$7D$ @T$dZjRT$(T$@$T$\T$T$DT$T$hT$ T$?T$T$`T$L$D$\$ l$$D$,L$0T$4\$8$$$$lge ;avwe vu we |7 (辂)蚍u%苾&a謄Wwe gee ;avD,YuA|$41L$0IR $ҍt$|$ل|$4t$̄,eg룍|$09;u#e ;av?YuYu;D$@L$ $ЋD$L$ T$\$\$PD$TL$XT$\[멍|$9;u#e ;av. Yu+D$@L$T$HT$T$LT$ $Ѓ Z빍|$9;u͉#e ;av'Yu$D$ @L$T$DT$ $ЃbZ|$ 9;uԉ#e ;av. Yu+D$@ L$ $ЋD$L$L$HD$L Z빍|$9;u͉#e ;av'Yu$D$ @$L$ $D$D$DY|$ 9;uԉ#e ;av>Yu;D$@(L$ $ЋD$L$ T$\$\$PD$TL$XT$\KY멍|$9;u#e ;avP$D$L$  e uL$H L$D$ÍxD$RpXe ;a$D$(@IT$,Z(R$T$\$$ыD$L$ T$\$D$ L$Q@Gк\$D$$ҋD$t((d ,d D$0D$4D$8L$<$Í$D$@L$ $L$ L$ vL$D$ D$ @L$0D$4D$8D$<$D$0D$4T$8\$<$We ;a `C$9D$D$L$ e uNL$H$ e L$uD$H ML$D$ ËT$zwn܍xD$gnV[e ;a$D$(PI\$,\$$ыD$L$T$\$ uzT$\$D$(@D$ @ $ID$L$ e u3L$HL$  H yL$8D$ $}|$|$e *D$$<$D$ 0$D$ ` $;D$D$  $%D$|$GG e D$GD$ GD$G$D$L$A A$e :AAD$D$,$2D$ L$L$,e \$CAA$D$\$D$L$ D$,H$L$L$L$D$L$ u_D$,@ tMD$Ht> tD$0D$4D$8(Ëd d D$0L$4D$8(1D$D$0L$4D$8(D$0L$4D$8(Íy7gD$0L$4D$8(Íyg gOω‹D$fzD$ fzD$fSD$$fJOue ;a.\D$l${D$D$l$D$L$D$`HPT$X$L$lT$$D$ L$ e T$lL$`ABl $T$D$L$T$\$ l$0T$$\$ l$8~$D$襪D$D$T  $D$ʥD$D$P @ $D$謥D$D$L  $ e L$L$0}D$TAD$PA D$LA$ e |$|$H6D$0$s e |$|$4D$0D$`HD$L$`$D$L$ L$D$ $D$4D$D$D$D$D$8D$ D$ D$D$$D$D$4D$$RD$``$0ND$L$HL$/D$D$,L$ L$$ D$L$dH e L$hH D$DL$ e L$,H$0ND$D$HD$D$D$ $| |$e uBD$@D$`x|$$D$L$ u D$`D$pD$tL$x\ËD$@a|$XaNjD$`D$pL$tD$x\Ëd d D$pL$tD$x\Ie ;a?@D$DHT$L$ ` $D$L$ T$HZ$j(r,\$l$ t$ $D$D$D$D$ӾD$ L$$T$(\$,l$0t$D$LD$PD$T\$Xl$\@ÉD$ $M|$|$e D$$ $D$ $D$ ` $ D$D$  $D$|$GG e ID$GD$ GD$G$D$L$A A$e AAD$D$,$D$ L$L$,e \$CAQ$T$\$D$L$ uYD$,H$L$D$D$D$L$ tD$0L$4D$8(ËD$D$0D$4D$8(D$0L$4D$8(ÍyN]eD$0L$4D$8(Íy-]#]Oω‹D$]zD$ ]zD$\D$$\aEe ;a@D$DHPT$<qL$PT$$D$ L$; e T$PL$DABD$(JL$`$L$D$ D$D$$L$ L$$D$L$HH e L$LH D$8L$ e rL$$H$D$D$D$(D$D$D$0L$ L$ w$D$  e L$8HL$ H e L$0H L$D $MT$D$p D$L$ tdT$DJe uIB D$,L$Je u'B$ D$D$TD$D$XD$,D$\@ÍzZҍz Z밋D$D$L$PL$,D$D$ D$L$DQID$TL$XT$\@Íx D$0Z#xD$8ZxD$$lZx D$LYZP|$ $v|$e uBD$4D$Dx|$$ D$ L$u D$D9D$TL$XD$\@ËD$4Y|$ 3 $D$D$L$ L$4T$\$|$T1>L$4L$TT$X\$\L$L$`L$8L$dD$xD$|$t$TB$ʹDŽ$DŽ$$$Ĭ%e ;a#,D$8L$4L$4D$8 $D$TD$L$` 9FuY I-d 9tD$HD$LD$PT$T,ÉD$T$ $\$ d D$ oD$ u D$T$ 볋D$4$D$8D$D$L$T$ \$D$$D$(D$#:N][z$D$`D$D$ D$L$0d e  4d e ud uyc ud 0  $D$ZD$L$ c e u4 c e |ud uc pe Í=c 4=c 4Í=c 4뀍=4d 4X e ;avaD$$L$L$D$OD$ L$Q$D$x`D$L$ $D$D$D$ D$e ;aveD$T$9uNHXjr9t1Ʉt@ J 8D$14$l$L$fL$ D$T$1e ;av: D$$L$L$\D$L$ $D$\D$D$ e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$EYD$ 1݉4$T$l$*YL$ D$\$qe ;aD$$ a$ڪD$L$H e uhL$H L$ HD$ $D$L$tD$,D$0D$4L$8ÍD$,D$ D$0D$4D$8Íx D$1yD$ 1눋 d $d D$,D$0D$4L$8e ;a4D$8HP X\$$L$ D$ D$L$L$T$8R\$T$@$ D$L$ D$ D$$L$ D$$$D$D$D$D$?"D$ L$T$D$(D$,D$0D$(L$,T$0D$ $D$(D$D$D$ D$L$L$ $2̪|$|$$e D$@֪$D$<֪$D$8 ` $˪D$D$0  $˪D$|$0GG e `D$$GD$D$D$d$ $T$D$9D$L$ $$$D$$D$ЫD$ D$D$HD$D$,D$D$dD$D$ L$(T$$vD$LH$P T$L$ ` $D$L$ $D$8D$L$T$ T$T\$\$4-d 9$ L$  $WT$D$ u D$c ^$D$D$@L$4e (T$TP$ɽD$L$4He T$TP@e \$@X $Q IH e fP$ 0L$0D$XT$LZ$R T$\$$賚D$D$`L$ L$<w$D$L$0 e L$XHD$hL$yd?u(ٷ{cFa7$D$L$ @d e uDd re  Í=Dd +e ;avD$D$?e ;avD$D$D$D$ e ;avD$D$Ze ;avD$D$*e ;avD$D$e ;av: D$$L$L$(D$L$ $D$(D$D$ e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$5%D$ 1݉4$T$l$%L$ D$\$qe ;avBD$$L$L$*D$L$ $D$D$ 8oD$ D$e ;aviD$HT$Z*09t11Ʉu 1D$ÍJL$$D$ K$D$ ׉4$L$\$0L$ D$T$ {e ;av"YuD$ $D$D$Pō|$ 9;uى#e ;av* Yu'D$$D$L$L$D$ 뽍|$9;uщ#e ;av"YuD$ $D$D$7ō|$ 9;uى#e ;av"YuD$ $D$D$`ō|$ 9;uى#e ;av"YuD$ $D$D$`ō|$ 9;uى#e ;aOD$D$ D$$D$(e e $*8e D$$WD$cu$L$T$\$ uE }d e u(}d D$L$ D$$D$( kÍ=}d +D$D$ T$$\$(jÐjÍe $_6}d D$ }d L$e $6D$ L$L$D$ D$$D$(oje ;aP誺$D$聃D$L$  $裢D$D$,AۯD$L$L$$|$@5D$HD$$D$LiҺ$D$D$@D$D$ D$D$ H0e T$,P4$D$L$d 9tD$TD$XD$\L$`PÉD$ L$($L$ d T$,D$ D$,@@ @P|$05 ֟ $D$L$0L$D$ D$D$ H0 e 'L$,H4$D$L$D$,PX@ 9$)É!ىL$)‰T$l$ ~D$L$$L$D$L$ uZ$谠|$G(e u*fD$TD$XpD$\|$`PÍfщD$TL$XD$\D$`PÍ귺bD$TD$XD$\L$`PÍx4D$,D$ L$(D$,HX h9$)݉ۇ!T$)ىL$D$ PD$L$$L$D$ L$ $D$D$D$ D$ӶD$L$A,I(L$TD$XD$\D$`Pù귺{x4‹D$,D$TL$XD$\D$`P[ [ ޮe ;avMe vu^ e Z2Hٮc6e ޮe ;avdD$ T$ \$ HJKHJKH J K JHKJHKJHKJHKJ H K @$B$C$ޮe ;avdD$T$ + \$ H+JKH+JKH +J K H+JKH+JKH+JKH+JKH +J K @$+B$C$ݮe ;aD$ ؋L$\$+1!1Qk1!1QQk1!1QQ k 1!1Q Qk1!1QQk1!1QQk1!1QQk1!1QQ k 1!1Q Q$[$1!1ډQ$ܮ>e D$;AX$PXhp$xp$p$p$p $p $p $p $p $p$p$p$p$p$pt$|pt$xpt$tpt$ppt$lpt$hpt$dpt$`pt$\pt$Xpft$V@$4$ щ ى ͉l$  ډT$$ $ ډT$   ˉ\$$$ ˋ$ ˉ\$  L$$$ ˋ$ ˉ\$  щL$ $$ ˋ$ ˉ\$$  ͉l$($$ ˋ$ ˋL$| ىL$,  l$0L$t\$x ˋL$p ˉ\$4  L$8L$h\$l ˋL$d ˉ\$<  L$@L$\\$` ˋL$X ˉ\$D  L$HL$V L$LD$Pĸ9ٮe ;a|D$H$ɍQPPP PPPPP ɍ QىXˉX)ʉPډP)ىHX ӉX )щHPډP)ىH XӉX)щHPډP)ىHXӉX)щHP ډP )ىHX$)щH +)ʉP$T$ JJX ˈZHJHJHX وJHJH JHX  ˈZ H J H J H X وJ HJ H JHJHJHJHJHX ˈZHJHJHX وJHJH JHX  ˈZH JH JH X$ وJH$JH$ J@$B֮de ;av2(|$1L$ $L$,L$,L$L$0(G֮e ;avaH|$1L$ $T$LT$|$(t$?11T(@ у | ȉ ȉ ȃD$PHծe ;avWD$ًT$ HىJHىJH ىJ HىJHىJHىJHىJH ىJ @$؉B$Rծe ;a4L$<ʁ\$@ ˉ\$0L$Dˉ\$D|$,)T$(l$\|$`|$$ |$ l$d|$T$ T$l$\)Չl$t$L$Ht$DL$  ىL$\$LًT$l$D)Չl$Dl$$l$\$ t$dދt$ht$$ 4$|$l$l$)݉l$dˁl$ |$T$L׋T$P݁T$  ʉT$L$T)l$Ll$$ $\$lًL$pL$$ L$t$t)\$lׁ\$ t$l$Tl$X݉l$  Չl$T$)\$Tρ\$$T$t$tT$xډT$$ ʉT$L$|ʉ$)\$t\$L$  ً\$\t$)\$`ˋL$ t$T$ˉ T$dډT$d)ىL$\$݁t$$|$T$|׋$ ډT$ $)t$|ׁt$ ދ$ ӉؿD$ |$(D$()݉$l$L$0 l$<\$,)݋\$@ NыT$ ًT$(Ӂ T$D)ˋL$8QT$LQT$TQ T$\QT$dQT$lQT$tQT$|Q $Q$4GѮe $;A+$$$$≔$$y$牼$S$$4ҍ4r$牔$$$‰$y$s $,,n$牔$$$‰$q $扴$k$||}$扔$$$Љ$Q$k$|ttu$x≔$t$p$Љ$lQ$h≔$dk$`ttu$\≔$X$T$lЉ$PQ$Lk$Httu$D≔$@$<$PЉ$8Q$4≔$0k $,ttu$(≔$$$ $8Љ$Q $k$ttu$≔$ $$Љ$I$$ቌ$[$ۍS$ቔ$$$ЉD$t؋$≔$$$$≔$$$Љ$$$≔$$$Љ$$$≔$$$Љ$$≔$$$Љ$$x$h≔$$$Љ$$\$L≔$$$Љ$$D$4≔$$$Љ$$($≔$$$Љ$$≔$$|$ЉD$p苔$≔$x$t؋$≔$p$l$tЉ$h$$≔$d$`$hЉ$\$$≔$X$T$\Љ$P$$≔$L$H$PЉ$D$d≔$@$<$DЉ$8$x$L≔$4$0$8Љ$,$\$0≔$($$$,Љ$ $D$≔$$$ Љ$$(ቔ$$ $ЉD$l$,$≔$$苔$≔$$$Љ$؋$≔$$$Љ$$$≔$$$Љ$$$≔$$$Љ$$$h≔$$$Љ$$L≔$$$Љ$$x$4≔$$$Љ$$\$≔$$$Љ$$D$≔$$$ЉD$h$H$≔$$$,$≔$$$Љ$苔$≔$$$Љ$|؋$≔$x$t$|Љ$p$$≔$l$h$pЉ$d$$d≔$`$\$dЉ$X$$L≔$T$P$XЉ$L$0≔$H$D$LЉ$@$x$≔$<$8$@Љ$4$\ቔ$0$,$4ЉD$d$`$≔$($$$H$≔$ $$$Љ$$,$≔$$$Љ$ 苔$≔$$$ Љ$؋$≔$$$Љ$$$h≔$$$Љ$$$L≔$$$Љ$$$4≔$$$Љ$$≔$$$Љ$$x$≔$$$ЉD$`$|$≔$$$`$≔$$$Љ$$H$≔$$$Љ$$,$≔$$$Љ$苔$≔$$$Љ$؋$d≔$$|$Љ$x$$L≔$t$p$xЉ$l$$0≔$h$d$lЉ$`$$≔$\$X$`Љ$Tቔ$P$L$TЉD$\$$≔$H$D$|$≔$@$<$DЉ$8$`$≔$4$0$8Љ$,$H$≔$($$$,Љ$ $,$≔$$$ Љ$苔$h≔$$ $Љ$؋$L≔$$$Љ$$$4≔$$$Љ$$$≔$$$Љ$$$≔$$$ЉD$X$$≔$$$$≔$$$Љ$$|$≔$$$Љ$$`$≔$$$Љ$$H$≔$$$Љ$$,$d≔$$$Љ$苔$L≔$$$Љ$؋$0≔$$$Љ$$$≔$|$x$Љ$t$ቔ$p$l$tЉD$T$$≔$h$d$$≔$`$\$dЉ$X$$≔$T$P$XЉ$L$|$≔$H$D$LЉ$@$`$≔$<$8$@Љ$4$H$h≔$0$,$4Љ$($,$L≔$$$ $(Љ$苔$4≔$$$Љ$؋$≔$ $$Љ$$$≔$$$Ћ$$T$tT$$$$$$$$L$$$$$$$$d$$0$$$$$$$$($$D$$\$$x$$$l$|$t$x$ϋ$$ы$$$$$ы$ꋴ$$$$$鋔$$Ջ$ꋬ$$ꋬ$$ы$x$Ջ$$$tꋬ$p$ʋ$\$͋$d$$X鋬$T$lы$D$Ջ$L$$@ꋬ$<$Pʋ$($͋$0$$$鋬$ $8ы$$Ջ$$$ ꋬ$$ʋ$$͋$$$鋬$$щL$L$pL$ $$$$$h$$4$$$$$$$$닜$ϋ$$ы$$ً$$Ӌl$x$$ꋬ$$ʋL$|$͋$$$鋬$$ы$$Ջ$$$ꋬ$$ʋ$x$͋$$h$鋬$$ы$\$Ջ$L$$ꋬ$$ʋ$D$͋$4$$鋬$$ы$($Ջ$$$ꋬ$$ʋ$$͋$$$鋬$|$щL$L$lL$$$$ꋔ$ʋ$x鋔$$Ջ$$$pꋬ$l$tʉߋ$$$d달$`$hӋ$$Ջl$x$$Xꋬ$T$\ڋ$$݋|$|$$L달$H$PӋ$$Ջ$$d$@ꋬ$<$Dڋ$x$݋$$L$4달$0$8Ӌ$\$Ջ$0$$(ꋬ$$$,ڋ$D$݋$$$달$$ Ӌ$($Ջ$$$ꋬ$ $ډT$T$hT$$,$$닜$Ӌ$ꋜ$$݋$$$달$$Ӌ$ʋ$$ы$$ً$$Ӌ$$$ڋ$$ʋ$$ˋ|$x$$ً$$ы$$Ӌ\$|$hߋ$ڋ$$ʋ$$ˋ$$L$ً$$ы$x$Ӌ$$4ߋ$ڋ$$ʋ$\$ˋ$$$ً$$ы$D$Ӌ$$ߋ$ڋ$$ʉT$ L$dL$$$H$$ڋ$ʋ$ً$$,Ӌ$$ߋ$ڋ$$ʋ$鋼$$鋬$$ы$$Ջ$$$xꋬ$t$|ʋ$$͋$$$l鋬$h$pы$$Ջl$x$d$`ꋬ$\$dʋ$$͋|$|$L$T鋬$P$Xы$$Ջ$$0$Hꋬ$D$Lʋ$x$͋$$$<鋬$8$@ы$\$Ջ$$$0ꋬ$,$4ʉT$(L$`L$,$`$$ꋔ$ʋ$(鋔$$HՋ$$$ ꋬ$$$ʋ$,ً$$ً$$ы$$Ӌ$$$ڋ$$ ʋ$$ˋ$$ߋ$ً$$ы$$Ӌ$$h$ڋ$$ʋ$$ˋ|$x$L$ً$$ы$$Ӌ\$|$4ߋ$ڋ$$ʋ$$ˋ$$$ً$$ы$x$Ӌ$$$ڋ$$ʉT$0L$\L$4$|$$ڋ$ʋ$ً$$`Ӌ$$ߋ$ڋ$$ʋ$H鋼$$鋬$$ы$$,Ջ$$$ꋬ$$ʋ$$͋$$$鋬$$ы$$Ջ$$d$ꋬ$|$ʋ$$͋$$L$t鋬$p$xы$$Ջl$x$0$hꋬ$d$lʋ$$͋|$|$$\鋬$X$`ы$$Ջ$$$Pꋬ$L$TʉT$8L$XL$<$$$ꋔ$ʋ$H鋬$$|$$$@ꋬ$<$Dʋ$`ً$$4ً$0$8ы$$HӋ$$$(ڋ$$$,ʋ$$,ˋ$$ߋ$ً$$ ы$$Ӌ$$hߋ$ڋ$ $ʋ$$ˋ$$L$ً$$ы$$Ӌ$$4$ڋ$$ʋ$$ˋ|$x$$ً$$ы$$Ӌ|$|$$ڋ$$ʉT$@L$TL$D$$$ˋ$׋$ы$$ڋ$$׋$ڋ$$ʋ$|鋼$$鋬$$ы$`$ꋼ$$$ꋬ$$ʋ$$H͋$$$鋬$$ы$$,Ջ$d$$ꋬ$$ʋ$$͋$$L$鋬$$ы$$ꋼ$$0׋$ꋬ$$ʋ$$͋$$$|鋬$x$ы$$Ջl$x$$pꋬ$l$tʉT$HD$L$$Ջ$͋$hы$$Ջ$$$`ꋬ$\$dʋ$ً$΋$Tً$P$Xы$$|Ӌ$$݋$Hڋ$D$Lʋ$$`ˋ$$݋$<ً$8$@ы$$HӋ$$h݋$0ڋ$,$4ʋ$$,ˋ$$L݋$$ً$ $(ы$$Ӌ$$4݋$ڋ$$ʋ$$ˋ$$݋$ ً$$ы$$Ӌ$$݋$ڋ$$ʉT$Pe $d;A$ Q$&≔$D$$i$Ƹ剔$D$Q$&≔$D$Q $≔$D$Q$$&≔$$T$|T$xD$tQT$pT$l$T$hD$dT$tЉD$`QT$\T$XD$≔$$T$`Љ$Q $ ≔$Ћ|$牔$$$Љ$I$ቌ$D$ቔ$$$Љ$㉔$$$Љ$T$|≔$D$p≔$$$T$\≔$$$Љ$D$$≔$$$Љ$$牔$$$Љ$㉜$D$㉔$$$Љ$D$\$≔$$D$lT$p≔$$$Љ$$$≔$$$Љ$|D$ቔ$x$t$|Љ$p牔$l$h$pЉ$dD$剔$`$\$dЉ$X$ $≔$T$PD$\T$l≔$L$H$PЉ$D$$≔$@$<$DЉ$8D$㉔$4$0$8Љ$,牔$($$$,Љ$ $$≔$$$T$l≔$$$Љ$ D$\$$$ Љ$$㉔$$$Љ$剬$D$剔$$$Љ$$牔$$$Љ$$$≔$$$T$l≔$$$Љ$$ T$X≔$$$Љ$$$≔$$$Љ$$≔$D$≔$$$Љ$$$≔$$؋T$l≔$$$Љ$$T$X≔$$$Љ$|$$ ≔$x$t$|Љ$p$$≔$l$h$pЉ$dD$$≔$`$\$dЉ$X$$≔$T$PD$l$≔$L$H$PЉ$DD$X$≔$@$<$DЉ$8$$≔$4$0$8Љ$,$$≔$($$$,Љ$ $$≔$$$T$l≔$$$Љ$ D$X$≔$$$ Љ$؋$≔$$$Љ$$$$$Љ$$$≔$$$Љ$$$≔$$D$l$≔$$$Љ$D$X$≔$$$Љ$$$≔$$$Љ$ȋ$≔$$$Ћ$$$T$|T$T$l$,$\$ $t$$|$ $T$T$lT$HT$XT$@$T$8L$0k&$鉌$,ۍ,k$뉜$k&$$44w$$|$k&$$|$T\$|\$x<$l$Hl$l͋l$hl$d|$tً\$l$@݋l$X$달$t$`ˋL$ы$$$ы$$ˋL$0T$ʋ$$$ы$$ˋL$$T$,ʋ$$֋$ы$$ى$($$,L$pL$L\$\\$D$l$4$l$P$|$($Ջ$$Ӌ$$$$ʋL$t$8΋$$$$$ыT$4t$֋$$$$$ыT$(t$֋$$$$$щ$0$X$4$ˋt$\$t$l|$L\$Ht$p$$$ˋ $t$8΋$$$$$ˋL$t$0΋$$$x$t$|ˋL$(t$΋$$$l$h$pˋL$t$ ΋$$$`$\$dى$8$ $<$ L$<݋$Tڋ\$l|$DߋL$H|$\ϋ$Lً$H$Pы$\$4Ӌ$$$@ꋬ$<$DыT$l$(Ջ$$$4ꋬ$0$8ыT$ l$Ջ$$$(ꋬ$$$,щ$@$$D$$\$P$t$H$|$8l$l$$$݋\$\t$Dދ$$$ ,$t$($$$$$l$͋$֋$ы$$ًT$\$ڋ$$׋$ڋ$$ʉ$H$$L$L$$|$,ߋ$T$P$ڋ\$l|$4ߋ|$H$$$$ӋT$Xt$<֋t$@$ $$$ڋ$t$ ދ$$$$$Ӊ鋴$$$$$݉$P$X$T$l$ ݋$l$P$l$H$|$(t$l$$$݋\$Xt$4ދt$@$$$$달$t$<|$8$ $x$t$|݋$ً$$$lً$h$p\$ Ӌ$$$`ꋬ$\$dʉ$X$ $\$T$ʋ$T$P$TыT$l|$ ׋|$H$$Lꋬ$H$PʋL$Xl$,͋l$@$$@鋬$<$Dы$l$4Ջl$8$$4ꋬ$0$8ʉ$$$($$$,Չ$`$$d$Ӌ$|$P$ڋ\$H$\$l$l݋$$$ӋT$Xl$ Ջl$@$$ꋬ$$ ڋ\$8$t$($$달$$Ӌ$l$4Ջ$ꋬ$$ڋ\$ˋ$$$ً$$щ$h$l$T$ʋ$T$l\$ Ӌ\$H$݋$ڋ$$ʋL$X\$ˋ\$@$݋$ً$$ы$\$ Ӌ\$8$݋$ڋ$$ʋ$\$,ˋ\$0$݋$ً$$щ$pe ;avTD$\$D$X$蓺Tڏe D$;A$$D$T$ ҋl$$퉬$|$$$|$$|$|$|$,|$t$|$4|$l$|$<|$d$|$D|$\$|$L|$T$|$t$l$$l$ $l$($l$0l$xl$8l$pl$@l$hl$Hl$`l$Pl$X$,$D$|$T$ t$$D$$$D$$D$$$D$ $D$$D$|$D$($D$,D$tD$xD$0$D$4D$lD$pD$8$D$D$8$L$`L$ZD$ D$8$D$?D$ @2|D$8$D$L$`L$D$$L$8L$ D$ D$$D$D$ @d|D$8$L$L$D$蜵D$8$D$D$ D$8$D$D$ @2|D$`$L$8L$D$OD$`$D$oD$ D$`$D$TD$ @|⋄$$D$`D$$D$Ĉ,7e ;a D$ `e 9t$L$D$(cD$H(`e 9t $T$D$(D$@Px `e 9t$L$D$( 臂2e D$;A|$ 1跚L$ $9t $T$D$(计D$4$Q(9t$T$D$(脡D$\$P9t$L$D$(ZD$ $$D$SĄ跁2e ;aD$L$L$$Q(T$ T$D$D$L$Q($T$ T$UD$HPT$ZP9t $\$D$(諠D$xD$D$x$^ D$ǯIe ;av D$L$9t$L$D$(7D$H(T$Z(9t $\$D$( D$PL$P9t$L$D$(㟮 Zee D$;A|$\1蛘|$4蒘|$ 艘$QPT$T$\$g$L$T$4$\$\\$蘮$(L$L$ $T$\T$v$ $T$ T$oL$4 $$Q\$1ڈQĄoe $d;A$1襗$虗|$t萗|$L臗${$ Q($$$$\$/$ QP$`e 9t$\$D$(.$ @P$L$$$v$$$L$^ T$"$D$$ $L$D$D$$$D$覟D$t$$L$D$t$D$$L$贬$ $L$tL$$ D$$$L$$ D$$$L$a$ D$$$ D$$L$tL$3$ D$$$L$|$ 1•$ D$L$L $#D$L$D$$L$ث$$L$LL$$T$$$触D$tk$ $?D$$$I8u0$D$$ Hx $D$WƄ$(Ë$ D$$赦뻍$$L$LL$$L$ѝ$$D$t`$ D$$ @^ L$ܪ$ D$L$ $բ|$,t$ 81@  Hك rƄ$( {Ye ;avnD$L$QxT$T$$L$8D$HPL$ L$T$Z($(D$D$D$D$P$D$ D$+{ve ;aD$ L$QxT$T$$L$褩D$HPL$L$T$ Z($X(\$ \${D$D$D$ HP $L$L$\D$ D$D$ x$D$D$=tzOe ;a D$ `e 9t$L$D$(裙D$H(`e 9t $T$D$(vD$@(P `e 9t$L$D$(H yZe ;a_@|$ 1L$DT$HT$ $Z(\$<\$L$HL$T$DZ(\$8$l$$ @PI|Nf u6 t($$$ L$D$ H$ L$ $$L$D$ =Tn}$$L$L$D$ )Ƀrkx @_ ȉD$$$T$T$QD$ $$L$L$aD$ Ƀkx @_ ȉD$$$T$T$$$L$L$D$ )ɃD$$$L$L$D$ $$L$L$D$ ɃsMD$$$L$L$D$ J         nSe ;avk D$L$L$$T$T$[D$H(L$L$Q($T$T$9D$PD$D$P$D$D$ mye D$;A|$1跅$$T$!)Ӊ\$`e 9t $T$D$(菌$H($`e 9t $T$D$(X$@(HP$`e 9t $T$D$( $$T$1Al$ i5@/c kx\$ $JT$O$$T$\$ }k1 rD$$9t$T$D$(臋D$@$9t$L$D$(b$D$D$h$ $$D$D$D$D$Ęp ke $;Ax|$1҃$1DU }+@,tl߃Z@r 11%\ ,D T)ՕD Aڃ?} @rL$OшL$O$`e 9t $T$D$(*$Q(`e 9t$\$D$($A(QP`e 9t$\$D$(ω$APQx`e 9t$\$D$(螉|$P1u$@_gT$ DD$D$P$L$^$@$$L$T$PT$ $@$$L$D$ H1@}у@ri$ց$ $$@T$$@ $$T$$ $$@T$$@ $$T$\$ $$@T$$@ $$T$($ $$@L$N$@ $$T$1eL$ T ҉T$T$P$D$$@$$L$T$PT$$@$$L$"D$ @}ȃ@r     gae $;Ax$Y$ ځ$8$s %$ ≔$$$*J$ ́$ʼn$K$ {$ {$ $$ ͋$  $ȉ扔$$W$$ o$ o$ $$ ы$  $Љ$$M$$ U$ U$ $$ ͋$  с$4ȋ$ 剔$$$‰$S$$ k$ $$  Ӂ$扔$$o$$ W$ $$  $؉$ʼnȋ$≔$$ʼn$$Z$|$ J$ $|$  ځ$,Ћ$ ㉔$|$xʼnl$P$J$t$ j $ j $p $t$ ʋ$p  $扔$$tW$l$ o $ o $h $l$ ы$h  $‰$$4$ቔ$l$d$‰$`$,$剔$\$X$`‰$T$M$P$ } $ } $L $P$ ͋$L  $(ȉ㉔$$Plj|$0$j $H$p z $p z $D $H$p ꋬ$D  $扔$p$H$W $@$h o $h o $< $@$h ׋$<  $‰$h$4$剔$@$8$h‰$4$,$牔$0$,$4‰$(ȋ$牔$$$ $(‰$$O $$L o $L o $ $$L ϋ$  $$ȉ㉔$L$lj|$($j$$D z$D 틼$$D  $扔$$ $j$$< z$< 틼$$<  $‰$$4$剔$$$Љ$$,$≔$$$Љ$$($≔$$$‰$ȋ$牔$$$‰$$O$$ o$ 鋬$$  ρ$ ㉔$$ʼnl$ $J$$D j$D j$ $$D ʋ$  $扔$D$$U$$< M$< M$ $$< Ջ$  ʁ$‰$<$4$ቔ$$$<‰$$,$剔$$$Љ$$($≔$$$‰$$$$剔$$$Љ$$≔$$$‰$$}$$ M$ M$ $$ $  ρ$㉔$$ʼnl$$J$|$ j$ $|$  ʁ$≔$$|$J$x$ j$ $x$  ʁ$‰$$4$ቔ$x$t$‰$p$,$剔$l$h$p‰$d$($剔$`$\$dЉ$X$$$≔$T$P$X‰$L$ $剔$H$D$LЉ$@$≔$<$8$@Љ$4$j$0$ z$ $0$  $ʼnЉ㉔$$0ʼnl$$jR$, Ձ$剔$($$$jR$  Ձ$ʼn$$4$≔$$ʼn$$,ቔ$ $艄$$($≔$$$‰$$$$剔$$$Љ$$ $≔$$$‰$$$剔$$$‰$$剔$$$‰$$}m$ $㉔$$$‰T$$U$$, ]$, ]$ $$, Ջ$  ځ$扔$,$$Z$$  j$  j$ $$  ڋ$  $É$ $4$≔$$É$$,$≔$$؉$$(ቔ$$$Љ$$$$≔$$$Љ$$ $≔$|$x$Љ$t$$≔$p$l$tЉ$h$$≔$d$`$hЉ$\$≔$X$T$\Љ$P$Z$L$ j$ j$H $L$ ڋ$H  $؋$ 剔$$L$PЉ$$j$D$ Z$ $D$  $≔$D$@$Z$<$ j$ $<$  ځ$Љ$<ŋ$$4≔$8$4艄$0$,$≔$,$($0Љ$$$($≔$ $$$Љ$$$ቔ$$$Љ$ $ $≔$$$ Љ$$$≔$$$Љ$$$≔$$$Љ$$≔$$$Љ$$$≔$$$Љ$$j$$H Z$H $$H  $0ÉЋ$ 剔$$؉$$Z$$ j$ R $$  $ Ӊ$扔$$$r$$ j$ R $$  $ ։$Ɖ$$4$≔$$$$$,≔$$$Љ$$($≔$$$Љ$$$$≔$$$Љ$$ ቔ$$|$Љ$x$$≔$t$p$xЉ$l$$≔$h$d$lЉ$`$$≔$\$X$`Љ$T$$≔$P$L$TЉ$H$0$≔$D$@$HЉ$<$r$8$H z$H R $8$H   ։$H$ 牔$8$4$<Љ$؋$4≔$0$,$,$牔$($$$,Љ$ $$(≔$$$ Љ$$$$≔$$ $Љ$$ $≔$$$Љ$$ቔ$$$Љ$$$≔$$$Љ$$$≔$$$Љ$$$≔$$$Љ$$0$≔$$$Љ$$≔$$$Љ$؋$,≔$$$(牔$$$Љ$$$$≔$$$Љ$$ $≔$$$Љ$$$≔$$$Љ$$ቔ$|$x$Љ$t$$≔$p$l$tЉ$h$$≔$d$`$hЉ$\$0$≔$X$T$\Љ$P$≔$L$H$PЉ$؋$(≔$D$@$$牔$<$8$@Љ$4$$ ≔$0$,$4Љ$($$≔$$$ $(Љ$$$≔$$$Љ$$ቔ$ $$Љ$$$≔$$$Љ$$0$≔$$$Љ$$≔$$$Љ$؋$$≔$$$ 牔$$$Љ$$$≔$$$Љ$$$≔$$$Љ$$$≔$$$Љ$$ቔ$$$Љ$$0$≔$$$Љ$$≔$$$ЉD$x؋$ ≔$$$牔$$|$Љ$x$$≔$t$p$xЉ$l$$≔$h$d$lЉ$`$$≔$\$X$`Љ$T$0ቔ$P$L$TЉ$H$≔$D$@$HЉD$p؋$≔$<$8$牔$4$0$8Љ$,$$≔$($$$,Љ$ $$≔$$$ Љ$$0$≔$$ $Љ$ቔ$$$ЉD$h؋$≔$$$牔$$$ȉ$$$≔$$$Љ$$0$≔$$$Љ$$≔$$$ЉD$`؋$≔$$$牔$$$Љ$$$0≔$$$Љ$$≔$$$ЉD$X؋$≔$$$0牔$$$Љ$$≔$$$ЉD$H؋$0≔$$牔$|$x$ЉD$@扔$tD$8$$$ڋ$$$$p $$$$$l$)߉$h\$P$$׋$$$$֋$$x$|T$Tt$P$d ډ$\$0ډ$$$)$t$($$HӋ$p$h$8$@ڋ$4$,$0ڋ$($ $$ڋ$$$LӉ\$,T$(ׁ$` $t$ $$$|)׉$xT$$$ދ$D$<$$$$$$$$ދ$$$ދ$$$ދ$$$\$t$$\ Ӊ$pT$Ӊ$h$p$L)$Ht$$$$ڋ$($$$ڋ$$$ ڋ$$$ڋ$$$ڋ$$$ڋ$$$ڋ$$$ڋ$$$ډT$ \$߁$X $D4$$@$D$<)߉$8$$@$֋$D$4$<$8$($0$,֋$$$$ ֋$$$֋$$ $$$$$$$$$$$$$$$$։$$ׁ$T މ$4$މ$0$4$,)׉$($$$$$4$0$$$,ϋ$($$ $΋$ $$$$$$$$΋$$$΋$$$$$$$$$΋$͋$$$Ή$$́$P ։$ $։$$ $)͉$$$(Ӌ$D$8$@$<$,$4$0$ $($$֋$$$$$$ ֋$$$֋$$$֋$$$$$$$$ց$L ͉$L$x͉$$$)։$T$p$ ˋ$$|$$鋬$p$x$t鋬$d$l$h͋$X$`$\͋$L$T$P͋$$$$D$@$Ht$tL$ṕ$H ։$T$h։$$$)͉$L$`$Ӌ$$$$$$$$$$$$$$$$Չl$dT$`ց$D ͉$L$X͉$$$)։$T$H$ˋ$$$$͋$$$$$$l$LL$H΁$@ Չ$T$@Չ$$$)Ή$$Hˋ$$$׋$tщ$T$8Ձ$< ȉ$($$)ʼn$$$$鋌$$$$鋬$p$$$鉌$$$p щ$$щ$$$$)$$$$t$$$d֋$lՋ$`$X$\Ջ$T$P$Ջ$d$$L$0Չl$4$$d $$x$$$$)ω|$0$$$ ֋$$$$$$$$$$$$$$$$֋$`$t$l$ ։t$$$$` Ή$l$HΉ$d$l$`$)|$ $h$$|$$$tϋ$xʋ$p$h$lʋ$\$d$`ʋ$X$P$Tʋ$D$L$Hʋ$8$@$<ʋ$4$0$ы$\$\$pt$щL$$h$\ 鉌$X$8鉌$T$X$P$h)l$$@$$׋$,$ $$ꋬ$$$ꋬ$$$ꋬ$$$ꋬ$x$$|ꋬ$l$t$pꋬ$`$h$dꋬ$T$\$Xꋬ$L$P$ꋬ$X$$D $T$$@$X $ $($$ $$@)Ή4$$0$$8담$$$$$ꋔ$׋$$ꋔ$׋$$ꋔ$׋$$ꋔ$׋$|$ꋔ$׋$p$xꋔ$t׋$d$lꋔ$h׋$X$`ꋔ$\׋$L$Tꋔ$P׋$@$Hꋔ$D$ $$$8$4$<ꋬ$T$$4$ꉔ$$0$T ʉ$$ʉ$$$$0)$$$,$$$֋$Ջ$$$Ջ$$$ꋬ$$$ꋬ$x$$|ꋬ$l$t$pՋ$`$h$dՋ$T$\$XՋ$$$$L$H$P鋔$P$$ $щ$$$P ω$$ω$$$$)$$$$닔$ꋬ$$$ꋬ$$$ꋬ$$$Ջ$$$ꋬ$$$ꋬ$$$ꋬ$$$$$$ы$L$$|$xщL$|$$L Ή$$Ή$$$$)L$x$$닔$<ꋬ$0$8$4ꋬ$$$,$(ꋬ$$ $ꋬ$ $$ꋬ$$$$$$ы$H$$t$hщL$l$$H ω$$ω$$$$)l$h$$닔$ꋬ$$͋$ʋ$$鋌$ʋ$$$͋$$$ы$D$|$|$XщL$\$$D $x$$x$t$)t$X$$0݋$달$$$ꋔ$|ꋬ$x$Ӌ$@$$$t$@Ӊ\$D$$@ $p$$p$l$)$(, 扔$h$d$Љ$`$(-≔$\$X$Љ$T$(g ≔$P$L$Љ$H$(9≔$D$@$)‰$<$(剔$8$4T$xЉ$0$(}o ≔$,$ $)‰$扔$$$Љ$ غ-≔$$$`Љ$غg ≔$$$TЉ$غ9≔$$$H)‰$剔$$$<Љ$غ}o ≔$$$0)É$扔$$$Љ$-≔$$$ ؉$g ㉔$$$Љ$9≔$$$)‰$剔$$$Љ$}o ≔$$$)lj$扔$$$T$|ȿ-牔$x$t$Љ$p㉔$l$h$Љ$dȺ9≔$`$\$)‰$X剔$T$P$Љ$LȺ}o ≔$H$D$)$@D$X扔$<$8T$Љ$4D$X牔$0$,$|ȉ$(D$X㉔$$$ $pЉ$D$X9≔$$$d)‰$D$X剔$ $$XЉ$D$X}o ≔$$$L)‰$$扔$$$d$d$牔$$$4$$㉔$$$(؉$$9牔$$$)lj$$剔$$$艄$$}o 剔$$)ʼn$$d$$\$p l$$L)݋\$$|$ l$`$)͋L$d$`$p$l$H닔$H$\$$щL$di, $$݉l$$dށ$`$ $L$$H$L$)މt$$$$$D ֋T$$<)T$ $$$ |$H$)l$L$\$D$X$8$D$x$݉l$L ߋ$$t)\$\\$\i, $$$Ti-$0ꋬ$,$|ig $$$(Չl$ $ց$\$ $T$$<$T$8)։t$$$$$$4 $$,)$$<$4$( l$8$$)Ջ$$X$,$ $($@$p$ʉT$< $$l)l$Di, $$$i-$$$ ʋL$Lig $l$h$i˭9$ы$d$)΋L$di$$$։$$ʁ$X$$ $($$$$($)ʉ$$$$$  $$)׋$$T$ $$$4i-$\$X$L$ Q?   $ ׉‰, 剔$$Q$Y$ Q$ Y$ $$ Ջ$  ځT$x‰$-㉔$$i $$ Q!$ i"$ $$ Ӌ$  T$p‰$g ㉔$$Q#$$ i$$ 틔$$  \$hÉ$9≔$$i%$$ Q&$ i'$ $$ Ӌ$  T$`)‰$㉔$$Q($$ i)$ $$  \$X؉$ʼn}o ≔$$y*Y,$ ߁|$P)lj$Y9$Q:$ y;$ ׉ $$   о, 扔$$Y$Q$ ڋ$ $$  ށ$Ɖ$-≔$$$‰$g ㉔$$$‰$|9≔$x$t$)‰$p≔$l$h$‰$d}o ≔$`$\)ʼn$XQ7$Ty8$P ׋$ 틼$P$  T$8п, 牔$$Pi$LQ$H i$D Ջ$ $H$D $  Ձ,$ʼn$D$8-≔$H$D$@D$8㉔$<$8$‰$4D$89牔$0$,$|)‰$(D$8扔$$$ $p‰$D$8}o ≔$$$d)‰$Q4$ q5$ Q6$ $T $$ ׋$T  T$<п, 牔$T$q$L ցt$Ɖ$LD$<-≔$$ʼn$D$<㉔$$$@Љ$D$<9≔$$$4)‰$D$<≔$$$(‰$D$<}o ≔$$$)‰$Q1$i2$ Q3$ ꋬ$  $$ Ӌ$   Љ牔$ $Y$Q$ Y$ $$  ߁|$lj$-≔$$Ɖ$g ㉔$$$Љ$躭9≔$$$)‰$≔$$$Љ$}o ≔$$$)ʼn$Q/$|i0$x Ջ$ $x$  ց, 扔$$xi$tQ$p i$l Ջ$ $p$l 鋬$  Ձʼnl$-扔$$p$l扔$h$d$É$`9扔$\$X$)‰$T扔$P$L$$}o 扔$H$)Ɖ$D$xы$L$T$$@ 鉌$$l鉌$x$$<l$)Չ$8T$$ꋔ$T$L$͋$ы$$dꋔ$hʉT$ $`́$4 ډ$T$Tډ$L$T$)͉l$$$$Ӌ$$D$닜$HӋ$$@ꋔ$ڋ$$)닜$ڋ$L$PӉ$$Ձ$0 ˉ$$$)͉$$$$i-$|$p$߃$$$ދ$|$,)$0ދ$($$ދ$$)$މt$t$߁$, ։$$։$$$)߉|$p$iѭ9$t$`$)֋$$h$l֋$d$)$։t$d$ׁ$( މ$$Xމ$$$)׉|$`$$s-$$ {.$ $| $$ $|  |$Hi}o $t$P$)ιىL$T$ށ$$ щ$$$)։t$P$x\$$Ӌ$ $p$ˋ$ы$@$$$lщL$$x$@ $|$$|$$l$x)|$$L$$PӋ$$$ˋ$ы$$ڋ$ʋ$$X)ً$\ʋ$4$$T$TʉT$$L$4 $ꉔ$h$d$L)<$$$i, $ً\$x$Ӄ$$ڋ$ʋ$$8ً$<ʋ$4$)ً$ʋ$$ً$ы$)‹$Hы$0$$$DщL$|$$0 $t$p$$$$)\$x$ig $ڋ\$h$$$t)$xڋ$p$ $$ڋ$$)$ڋ$,$$$ډT$l$$, $|$`$$$$)ω|$h$i$$\$Xރ$$\)$`݋$($$$X݉l$\$$( ͉$L$P͋$$$)L$X$, 牔$$$r $xZ$t $t 鋜$t$t  ΁t$ $tË$-ቔ$p$`$8$\$g 扔$X$PT$Љ$H$9≔$D$@$|)‰$<$≔$8$4$Љ$0$}o ≔$$,$h)‰$(牔$$$ $z $r $ z $ $x $$ $x  |$($xƉቔ$$؉$ g ㉔$$$\Љ$躭9≔$$$H)‰$牔$$$<Љ$}o ≔$$$0)ʼn$D$X, ≔$$$j$z$ j $ $ $$ ꋬ$  l$0艄$NjD$Xቔ$$$D$X㉔$$$ Љ$D$X9≔$$$)ʼn$D$X≔$$$Љ$D$X}o ≔$$$)‰$$, ≔$$|$V$tv$p ֋$ $p$  Ձl$@艄$Ƌ$ቔ$p$l$h$㉔$d$\$$X$9牔$T$P$)‰$L$剔$H$D$Љ$ $}o ≔$$$)‰$D$h, ≔$$$j$ z$ j$ $t $$ ꋬ$t  $艄$tNjD$hቔ$$$D$h㉔$$$hЉ$D$h9≔$$$X)ʼn$D$h≔$$$LЉ$D$h}o ≔$$$ )‰$$, ≔$$$6$  ց$$ቔ$ $$$㉔$$$؉$$9ቔ$$$)$$≔$$艄$$}o 牔$$)lj$$$$ $$)͋L$t$0$$\$pL$ti, $$$$$0 Ӊ$$Ӊ$$$)$$$$ $$)ՋT$d$,$\$`T$d $$)\$l\$li, $$|T$@׃i-$$$ig $달$$ډT$D$݁$, $$$$$)݉l$@$$$$$ $$)׋T$T$($l$PT$T $$)l$\l$\i, $$$ T$(׃i-$$$xl$dig $d$\$l$li9$$X$)i$$$T$,$$( ډ$$ډ$$$)t$($$$ |$$<)׋T$ڋ$|$H$\$Li-$p$`$8L$Tig $$$\֋L$\iѭ9$$$)֋L$di$H$D$֋L$li}o $$ $)։t$$ʁ$$ $$$$$)ʉT$$$$T $`$)l$ $@$$T$iӭ9$D$|$@)ՋT$Ti$$$<T$\i}o $$$)l$ $ց$@ ͉$$͉$$$)։t$$($$ ϋ$$)鋌$$4$$$i}o $$h$,)$$($4 щ$T$xщ$$$)$$T$li, $$$t$ti-$ $$tˋ$0$$$ˉ$$$0 뉜$|l$@뉜$x$|$p$)$$t$\i, $ً$|$0\$di-$p$l$ig $$$hً\$ti9$$$)$,$h$$ىL$4$$, 鉌$`l$(鉌$\$`$T$)|$0$t$Li, $ً$|$ \$Ti-$$$tˋL$\ig $$$ ދL$di٭9$T$$P)i$ы$$L΋L$ti}o $ы$)΋$($$$Ήt$$$߁$( $l$$$$t)|$ $$$ 달$x$l)ՋT$ڋ\$Lig $X鋬$P|$ыT$Ti9$$H$)T$\i$ꋬ$$ыT$di}o $ꋬ$$)ы$$$$$щL$$$$ $t$$$$l$)L$$$$ $L$d)l$i$8ً$44$\$Ti}o $달$0$)ً$@$$$ىL$$$@ $$$d$$X$) $$$$ $$)l$|͋$4$$\$x͉l$|$$4 $$$)\$x, 剔$$P$艄$L-㉔$H$D$؉$g 牔$@$<$x$89ቔ$4$0L$0)$,≔$$$ $\Љ$}o ≔$t$ )Ɖ$$$ $$)΋$ы$4$i, $$P$$L 鉌$$鉌$$$P)Ή$$0$$| $$p)$i-$H$D$$$$$ $p$8$H$p$D$)ˉ$$h$ ϋ$$)ًL$D$||$@$ig $@$<$xˋ$$$pˉ\$D 뉜$$,뉜$|$$x)։t$@$,$h$` ׋$$T)ʋL$4$i9$4|$0$0)T$D$$щL$4 ى$T$ى$@$T$<)l$0$$ $$)֋T$,$`|$($h$i$$$ $\l$4$$TT$, ʉ$$ʉ$$$h)\$($($`$ $$t)l$$$i}o $|$ )݋D$,$$ʼnl$$ Չ$$Չ$$$t)ىL$ $$ $$)ϋL$ً$|$$`ً\$$$$ىL$ 鉌$l$L$$$)T$$$$$ $$l)ߋ\$ӋT$$$Ӊ\$ ˉ$l$ˉ$$l$`)$\$$ $$)ՋT$ $|$$l$$$lT$  ډ$$ډ$$$)L$$@$$ $$X)l$͋L$ $$͉l$ Չ$$dՉ$d$$X)$8$$ ߋ$($)ˋ$$$$ً\$$$ى$ 鉌$l$xL$x$$)$$ $$)֋T$|$$$T$| ʉ$$)Չ$Ⱥ, ≔$$4$艄$ȿ-牔$0$,$$Ⱦg 扔$($$t$@$ Ȼ9㉔$$\$0)É$Ⱥ≔$$ T$(Љ$Ⱥ}o ≔$L$ )$$$ ʋ$L$P)ً$ыT$|$i, $$4ˉ$$ ˉ$$ˉ$$$P)݉$L$$p ݋$$D)ˋ$i-$0달$,$$$$$ $$ $p$$D$)͉$$$ ͋$H$x)L$Dig $($$T$@鋔$$$щL$D ى$$ى$x$$H)|$@$$T $|$<)t$4$i9$|$0$)֋T$D$$։t$4 Ή$|$Ή$T$|$<)\$0$$ 달$@$h)l$,݋$i$$ \$(\$4$|ډT$, $$$$$h)L$($$ ͋$$t)L$$鋬$i}o $|$ )l$,$$L$$ щ$T$щL$$$)t$ $$ $$)l$t$$$$l$ ͉$$\͉$$$)$t$$l ׋T$$`)T$t$$$T$ Չ$lT$Չl$$l$`)L$$$ $$)t$ ΋L$$$lΉt$  $$8$$$)$\$$ ׋$$X)ʋL$T$ $$щL$ Ή$$Ή$$$X),$$$ $d$)׋$l$$$ꉔ$ $$$$$d)$@$L$$$ $$P)$͉ ՕF ϋ$ ϗF$$ ͋$$D)$ шN  F ʋL$@ ʈV$$ ʋ$p$H)L$Dщ N ׋L$0 N$| ˋ$x$<)L$4ى шN  ݕF  ʋL$( шN $$ ʋ$T$h)Љ ؈F  ʈV  ݋L$ N $$ ً$$)\$$ˉ ӈ^ ͋$t N$$ ˋL$$)L$ى шN  ݕF ʋL$ шN$$l ʋ$$`)L$щ وN  ՕF$\N$$ ӋT$$)T$ ډ ʈV ݋ $ ͕F$$ ˋ$$X)L$ى шN  ݕF ʋ$@ ʈV$$$ ϋ$$d) ڈV ͋$ N$$ ً\$x$)\$|ˋ$ȋ$ˉ ӈ^  ͕F ӈ^2e ;aD$  HT$ Є Yۉ!ك\ltt$<   |$  t l|L   sa$ ^ ,ы}9m9!9 Єu/9!9 u$%D$D$D$. . / 輲e ;av*e vu1 e  e oe ;a03$D$ D$ D$L$T$ \$8 l$<ۇ t$49~bD$L$T$ 9t$l$\$PѭD$ D$$D$D$(D$D$,`Х$D$$D$JD$ L$L$@D$D0ÉU. ~e ;a$3$D$ D$ )D$L$T$ \$0 rN ~E D$L$T$ l$(9t$l$\$vЭD$ D$4D$D$8D$D$<$É- ʰUe ;a$D$H@L$L $ЋD$tb$ap|$G#e u2hD$PD$TD$XpD$\|$`$ÍhǭɋD$($D$,D$D$0D$D$$|1$.E$$$$$ $9} tr^ Yp)ӉYp 1#96 )։ۇ!֋$)Ӌ$ )Չۇ!ꋬ$> $ $$$݃?\$|)݉$?~>$Z09 )!)@ 9t$D$|$t­$HPXhp $ x$nd 33x$$1 nd 3щ$X1$$$12-by3x($1 2-by뉜$T1$$$1$ te k3X,$ى$1 1te kΉ$P1$$1ً$$ 9U $$$$$$1$$F$$($11 1$É$1$$$ 닄$11 뉜$41$‰$1$$,11 Љ$01$1$$$$ȋ$1$1 1111 t$(1T$1l$$$4Ջ$11 Չl$$1\$1T$ $0ʋ$1$1 ʉT$,1\$ 1L$$ȋ$1$1 11$D$($($L$$$$T$$$ $|\$ $$tl$$$$$|$$t$lD$,$,$dl$$$\L$ $t$$$$$$$$ 8$$$$FN~ V$LV$HV$DV$$@V($<V,$8$BV $ꋬ$苬$鋬$l$d$\$T$$L\$h$$H\$t$$D\$X$$߉|$x$$@l$p$$<l$`$$8$$9L$\l$l)߉$ۇ!ߋ$$ϋ$9n0E@$@}w$(expa$39}$ nd 33y}$,2-by3y}$$te k3y } 3QU3AED$\3AED$d3AED$T3A E D$h3A$E$D$t3A(E(D$X3A,E,D$x3A0E0D$p3A4E4D$`3A8E8D$l3A=D$D$8D$D$<$ËD$ $=d d L$8D$<$p :%e ;aD$ $D$$D$AD$ L$T$roXl$uvYZDDD,$L$D$T$ D$L$L$(D$,Uo Np wBe ;amPD$TH<L$d _\$T$,HdL$L $8D$THpL$ & $T$dT$9D$ HL$(T$D@D$$\$L$;D$`L$\T$X\$$l$(t$D11D$<1ɉL$HD$`L$\7D$ɉŸ4cG<9v 9ti\$($KL$@${D$xD$<D$@D$(@D$ 3${D$ L$L$9D$ $]D$D$0|$\1D$HPL$\T$`H L$dHP@T$hL$lD$p$D$t e u-|$0t$\YL$0L$,@8$D$,D$ D$uED$LHD@z(9 r$J(r z$9T$L$T$PT$)!L$)lj|$ T$D$L$T$8D$D)H8H P(\$0l$(99p )!ыPvL$)\$|$ L$\$|$$֋D$DH(P$X l$099)!)X8uUH @(T$ 9ȉD$TBD$X\$\D$`D$d@ÉT$$t$4L$8G$ЋD$DHT$HPXPXXR L$D$D$ $ҋD$DH(P \$09R(pm T$\$L$ 4$ՋD$DPIX4h,l$D$\$ $ыD$L$T$\$DK0C4-e umS,$L$D$D$8D$ D$$D$D$4D$?D$u D$DD$TD$XD$\D$`0D$d@Í{,ʼnȬD$TD$XD$\D$`T$d@Í3$t$t$D$L$ T$\$DC$S(e uBK T$(9~/Ћl$<9t $l$T$^ЬD$(T$D\$0l$ ‹D$(ˍ{ ‰5ȬD$TD$XD$\D$` D$d@ÉD$TD$XD$\D$`D$d@ÉD$TD$XD$\D$`D$d@D$TD$XD$\L$`D$d@, , , , , , + - , {, t- 蝯e ;a$)G|$D$8Ge 2L$4G  e  1kOG e ȲG@$|$D$!,$D$L$T$ \$D$ L$$T$(\$,|$0O e uD$DH@PDXHl$Hu@}DmHt$|$l$-ܻ,$D$L$T$ \$qD$ L$$T$(\$,l$8M e ED$DHLPPXTl$HuL}PmTt$|$l$-`,$D$L$T$ \$D$ L$$T$(\$,l$0M e bECD$DHXP\X`l$HuX}\m`t$|$l$-y,$D$L$T$ \$D$ L$$T$(\$,l$8M e ED$DHdPh@l\$Hkdsh[ll$t$\$l$D$L$T$ D$ D$ L$$T$(\$,l$0M e u7EtD$LT$P\$T<ËD$4D$LD$PD$T<Í}iD$LT$P\$T<Í}K-D$LT$P\$T<Í}*D$LT$P\$T<Í} D$LT$P\$T<넬eD$LT$P\$T<̈́‰ȉND$LL$PD$T<Í}‰蝄 D$LT$P\$T<}vle ;aDL$HyQE|$@QT$ $D$ L$L$D$ D$0D$0$D$L$ D$$L$(l $D$D$D$D$ D$XͲD$L$L$4D$8,e*e ;avg D$D$$$L$L$/ɧD$t;D$D$Htω$D$D$D$ D$n먃 bee ;av) D$H@I$ыD$L$D$L$ ee ;avD$H @D$L$ de ;av( D$@I$ыD$L$D$L$ de ;av( D$@I$ыD$L$D$L$ Qde ;av( D$@I$ыD$L$D$L$ de ;a,D$0HL$$@D$3$D$D$6D$L$T$ \$9~@D$ L$T$(l$$9t$l$\$D$(D$4D$D$8D$ D$<,ÉRc]e ;a,D$0HL$$@ D$3$D$D$5D$L$T$ \$9~@D$ L$T$(l$$9t$l$\$GD$(D$4D$D$8D$ D$<,Éb]e ;a,D$0H(L$$@,D$3$D$D$?5D$L$T$ \$9~@D$ L$T$(l$$9t$l$\$藁D$(D$4D$D$8D$ D$<,Éa]e ;aR,~$D$QD$D$( @ $D$3D$D$$ | $D$D$D$ U $?!D$L$0 e L$4HL$LHL$PH e L$HH L$@HL$DH e L$T$pZ(l$0l$$D$L$\$ D$L$T$L$pcX8h<e *P4YRl$D$$ҋD$ L$ ʡ$cL$D$pXRL$D$D$ $ҋD$L$D$p@I$ыD$L$T$\$uQt'D$$D$L$$$lDŽ$DŽ$lÉ$$lÉ$$lÉ$$lÍx4ÉUXhe u tÉ_U^$$lËl$0l$$D$L$\$ TD$L$T$D$4D$8D$pD$0$էD$ L$L$4D$8K$D$)D$4D$D$ D$'D$L$$$lÉ$$lÉ $|$T$zD$ t2D$(H @HT$,Z RZ9t \$pt$T$L$zD$ t\$pN$$lË\$pʼnSK$ωŋD$tSL$ ɉqKωSD$p3|$$S =$D$0D$L$C! ߮$$D$$L$F}DŽ$$$ĤDŽ$$$Ĥt DŽ$$$ĤDŽ$$$ĤDŽ$$$Ĥ*Ke ;alD$pH$L$L$|L$$L$ ?[D$L$T$lD$Xթ$9D$D$hL$pYl$Xu} |$ $\$t$zD$L$T$|$hOGe @$|$wD$L$T$ \$tkD$T$L$ D$x$ՋD$L$D$t@L$x $ЋD$L$ T$\$l$IL$(T$$\$P߮$TD$D$dL$P $L$$L$L$(L$ L$ D$cD$L$D$pP\$dks{ |$l$ t$ $T$4D$L$T$\$ mD$HL$DD$X@$QD$pPI$\$l$t$ |$H|$|$D|$\$ l$t$$ыD$D$LL$pY$\$oED$$bD$D$,L$L$T@$ŧD$ L$D$L$$$@$L$,L$T$TT$xŧD$ L$T$djr\$l$ t$$L$<@$L$,L$T$TT$.ŧD$ L$T$hjR\$l$ T$$L$@$D$,D$L$TL$ħD$ L$T$dZ jr\$l$ t$$L$觚D$L$諒D$ 3 $D$%D$ D$\L$L$0T$T$4$L$T$\$L\$ 5D$,H T$\T$\$0\$l$4l$ t$T4$ыD$,@D$D$D$ L$T $ЋD$D$`L$L$@T$T$<\$p+[,$\$xCD$D$8 ֲ $R|$D$@GD$ϧ|$D$4GD$0Ge $L$(OL$,O e $O $QYW_ e uZGAQI W(O, e u.G$G0$DŽ$DŽ$ĨÍO$&ōW &뙍O ω‹$%[$%$ $!Χ|$G4e u.&DŽ$p$$ĨÍ&s%DŽ$$$ĨDŽ$$$ĨDŽ$$$ĨÉ %DŽ$$$Ĩ` e D$;A\$H$$ыD$ L$T$\$l$D$L$H $gȻT$D$0?D$ ED$LL$H $D$7T$D$ =D$ D$LCD$L\ q5 t L$H~L$H $ۼT$D$>D$ D$H$D$LD$qD$ L$T$<$T$@T$T$DT$L$ D$D$L$T$t4D$PD$TD$XD$\D$`T$dL$h8Í mL$PD$TD$XD$\D$`D$dD$h8ËD$L L$H $0T$D$=D$ D$L L$H $T$D$q=D$ D$L(tht6L$H $ViT$D$+=D$ D$L`L$H $.iT$D$<D$ iD$L(뚋L$H $iT$D$<D$ 9D$L(eL$H $D$ۼT$D$ @;D$ D$LD$L$L$H $D$ȻT$D$ ;D$ D$LD$Lh5`e ;a0D$81111111\$4l$8|$<$D$L$T$ ND$L$L$ D$D$4$D$8D$D$)e ;a@D$\H  7L$(D$, D$0D$4D$8D$<D$0$Q~D$ L$L$0D$40$D$(D$+~D$L$ D$8L$<M$D$&D$0D$D$ D$]MD$L$L$`D$d@É$7D$L$3#D$ u D$\D$\HP@ T$D$L$ D$D$D$HD$D$LD$D$PD$ D$TD$D$XD$$:D$$uJ$蝤|$Ge u`pD$`|$d@Í`D$`D$d@h3e ;avED$ D$D$$D$D$(D$`Х$D$D$-}D$L$ D$,L$0e ;a貣$L$T$91tIt D$D$ $T$9t1$L$L$D$7.D$ 蛣D$ $T$9t1뤉$L$L$D$.D$ T$녉$D$D$L$-D$ T$Z"e ;avLD$ @L$ $ЋD$@=~= D$D$D$e ;a:$^$YD$D$ L$( $L$,L$L$0L$ L$ D$D$L$$ D$D$L$ Yu *nistyjp2567u *nistjp384unistu Rp521tr$茡|$Ge uB D$4D$8D$<D$@D$DpD$H|$L$Í 賡$L$T$e !JB \$ k s{|$l$ t$ $D$軙D$L$e T$BJ tur$襠|$Ge uB5D$4D$8D$<D$@D$DpD$H|$L$Í5빋D$ HX@-ml$4T$8D$=m9 $蔕D$D$tL$\ $T$4T$\$8\$-l$ D$D$$L$ 6$@HWC>m9$D$tD$ #D$L$ T$D$8L$4T$\ $甧|$$Ge ub$L$4O L$8O e u+D$\G$DŽ$DŽ$ĤÍOω‹D$\Ƌ$뙁@g& m93$D$(D$(7D$D$8L$L$4T$ T$\\$t+,$AD$D$@L$L$dT$tR$"D$L$T$@Zۃl$8 D$=m9@gm9u뱅t{ED$|DŽ$D$|D$h$$D$D$|D$D$ D$Z7D$L$DŽ$$$ĤÉ넅xL$TD$xC $D$\$D$xL$T$=mA$ЋD$$9$$$DŽ$DŽ$0$$D$gD$ L$$$_$D$'$D$D$ D$;6D$L$DŽ$$$ĤË$$L$ D$ t$$$J J ͫe ;a4D$8lH/W`Х9T$<jr9/& F9 tjD$ D$$D$ L$$$D$D$ D$D$ D$4D$L$D$@D$DL$HD$L4ÉT$B $D$D$uZ$茌|$G6e u*D$@D$DpD$H|$L4ÍэmD$@D$D$DD$HD$L4ÉѺ\$(l$,t$0~$D$(D$ehD$L$ D$@L$DD$HD$L4ËT$<c/T$<`/ju@9urT$\T$t$x1 GT$t\$>9^8v8uߋ$HU\$$1\$pkl$pL$|T$x$$$$t$$|$/D$ L$p9$$$T$$\$L$ D$$L$$T$$$L$D$;JD$ D$PL$$PP $ҋD$ D$x|Z$L$ $ $$L$$L$0:D$|H$ЋT$xJd d $$tÃD$x|e$L$ D$$ $$L$$L$AD$|H$ыT$xJˉ"d d $$tËD$Pt@DŽ$DŽ$$$$$D$$D$D$ D$(D$L$T$T$$T$T$pT$D$ L$D$L$$$tà D$x11111tTT$H\$@$$ $$L$$L$D$ D$?L$HT$@$d d $$tËt$|V$,XGw w 7 ʹ= aD$x111111tPL$D$\$L$$$D$$D$t$ l$>L$LT$D$d d $$tË|$|_$x|$Dks${$  {$$$$$ lj$  { { { ; ˋL$D?d L$P9u $$D$d D$P D$ K$$D$xD$D$|D$'D$L$T$ \$l$d d 5e d $$|$x$$$th~D$?\$? uπ$$$D$$D$t$ T$|$L4$$|$x111뭍=d ƉԫLAd d $$tËD$T$$D$D$pD$jD$ D$D$L$$$tËD$PH($$ыD$L$@P $ЋD$D$PHT$$ыD$L$x9D$PHT$$ыD$D$h1'$L$D$\$ t$l$ 3D$lHD$h9L$l$$$T$$\$L$ D$L$T$\$ll$x9 $4-_ -d -3-d e uR5d $$$t(kD$?|$? ̀111$=d ҫ$듍-3닋D$P@T$ $ЋD$L$x9\$|)É!Ë$)ʉ؉=d d $$tËD$T$$D$D$pD$>D$ D$D$L$$$tÃgD$x1111111tpl$`t$\$$D$L$T$ D$L$D$ L$$$$D$$D$u:L$`T$\$-D$T$$D$D$pD$D$ D$D$L$$$tËL$|$كks s  9s1111111)؉)݉ۇ!ݍ| ƉȉٻD$P@($ $ЋD$L$@P $ЋD${$$D$xD$D$|D$D$ L$$T$\$l$ t$|$$$|$x$$$@$$L$QD$ L$d t d e d $$$teQӃ uʀ$$$\$$\$L$ D$T$.$x$|$ˉщ111맍=d ,ϫj111돋d d $$tËD$T$$D$D$pD$HD$ D$-D$L$$$tËD$TH,T$pT$$$э$@$ԫ$\$X $D$ҦD$D$ VuD$L$u =restD$x;1111111$t$X|$d$ $$$$ L$lOD$ L$d t d e d $$$tYQӃ uʀ$$$\$$\$L$ D$T$i,$L$XT$d111볍=d "ͫv111뛋d d $$tËL$|$كks{   9s1111111)߉ۇ!ߍ4)؉ƉЉʉٻM$$D$x$D$|$ $$L$MD$ L$d t d e uwd $$$tPQӃ uʀ$$$\$$\$L$ D$T$*111M111뼍=d ˫111맋D$xt*D$>$?D$L$$$tDŽ$DŽ$tÉ$$$($,DŽ$0DŽ$4DŽ$8DŽ$< 3$0 _ ȉ$4$$$D$BLD$ L$$8$<Z$D$4$0D$D$ D$D$L$$$tË$ꋄ$x$=D$L$$$t1H111=d $ɫ~$r111/ / / . 3e ;avi 3$D$D$@݄D$ L$T$$L$T$D$$D$ D$(D$1D$L$T$D$,L$0T$4 蠱{e $;A$ $$$($,$d  d e u$d $($,$(@QӃ uʀ $D$T$GD$$L$$T$ $$L$D$7D$L$ $D$D$ L$$P $9H$L$$$$$$L$$t$6D$$L$ L$|1ҋ$$$$G$L$|Չ9$$l$d$$$$L$$\$T$ D$$L$$T$$ $L$D$f6D$ D$\L$$PP $ҋD$ IJ*$$ um$L$dQ$9$D D$P3$$l$L$\$ T$l$D$\$PD$PL$d뵃u $닃 u$w^$4n|$Ge u CCū u$$ u$ u$$T$d$$ $$D$$D$}D$ L$dQ$9$D D$?3$$l$L$\$ T$́l$D$\$PD$?L$d봃 P$$ $L$dQ$9/$D D D D D$T3$$l$L$\$ T$l$D$\$PD$TL$d떃u$i u$U^$5l|$Ge u CCë u$ u$ u$ $$ -$1ɉL$tD$pT$dZ   $9t$$$$|$H$ŋD$tDD$tDD$tDLDDD$pDڋ\$H$$$3$$L$T$|$ \$9D$L$|$Y$T$dl$t$$$6u$1 u$1^$7j|$Ge u C C u$1] u$JG u$12:Sd L$\9 $$D$d D$KD$  $`iD$ d  8 d e d $$ $$$ Z݃ uˀ$D$\$D$L$T$ $D$L$$ D$ $D$$D$f$ $D$$T$d)9|}$, 9 9 $$$$ml$ )Ӊ!Ӎ$D$t$k$$$7D$l 3 $T$\$zD$L$T$ \$d9~@؉L$h$$9t$l$\$FǫD$lT$d$\$hËD$d111=d > 83D$\H($$ыD$L$@P $ЋD$ D$\@T$ $ЋD$$1ɋ$$l$dD $N$։ډ9H$$$$$ $$T$$\$L$ BD$L$$ uk$Q$9 $SD$X3$$l$L$\$ T$zl$D$\$PD$X$ u덃 u냍^$e|$Ge u CCX u7 u+ u݉Ӊf$ $$D$$D$k*D$D$`L$ $T$dZ$9$DDD$9wK~ 9v $$$L$|$Zī$$$\$D 3 $t$\$l$ D$yl$t$$$\$D|$`p3$$L$T$l$ \$xt$D$l$XD$`$T$dD$\@($ $ЋD$L$@P $ЋD$a1D$dH$9$$L$@T$L$ ,$$t$$|$BD$ D$x1ɋT$L$l$@C$$ $\$D$«$HD$x$$$9$$$$$ $$T$$\$L$ D$L$T$$v$u$9$$$$$+,$$$$D$L$o'D$$$\$ $9w$9$$3$$\$L$l$ T$lvl$t$$$$$뒉$$$3$$L$l$|$ t$ vD$L$|$q$$$$$$$$$D$d9)!‰)ŃEDDD݉L$L$t$@3$$l$D$T$ L$*u\$D$T$HD$d$$$L$$T$'D$ L$@,$T$ $Ѝ$x$]$$ $D$ҦD$D$ ^D$L$$ $$L$$T$D$ L$dQ$95$D D D D $$$$ $$D$$D$ӰD$$$\$ $9wQ$9$$ $\$D$蔾$$$$$3$$\$L$l$ T$7sl$t$$$$$Z$3$$l$L$\$ T$rl$D$\$P$L$d=rest4$T$d$$$$ĬÈL$> 3 $$l$D$\$ T$Zrl$D$\$P$L$>v$$$`111=d $$u111$G E$|$ ( $G E$|$' $G E$|$' $G E$|$' $ $$D$$D$D$$L$ $DŽ$HDŽ$LDŽ$PDŽ$T`&$$T$/4D$ L$$H$L$$P$$Td\$D$'$HD$D$ D$lD$L$$0$40$$0D$}4D$ L$ $D$&   $ $$D$$D$D$ $L$$DŽ$XDŽ$\DŽ$`DŽ$d`&$$T$2D$ L$$X$\$$`$$d#<$D$%$XD$D$ D$6D$L$$8$<0$$8D$G3D$ L$ $D$S% l e ^ W P $ $$D$$D$YD$ $L$$DŽ$hDŽ$lDŽ$pDŽ$t`&$$T$1D$ L$$h$l$$p$$t$D$"$hD$D$ D$D$L$$@$D0$$@D$1D$ L$ $D$$ Qe ;aZPD$X1111111}CT$'l$@t$(|$, $D$\$Ⱥc кc ̺c D$ T$L$>D$D$DL$L$00$L$L$kD$ L$T$T$<\$0D$LL$8l$D1 T$H ՉƉl$Ht$4EMU$D$L$T$ 踟D$L$T$4\$89Bl$Lt e |uBBL$09|l$`\$dD$VD$D$(L$ T$0　3$L$L$iD$L$ T$\$0l$ 1 Ӈߗ1F9}93<39r&\$($L$T$D$ \D$($D$ rd L$D$(H~-D$DD$,D$HD$D$LD$D$PD$T41Չ$T$L$L$$L$ D$(빋T$0D$D\$HT$LL$PD$T4ËL$@\$8كks k  9s1111111[|,)ډ!)؉ωމӉ¸2  諔e ;a<D$,D$0D$4D$8D$@HPU1ۅD$,D$0D$4D$8L$,9tbPX!119 t$T$|$(9t<$\$l$rD$D$4D$D$8D$(D$0D$@D$,D$4D$,D$,D$,$D$rd D$MD$4L$0P|zD=rk=r=z^ Љ9uQLȉD$D<ø111NT$ \$$ ($T$BD$e|$ t$T$D$@L$,\$$l$ 1u넍B|zLrjr^  ȉ9uQL11t _Ut    ݑ8e ;aEhD$XD$\D$`D$dD$pL$tQT$@l$lt|$xOD$D1D$ D$D\$$JD$ @ ߮$ID$ 4tH|$l$\$T$ t$[D$L$T$\$$Se uCʼnʉىy{靫 ( Qe ;a D$D$L$+AD$ $ˬD$D$$ WL$zu5D$H@ T$9sD$ D$ Ð 袅]e ;avYD$ L$+AD$ $ʬD$H P\$ 9s e Mxe ;avTD$ $D$$D$D$T$\$ l$@Il$\$T$ $ыD$L$D$(L$,Հe ;a@HD$hD$lD$pD$tD$xD$|L$X|$01옫L$PL$0L$TL$4L$XL$8T$\T$e ;aD$HHtb$#|$Ge u2!D$(D$,D$0pD$4|$8Í!1{ɍ $#D$ T$Je uB D$J e uaB$D$ D$D$$D$D$L$ T$Z*r R9)!T$()\$,|$0L$4D$8Ízz똍z zw$"|$Ge u2!D$(D$,D$0pD$4|$8Í!zcߨ bGe ;a'(D$,H tJ$-"|$Ge uhpD$0|$4(ÍhyHPIĺ\$D$D$ D$D$D$$D$L$ T$$t.t L$0T$4(ËD$,$yD$L$D$0L$4(Ätʍ$_!|$Ge uZpD$0|$4(ÍZx>ae ;a(D$,@ D$D$ D$$ xOL$ |OL$ pOL$$1L$\$$*ՋD$HD$,|ދH(@$L$>e L$uiD$,H0H$L$P(T$18\$D$T$ $lOT$sD$XD$,L$T$9|D$0D$4(ËT$,z0w`e ;a^4D$8H D$,D$0H@ $L$,L$æD$0D$L$,L$ T$8Z$D$ L$\D$`PD$\D$`PSר |[e ;avDD$D$ >F[e ;aDD$HH4~$D$藲D$D$@  $D$yD$D$< @ $D$[D$D$8  $D$D$0 e L$@HL$pD$00pD$0"pMxD$@py D$<pyD$8o $DD$}DLXe ;a%$L$(Q5Q4$D$ b^ e L$(HQ,Y(i$s9#SQ( e |uD$,oD$ @$l$\$T$ t$+D$L$T$\$(S,e uC$ŋD$ ʉى덍{$nxD$(nȋL$(Zc c Qe uA y n$We ;a%$L$(Q6Q4$D$ c^ e L$(HQ,Y(i$s9#SQ( e |uD$mD$ @$l$\$T$ t$*D$L$T$\$(S,e uC$ŋD$ ʉى덍{$mxD$(rmȋL$(Zc c Qe uA y>m$Ue ;av) D$H@ I$ыD$L$D$L$ `Ue ;atD$ H tZ$|$G$e u*Q+D$ D$$pD$(|$,ÍQ+Il@4 o $D$HP\$\$T$L$ @ $D$ L$T$e uIJL$YAZ e u%B pGD$ T$$D$(D$,Íz kԍzk뮍$|$Ge u*@ D$ D$$pD$(|$,Í@ HkSle ;aD$HH tZ$R|$G%e u*m<D$D$ pD$$|$(Ím<j@5H@D$L$`$fD$L$ L$D$ D$$D$(Í$|$Ge u*!D$D$ pD$$|$(Í! jRe ;aD$HH tZ$|$G%e u*H<D$D$ pD$$|$(ÍH<hi@6H@I $э`$&D$L$ L$D$ D$$D$(Í$t|$Ge u*!D$D$ pD$$|$(Í!hCQe ;a$D$D$L$H e L$H@$D$oe L$uED$H@D$L$ L$ $ OL$8dD$D$$D$(D$,ËT$z@g밍xD$gtTPe ;av'$t$(jmD$ L$L$,D$0$Pe ;av D$D$ Oe ;avD$ L$L$ D$$Oe ;avD$L$L$ D$$xOe ;avD$L$L$ D$$HOe ;aDD$<D$@`&$D$HD$D$ L$L$D$HbȋL$H $ |$G;e u*"7D$PD$TpD$X|$\@Í"7YbD$PD$TT$XD$\@ËD$H2bJce ;a4@$Y |$|$<e 1bL$HT$< D$LB$T$D$D@IT$\$ l$50t$D$T$ \$l$$ыD$ L$T$\$$l$(tD$PD$T\$Xl$\@ÉL$0T$8\$,l$4D$$OD$@]D$0D$PD$8D$TD$,D$XD$4D$\@Í$|$g|$Xe ;aPTD$LD$Pp^D$LD$XD$PH $L$LL$PD$\H  $cD$D$HL$\Qi$T$l$DD$L$ T$\Z |$HG_e ,$|$D$XPI$\$l$t$ =xX|$D$ D$ \$t$l$$ыD$ L$0T$,\$(l$t$$7L$\Q D$XP$NT$L$ D$ D$@  $We |$u6D$\D$XGD$@G0nD$`|$dD$hD$lTËD$\TOω‹D$XTzD$@T볉D$<\$8t$4`$D$D$DL$< $L$4L$L$8L$ ͞L$ D$\wD$L$uD$DL$\A D$`D$dD$hL$lTÍ$T|$G)e u*"D$`D$dpD$h|$lTÍ"SD$`D$dT$hL$lTÉSD$XPI($$cCD$L$ $D$D$1D$X$D$\D$nD$L$T$ \$\$`T$dL$hD$lT;e ;a%$D$4D$($рD$(D$$ WL$ú$D$赒D$L$(Q Ziq9SZY RT$,Te |\uT$0TDD$4¨$ÉD$05R߉,R܉D$  $l$T$t$ \$D$L$T$\$(Se uCʉŋD$ \{Q$@:e ;a@D$Lu|D$8D$< 3 $D$ѦD$L$ D$8L$<$D$!D$8D$D$ D$诡D$L$D$PD$TL$X@=yD$D$L$HL$t^D$ L$T$tfD$L$ T$$ $*|$D$GD$ Ge u%D$$D$LG |$PD$TD$X@ËD$$P֋D$DD$(D$HD$,D$0D$40$D$(D$XѦD$L$ D$0L$4NǼ$D$D$0D$D$ D$芠D$L$D$PD$TL$X@i84e ;a2\D$DD$HD$d$L$DL$裛D$D$DD$$L$HL$0D$DD$HP $ҋD$D$,L$L$ !K$*T$L$uD$ (${D$D$@L$$Q\$0$ҋD$ L$T$$L$D$D$ L$@L$qD$L$tkI$ыD$$@D$(L$T$$#4\$D$;L$ T$=D$L$D$L$ D$D$0$D$( P$D$@@|$Ge %|$8G  e tG P$`|$Ge  G e u{tGT$80OD$`$\$T$\$ |$L$$L$T$0T$D$D$$@D$ L$D$ T$0$W׉Ít?Ms-M COύtMMD$,D$LD$ D$PD$TD$X0$D$LD$ͦD$L$ D$TL$X$D$D$TD$D$ D$ D$L$@$ .zL$rD$ u D$,L$  <$D$D$l=9蕈 {\衠L7b흳JWĿo&*u`ɦ$D$T " $D$1T$D$ 5|$Ge 60"$L$TL$*T$D$ |$Ge "$L$TL$gȻT$D$ |$G(e i"$L$TL$zȻT$D$ Z|$G(e +.i"$L$TL$ȻT$D$ |$G(e Vi"$D$TD$ 7L$D$ |$G e jۼD$Trd $D$"w_D$ L$ d e d p$D$(?_D$ L$ d e d (Ǧ$D$P  $3D$D$L @ e { OH$L$PL$ZT$D$  |$e (D$L $躻D$D$L @ e  OH$L$PL$TT$D$ I |$e D$L $AD$D$L@ e G OH$L$PL$T$D$ |$e D$L $ȺD$D$L@ e  OH$D$PD$ CL$D$ W |$e KD$LD$Prd $OD$(D$D$H$ OL$(D$D$D$ OL$q(D$D$@$ OL$S(D$D$<$ OL$5(D$D$8$ OL$(D$D$4  $D$ D$ĦD$ D$0 ܮ $kD$D$,@ e L$HH$L$0L$ T$D$ |$e D$, ܮ$D$D$,@ e L$DH$L$0L$ T$D$  |$e 5D$, ܮ$wD$D$, @ e L$@H$L$0L$ T$D$  |$e D$, ܮ$D$D$,@ e TL$Ŧ|$ Ge  0D$)$L$$L$T$T$Ħ|$ G e  $D$)$L$$L$T$T$Ħ|$ G e @ gDD$)$L$$L$T$T$rĦ|$ G e +UD$2)$L$$L$T$T$.Ħ|$ Ge D$4)$L$$L$T$T$æ|$ Ge DD$3)$L$$L$T$T$æ|$ Ge D$<)$L$$L$T$T$bæ|$ Ge kлD$P)$L$$L$T$T$æ|$ Ge HpD$Q)$L$$L$T$T$¦|$ Ge <D$R)$L$$L$T$T$¦|$ Ge %D$Z)$L$$L$T$T$R¦|$ Ge LdD$^)$L$$L$T$T$¦|$ Ge dD$[)$L$$L$T$T$|$ Ge D$\)$L$$L$T$T$|$ Ge PD$])$L$$L$T$T$B|$ Ge UD$`)$L$$L$T$T$|$ G e RD$a)$L$$L$T$T$|$ Ge T{xD$b)$L$$L$T$T$v|$ Ge ;D$c)$L$$L$T$T$2|$ Ge -D$d)$D$$D$L$L$|$ Ge I-D$$sd ;"$D$-ND$ L$ d e d $D$ D$}D$ D$  $D$T$D$ D$$L$ L$T$D$ D$$L$ L$T$D$ mD$$L$ L$T$D$ ;D$$L$ L$ʢT$D$  D$$L$ L$͢T$D$ D$$L$ L$4T$D$ D$ $L$ L$ȫT$D$ sD$ $L$ L$T$D$ AD$$L$ L$ T$D$ D$ $D$ D$ PL$D$ D$e D$ sd |$XIt$X>kD$L$$L$WD$ L$ $D$e L$u sd :e lÍ=sd =sd D$ q=d -=sd D$$-L;{xRPUrbRTdBd2%"X<pkл\`+U gD$d0rJSbh=d R=rd @=d 0j=rd  =rd D$( D$,=rd D$0xOFD$,xOD$,axO D$,xOwoD$,i'xD$4XD$,JxD$89;D$,+xD$<D$, \xD$@ D$,xD$DpD$,*xD$HD$L=rd D$PxOID$LxOlD$L^jxOKD$L=xO*{=d (=d ۼ=rd D$TVi&.iit0\e ;av*D$D$D$D$ D$鄀e ;av"D$D$D$D$ <we ;av8D$@8D$D$D$ D$$D$(D$,Fn!e ;av"D$D$D$D$ }e ;av=D$@8D$D$ D$$D$(D$,D$0D$4a|e ;av*D$D$D$D$ D$/e ;av*D$D$D$D$ D$}e ;av"D$D$D$D$ |e ;av D$@8D$D$D$ ]Ye ;av3 Yu0D$H|I$ыD$L$D$L$ 봍|$9;uȉ#e ;avOYuLD$ @IT$$T$T$(T$T$,T$ T$0T$$ыD$L$D$4L$8똍|$ 9;u#e ;av?YuYu;D$t%H$L$D$L$ D$L$? ˽멍|$9;u#e ;avQ D$$L$L$GD$L$Q$D$0D$L$ $D$D$D$ He ;aD$H\$k39tt1ɄtjH Pk s9t;1Ʉt1HS[@9t 1D$É$L$T${D$ 1݉$L$l$`L$ D$\$1뤉$L$l$=L$ D$\$lv1e ;av. Yu+D$@L$ $ЋD$L$L$(D$, +빍|$9;u͉#e ;av. Yu+D$@L$ $ЋD$L$L$(D$, ˻빍|$9;u͉#e ;avNYuKD$ @L$$T$8T$T$Yu;D$@L$T$(T$T$,T$ $ЋD$L$ L$0D$4;멍|$9;u#e ;av7Yu4D$@L$T$$T$T$(T$ $D$ D$,Ү밍|$9;uĉ#e ;av&Yu#D$ @L$ $ЋD$D$胮|$ 9;uՉ#e ;avFYuCD$@ L$ T$,T$T$0T$T$4T$ $ЋD$L$L$8D$<롍|$9;u#e ;avV YuSD$$@$L$(T$4T$T$8T$T$$D$D$D$D$ D$D$L$D$ $D$HD$ L$D$TD$XD$\L$`D$d@ËD$0D$TD$ D$XD$$D$\D$`D$d@É$L$D$L$ D$TD$XD$\D$`L$dj@É $D$D$ L$D$TD$XD$\L$`D$d,@É@  軎e ;a D$$$D$(D$D$,D$D$0D$ D$L$T$uh9uD$4D$8 Í$N|$Ge ucpD$4|$8 Íc}L$4D$8 ꍪ5e ;avFcD$D$ $D$D$D$D$ D$L$L$$D$(胍e ;a$D$,@L$0 $ЋD$D$ L$L$T$ T$ة$M|$D$GD$Ge uPD$ $|$D$L$ T$\$($D$L$T$ )D$L$D$4L$8$ËD$ <赌0e ;aש$iL|$D$$GD$(Ge uPD$ @$|$5D$L$ T$\$$D$L$T$ D$L$D$,L$0ËD$ 蔣 Xe ;a`ة$K|$D$$GD$(Ge uPD$ $|$D$L$ T$\$$D$L$T$ D$L$D$,L$0ËD$ 䢪]Xe ;aPcD$'D$T$D$'D$D$D$ XD$L$T$\$MpB=ul @9ub$J|$Ge u2EPD$XD$\D$`pD$d|$hPÍEP=|9= vb$J|$G#e u2 D$XD$\D$`pD$d|$hPÍ jɉ\$DD$  $D$\D$D$,L$ L$HT$T$(\$Dk s{D$<1D$0D$<A\$DL$0l$8t$4NjD$,L$HD$09<$t$l$D$L$ T$\$l$t$ uML$0\$(9T$4l$8ߋe T$H,u4vD$L耠D$L\D$XD$\D$`\$dL$hPÉL$XT$\D$,D$`D$dD$hPûJD$XD$\D$`L$dD$hPJ 0$8D$ Ye ;av[(D$,$D$0D$D$4D$D$8D$ D$*t!?t8ÇuD$8D$@$ÃT$4t$(l$,L$<\$011D$xD$0L$4T$8\$e ;a$,A$D$0D$D$4D$D$8D$ !D$D$L$L$ $T$(T$T$,T$%GD$H T$ \$l$T$\$l$ T$ $ыD$@D$D$D$ L$ $ЋD$L$T$D$0e ;a L$Z1Q9 $D$L$ubL$QZj 59u|krt99t55e uQ\$l$D$D$ Íy G1D$D$D$L$ ÅzaBN,$t$'D$lĥ 5/e ;aL$Zu1i9tayt9U]t+9t'e uQD$D$ ÉJF1Յu1e uA*FƋB4~d 0~d L$D$ Ë|.Me ;aL$QZ1Y9k[9t|]9u͋}Ee u\]5e Eu!CEEEZKZ농{IE1@E]6E}1,E%E1Ë[Zu!1e uA/yD"Bc-e ;a8&$D$L$@L$ D$L$T$ \$tD$x$D$ 0 '# | hPuD$x$D$xH PX\$T$L$ $D$L$L$ |$81?D$xHL$8HfL$e ;aD$$D$ D$D$D$  $D$LD$D$  $说|$e uTD$D$G|$ GfGGfG |$$ MD$D$ @D$$ËD$ Oω‹D$ Ie ;a4D$<@ $fD$pD$ D$$L$L$(T$@$T$DT$T$HT$T$LT$ T$PT$$[$D$(D$D$$D$D$ D$D$L$ D$,L$00$D$,D$D$L$ $L$~ e e ;a4}d L$@9u@ $D$DD$}d T$=D$ tD$@t@$D$DD$} D$<@ $fD$BD$D$(L$ L$$T$@R\$D$ҋD$L$$T$(T$T$$T$T$ D$D$L$D$L$ D$,L$00$D$,D$D$L$ $L$| Ce ;av< D$D$_D$D$D$D$ ы$u e ;a\D$`H P_KJ3YuE$RD$ _ e uL$`HD$d\ÍxD$`T$$D$,D$0ªD$,T$0$D$D$,D$D$ D$;XD$L$T$`$T$$T$L$D$ D$D$D$oD$d\Í$uD$ _ e uL$`HD$d\ÍxD$`D$d\D$d\Í $D$D$(|$41D$` $L$4L$SD$ e |$(t$4M |$Ht$(8 D$`H PXi9HYX e Q$,P @D$LT$xL$lY i$l$AD$ L$u=matcu AhD$lHP $L$D$L$ =hostD$XH P $T$ L$D$ D$D$\L$L$8$D$D$侨D$L$T$ \$8l$\1F|$\$D$@L$<9>1 |/tωt$D,$|$;D$L$ T$L$D$L$L$dD$hPËL$\fno$ $8qd D$D$$D$D$ D$ ߥD$uD$dD$hPËD$\$D$`D$D$ D$ @_dD$L$ttID$(D$,L$(D$,?k$D$D$(D$D$ D$H=D$L$L$dD$hPËL$\fye3Qs& թe ;a BD$PZЋ$L$$L$ND$L$e \$ l$E UЋ$L$$L$e L$T$ \$uZD$Hu ÉT$\$$\$yD$uߋL$T$J e u D$B$ Íz$D$l$}uL$$aL$\$$L$yD$t l$%L$T$J e u D$B$ Íz$D$l$} $L$ҩ`e ;a0D$4$bD$L$u0ÉD$L$(@o$5sD$3$D$D$L$(L$ sD$L$T$ t}d 90L$9D$(HL$D$$$zD$L$H e u1L$$ pT$4 e uB2z%NjD$$ƉL$,T$ $L$}d D$D$ OL$ T$4 e u D$,B0ÍzD$,o $D$'D$g D$$D$(D$q\ ѩUe ;a`BD$0JL$, $D$11m$D$D$ݨ$D$(D$D$D$DרD$D$$L$L$4T$,$D$,$|D$L$4T$$ыT$4L$T$( tBt= xD$ D$,$ L$D$ D$ u D$ D|$81+L$,QT$8QfT$$D$ ѱD$ $L$$.$D$ dѱD$ $L$$,$D$8ѱD$ $L$$P$D$ ѱD$ $L$$ $D$D$xD$ $  $D$$$T$$T$ ڥD$ $$L$$ T$$T$ ڥD$ $$L$$T$$ T$ YڥD$ $$L$$T$$T$ #ڥD$ $$L$$T$$T$ ٥D$ $$L$$T$$T$ ٥D$ $$L$$ T$$T$ ٥D$ $$L$$T$$T$ K٥D$ $$L$$T$$T$ ٥D$ $$L$$T$$T$ إD$ $$L$$T$$T$ إD$ $$L$$T$$T$ sإD$ $$L$$T$$T$ =إD$ $$L$$T$$T$ إD$ $$L$$T$$T$ ץD$ $$L$$T$$T$ ץD$ $$L$$T$$T$ eץD$ $$L$$T$$T$ /ץD$ $$L$$T$$T$ ֥D$ $$L$$T$$T$ ֥D$ $$L$$T$$T$ ֥D$ $$L$$T$$T$ W֥D$ $$L$$T$$T$ !֥D$ $$L$$T$$T$ եD$ $$L$$T$$T$ եD$ $$L$$T$$T$ եD$ $$L$$T$$T$ IեD$ $$L$$T$$T$ եD$e &$$D$ GD$$@L$ L$8ͺ$D$D$$<L$ L$4?$D$ D$$8L$ L$0b$D$̽D$$4L$ L$,.$D$ 製D$$0L$ L$(,$D$zD$$,L$ L$$ϱ$D$QD$$(L$ L$ $D$(D$$$L$ L$P$D$ D$$ L$ L$BQ$D$ ּD$$L$ L$"$D$AD$ED$ $ " $D$$$T$$T$ ƥ|$Ge "$$L$$ T$$T$ Bƥ|$Ge 8"$$L$$T$$ T$ ť|$Ge ""$$L$$T$$T$ ť|$Ge 5"$$L$$T$$T$ Rť|$Ge b"$$L$$T$$T$ ť|$Ge "$$L$$ T$$T$ ĥ|$Ge 5"$$L$$T$$T$ bĥ|$Ge B5"$$L$$T$$T$ ĥ|$Ge ੺"$$L$$T$$T$ å|$Ge |"$$L$$T$$T$ rå|$Ge ""$$L$$T$$T$ "å|$Ge "$$L$$T$$T$ ¥|$Ge b"$$L$$T$$T$ ¥|$Ge "$$L$$T$$T$ 2¥|$Ge "$$L$$T$$T$ |$Ge B"$$L$$T$$T$ |$Ge W"$$L$$T$$T$ B|$Ge "$$L$$T$$T$ |$Ge "kٺ"$$L$$T$$T$ |$Ge "$$L$$T$$T$ R|$Ge b"$$L$$T$$T$ |$Ge 4"$$L$$T$$T$ 貿|$Ge "$$L$$T$$T$ b|$Ge B"$$L$$T$$T$ |$G2e "$$L$$T$$T$ ¾|$Ge "$$L$$T$$T$ r|$Ge ""$$L$$T$$T$ "|$Ge  "$$L$$T$$T$ ҽ|$Ge b "$$L$$T$$T$ 肽|$Ge  D"$$L$$T$$T$ 2|$Ge  D"$$L$$T$$T$ ⼥|$Ge B "$$L$$T$$T$ 蒼|$Ge  "$$L$$T$$T$ B|$Ge  5"$$L$$T$$T$ |$Ge " $"$$L$$T$$T$ 袻|$Ge  "$$L$$T$$T$ R|$Ge b ¤"$$L$$T$$T$ |$Ge  "$$L$$T$T$|T$ 赺|$Ge  "$$L$$T$T$xT$ h|$Ge H 5"$$L$$|T$T$tT$ |$Ge "$$L$$xT$T$pT$ ι|$Ge "$$L$$tT$T$lT$ 聹|$GAe 1Q"$$L$$pT$T$hT$ 4|$Ge "$$L$$lT$T$dT$ 縥|$Ge w"$$L$$hT$T$`T$ 蚸|$Ge D"$$L$$dT$T$\T$ M|$Ge 5"$$L$$`T$T$XT$ |$G e `?B"$$L$$\T$T$TT$ 賷|$Ge "$$L$$XT$T$PT$ f|$Ge 5"$$L$$TT$T$LT$ |$Ge I"$$L$$PT$T$HT$ ̶|$Ge "$$L$$LT$T$DT$ |$Ge "$$L$$HT$T$@T$ 2|$Ge 2"$$L$$DT$T$"$$L$$@T$T$8T$ 蘵|$Ge x5"$$L$$<T$T$4T$ K|$Ge "$$L$$8T$T$0T$ |$Ge "$$L$$4T$T$,T$ 豴|$Ge a"$$L$$0T$T$(T$ d|$Ge "$$L$$,T$T$$T$ |$Ge "$$L$$(T$T$ T$ ʳ|$G&e JQ"$$L$$$T$T$T$ }|$Ge "$$L$$ T$T$T$ 0|$Ge "$$D$$L$L$L$ 㲥|$Ge u(һ$0qd Ԙe (Íһ[=0qd $I΍謸#蜸茸i| l5\RL?B<5,;D $Q췩ܷj̷ 5輷謷S蜷¤茷|6$l5\vL<D,VD 6충ܶv̶輶謶V4蜶茶|6kٺl\vWL<,V 6쵩|ܵv੺̵5輵5謵V蜵茵5|6l8\vL=8qd $5=V;,#W$D$L$ hd e u4ld e dc utc ue  Í=tc a=ld Tye ;av7D$D$D$D$D$D$D$ 7rye ;av7D$D$D$D$D$D$D$ "ye ;avD$D$D$D$ o xe ;avD$D$D$D$ xe ;avD$D$D$D$jxe ;av$D$D$D$ D$$D$(%xe ;avD$D$D$D$/we ;avD$D$D$D$ /we ;avD$D$D$D$/jwe ;av/D$D$D$D$ D$D$$we ;av/D$D$D$D$ D$D$!ve ;av/D$D$D$D$ D$D$"zve ;avD$D$D$D$ ?:ve ;avD$D$D$D$ ue ;av*D$ D$D$ D$D$Tue ;av=B@(J $ЋD$L$ T$\$l$l$D$ L$$T$(\$,te ;aD$$L$L$D$D$ L$Q$D$䵤D$L$Q$D$D$UD$ L$Q$D$~D$L$ $D$D$D$ D$tIe ;aD$T$9JX8H Z jp9tr1ɄthHZ9uZHZ9uLJZhp9t1Ʉt@ J 9D$1$L$l$茾L$ D$T$111뺉,$t$\$豱L$ D$T$n1g1`se ;avR YuOD$$$D$HD$D$LD$D$ L$T$\$l$D$PL$TT$X\$\l$` s땍|$$9;u#e ;avR YuOD$$$D$HD$D$LD$ D$ L$T$\$l$D$PL$TT$X\$\l$` r땍|$$9;u#e ;avR YuOD$$$D$HD$D$LD$D$PD$ D$TD$D$XD$D$L$L$\D$` r땍|$$9;u#e ;av:Yu7D$$D$e uB0D$|$ ÍB_u5=.5`5 V=2*5=D$D$ ]e D$;A$$D$L$T$f $$D$L$T$\$l$ D$,\$@l$8$$D$L$T$\$ l$cL$,Il$86t$@>uuu>pushu  u  u N$@3$D$@D$D$8D$l$ \$#bt$l$$t$@l$8$D$L$T$\$ l$u$1Pt ӻ $D$L$@L$T$8T$ 蟼t$$xL$$L$4|$h$xL$4D$@D$HD$8D$LD$PD$T0$D$HD$D$ L$L$PD$TQJ$D$?D$PD$D$ D$W¯D$D$upstu~reamt$@ċl$8t$@DŽ$DŽ$$$ĤDŽ$DŽ$$$ĤË$@$h$DŽ$DŽ$ĤDŽ$DŽ$$$ĤV"e ;aD$$D$L$ T$\$l$ uF,$L$>D$  $D$D$ L$L$ D$$D$(D$,ËD$@$D$D$L$ D$ L$$D$(D$,D$ D$$\$(T$,U e ;a$Se ;a0&$D$D$D$ D$D$L$T$\$4A l$(,؉T$$L$ D$,\$@$5D$ L$T$e 9M!L$( $T$<D$tOD$ HT$$9\$,됍&$l$,l$D$T$ L$"\$D$T$HD$ VD$@H(vd vd t$D$DD$HD$LL$PD$T0$D$,D$D$ D$D$$D$ GD$L$T$8T$DL$HD$LD$PD$T0ËP9q)ʉP@$@(11aD$DD$HD$LD$PT$T0$D$,D$D$ D$D$$D$ XGD$L$T$8T$DL$HD$LD$PD$T0gD$ D$0L$@T$,밋D$4$D$ D$D$PD$L$TL$ T$XT$8D$dL$hT$lYl$t$96QT$hȉ*e |u7D$0L$@T$,_\$ $D$t$dL$ D$ T$(\$1$l$D$D$ 5l$D$T$(D$$l$ $D$t$SdL$ D$$T$(l$m1dD$0L$4(D$0$ L$D$ dL$ D$4T$( $|$eD|$(D$8X=蜢 蕢 莢 臢 %e ;a$D$(P\$09^T$L$ l$,1'|$w|$D$,L$0T$ D$(щ\$0l$,9}GHI9t T$L$t@t D$`tL$dLÅu1L$< $D$ D$T$D$  D$MD$48L$L$0T$D\$Ӊ‰L$,D$(\$T$@B \$<$l$ l$L$D$ D$,HT$@ЋT$\$u;T$(juu1T$넺1ۋ|$$ƋD$PȉىËD$P~D$dLÉʼnЉԋD$DPL$T$ L$< $L$ L$KD$L$u4t0t$0N|$D|$4o\$pD$dLD$dLD$dL e ;avRbe vuʟ be 蜜4r9X"ЋT$P{'"g{‰"@DŽ$$$t; d e ;alD$|H$$D$ $ɤD$D$hL$|Q$$ҍD$D$dL$D$p$D$tD$D$xD$D$|D$ $L$7|$Lt$d&D$(L$,L$`|$ht$L&L$`D$|@$ $ЋD$$D$L$ T$D$4D$43$D$hD$D$D$ D$xݧD$L$YT$4Q$DŽ$$DŽ$DŽ$lDŽ$DŽ$DŽ$$$lDŽ$DŽ$DŽ$$$lËD$p$D$tD$D$xD$D$|D$ $L$|$8t$dy%D$,L$(L$0|$ht$8`%D$0z3$D$D$ڧD$L$ T$$$$DŽ$DŽ$li =e ;a\|$t1DŽ$DŽ$L$`IR$\$d\$\$h\$ $ҋL$T$\$ l$UT$D\$ T$$ CD$|"D$l@ L$p $$+D$ D$,L$L$PD$TL$X$T$TT$譠D$D$(L$ L$L`$T$ T$T$DT$ϣD$ L$D$L$ D$($D$LD$ eD$L$t/L$H|$t5e #$D$H$d\ËD$,$D$PD$謩t$|$0M#|$tt$0@#DŽ$DŽ$\Ð \ÉL$$|$t5e #D$$$$݌\e ;aPH|$`1L$LIR0\$P\$\$T\$ $ҋL$T$\$ l$T$\$dĸË,d (d $$dĸÐ dĸÐcĸË$H L$  $1T$D$ D$2D$  eкucreaQftetBudeleQftetfb=updaUAf=teG$HPIT\$d\$$ыD$ L$$$ĀË$HPID\$h\$\$\$$ыD$L$ $$ĀÃK%D$t$e D$D$ D$ t к ۺD$t$ e L$D$D$ \ x‹D$hE$|$|$9}5l$(4~|$6t$`CD$$[\$xD$01D$ D$0DŽ$DŽ$Ā!֨\e ;av; D$$$D$(D$D$,D$D$0D$ D$L$L$4D$8 ըe ;av?nd L$ $ L$D$D$ D$ cD$L$L$$D$(Zըe ;aTD$hD$lD$pD$t|$dOuL$XZ_e B<$D$L$L$pD$tL$dQ T$XkC[Y ie AX@ CYil$\$ $D$D$L$T$\$L$pD$tRT$<\$0$\$T$qD$L$ L$D$ D$pD$$ @RD$SD$0HT$<$ыD$ L$T$L$pD$tT$PD$X$L$dL$T$#D$L$T$ L$pD$t\T$@D$P$D$L$ T$T$pL$tD$DD$X$D$L$T$ \$l$L$pD$tT$8\$4l$LD$dHP Xh(l$ $T$\$ `L$ T$DT$D$L$T$ L$pT$tPD$HL$XQY$\$D$VD$ L$T$\$l$t$@NV e F\$pl$tFD$dHP Xh(@,D$D$X$L$T$\$ D$HD$D$DD$l$'D$ L$$T$(L$pT$tu`t,`D$hD$DD$lD$pD$t;YTË(d ,d `T$hT$DT$lD$pL$t YTD$hD$lXTËD$XHPL$T$L$L $L$4L$L$8L$ `L$ T$DT$D$L$ T$$\$(l$,t$@N(V, e F$\$pl$tujD$X$L$\L$L$`L$L$dL$ T$0T$T$ҨL$(Y9~-,$T$L$D$ \$'T$D$L$XȋL$(i$$$DŽ$DŽ$fe ;a4D$8@D$|$t$@ѨL$< $ЋD$(L$$d 9tD$TL$XD$\4ÉD$0L$, $D$d T$D$ u D$0L$,D$TD$XD$\4賳Ne ;a|$HL$X $e T$D$]D$ 6$@ $Q\$T$$$ЋD$L$d 9t$$|Ë$@L$lD$pD$tD$x0$D$lD$PKD$ L$L$tD$xi$D$D$tD$D$ D$D$L$$$|ÉD$TL$< $D$d T$D$ u D$TL$<$DŽ$DŽ$|Í|$@t$XkϨ|$$pXϨ$ $$L$|$t$@6ϨD$8L$0T$4tDŽ$DŽ$|Ë$HD$\L$`D$dD$h0$D$\D$ID$L$ D$dL$hi$D$D$dD$D$ D$(D$L$$$|É$$|Re ;a8D$<$D$@D$|$t$XΨfD$L$$T$ D$0;$ppD$D$4L$0 $D$D$D$ D$lD$D$(L$L$,K$pD$ Paxt$Dͨ e u:L$4HL$(ID$D$,$ыD$L$ T$4T$lD$pL$t8ÍxD$4TǨD$lT$pL$t8躯e ;a0D$Ie $|;AD$$L$$1һ11D$?L$@$$D$>L$?T$@$L$BT$A$$HP$$l$Dl$T$L$ :D$T$tD$BL$AcHP$$l$Dl$L$T$ =D$D$HL$$$Zjl$\$W$OGD$L$ $D$$D$L$HL$ XD$$|$x1-¨$q |$xƨ$t$xƨ$$ƨ \ $NiD$L$HH e &$H$x $$ƨ$t)QY 1҄$$$HPT$L$ W $4FD$L$ $D$$D$$D$ SD$L$T$uL$A D$BT$A$($,$0Ë\$D$U+uK|$d1$q |$dŨ|$P|$P$iŨ$QY\$T$`$HEL$T$ $L$$t$d'Ũ$t$PŨL$8T$0\$4uL$AD$A$($,$0$$g$ 6D$D$ DT$ $$x$蛾D$BL$A|$LG$\$>͉֋$D$?D$@$9T$L\$>$  Ћ$IL$D$L$7D$D$C$1 K $$T$$\$D$CL$>!ȈD$>L$?T$@$ $$ $D$D$L$T$ u>\$@ D$?t(Td Pd $($,$0ÉȉD$@$($,$0Ë$q$(DŽ$,DŽ$0;! d/e D$;A|$T1虽 K $$L$L$TL$贀L$L$P1D$/L$T $L$PD$/T$T{D$/T$XT$HZj -1ۄt|$41 r |$4$Yi[D$|$Pt$4,$ӋL$(L$LT$$T$0d 9u)$L$d D$D$ t D$/7D$0u}$HPT$L$ W $dAD$L$ $D$D$HD$PD$L$ T$u D$/ L$/$$$ĄƄ$$D$L$ĄÉ,$X&D$D$ o\$ D$/L$PT$H$DŽ$DŽ$Ą/e ;a4D$@D$DD$HD$LD$PD$8H @AHT$LD$XNH$ND$D$H `d $ L$D$H-D$L$T$ T$ L$,/$=ND$L$  e L$,HL$TH e L$PH `11ۉD$@L$(T$4\$$-,$MD$@L$( $L$@L$ vL$D$ D$  $D$D$$D$D$4D$ aD$L$T$T$\L$`D$dLÍxD$PNxD$,⤨ε$-MD$  e L$HHD$LD$D$H `d $ L$D$*D$L$T$ L$0T$/$KD$L$ e unL$0HL$TH e uDL$PHD$D ` L$D$$趥D$L$ T$D`xD$P뱍xD$0뇍ε$MKD$  e L$HHD$8Hި$T$L$)D$L$8AAb$T$D$)D$L$8A A /$T$D$)D$L$8A A b$T$D$x)D$L$8A |xD$H@臊e ;avX$nd  $D$D$(D$D$,D$ D$0D$D$4D$2D$ L$T$T$8L$d 9tD$<T$@L$D(É$L$d D$؞D$ d L$9D$4$D$D$L$L$$T$ $D$L$9tVD$,@L$4L$L$8L$L$0 $ЋD$L$ tD$<L$@D$D(D$<D$@D$D(ËD$$$L$oD$ tD$<D$@D$D(É $D$$D$d D$㝣D$ QL$$T$SZe ;avDD$ $D$$D$D$(D$D$ D$L$T$L$,D$0T$4Re ;av?nd L$ $ L$D$D$ D$ #D$L$L$$D$(JRe ;aD$($^D$L$umD$(HT$L$L$ $rD$ L$T$t L$,T$0É$D$ D$D$$D$D$(D$ {D$L$D$,L$0ÉL$,D$0QLe ;av?nd L$ $ L$D$D$ D$ #D$L$L$$D$(*Qe ;aD$($k^D$L$umD$(HT$L$L$ $RD$ L$T$t L$,T$0É$D$ D$D$$D$D$(D$ fiD$L$D$,L$0ÉL$,D$0qPLe ;aHD$PH $D$9t$PND$L$D$L$T$\$ D$PHuT$T\$XD$\D$`HÉ\$L$e ;aD$ H tj$^e L$u>T$ QZ Be uAL$D$D$ÍyUލyD$ U빋|d xd D$L$D$=He ;av%D$L$11B9} ,tC\$=e $;A h$P$T$p$$tD$PD$$D$L$T$\$N D$X$T$$(\$$$11\$\SD$Xl$t$΍ 9T$\$$L$,T$<\$8$= `<$yD$L$, e 1$HL$8H L$G蓮$@$$Ë$ʼn>U$@$$Ð.$H$$Ë$1>н$D$0D$D$ D$~D$L$$ e u*B読$H$$Ë$=1n$H$$ÉÉt=$y^=TyD$|M=#%~e ;a`$L$ L$T$$T$\$(\$ 2D$t4`$D$ D$D$$D$D$(D$ "/D$D$,Í $D$D$@?? ` $T$ T$\$$\$l$(l$ 5|$e u D$nD$M<`$e ;avN`$D$D$D$ D$D$$D$ 1D$L$t@?D$(1K$e ;avk<|$ 1< ` $L$@L$L$ L$ D$ $$D$ t D$H u tD$DHIIR( $ҋD$L$ T$$|$0$H6|$Dt$0;6|$X1M1$t$D 6|$lt$X6$ $L$lL$D$VL$ $$jD$ L$T$$$$$L$$L$T$ $L$|$t$05D$,L$(t$$ĜË$$$D$$D$(D$ L$$$ĜÉ$$ĜË$HQ IL$T$$ $D$L$t$ u|$04$$ĜÉ$$ĜË$$-D$L$u $$$ĜË$td d $$ĜPe ;a,D$8HiL$4Q  |d xd 1ۅ$9D$L$T$ \$l$t \$çe D$;A$ 1}ۧ|$dTۧ|$dKۧ$q|$x$q$ߧ$$$$$$ ߧ$QYi $$$I$HIR8 $ҋD$D$\L$L$(T$d$D$L$ t/L$,$ 5e oߧL$,$4$8Ë$@@ILT$(T$T$\T$$эt$ |$4"ߧD$ L$$L$`|$Ht$4 ߧ$ t$Hާ$4D$`$8ÉL$$$L$dL$gD$ L$T$\$u$$L$0$ 5e ާD$0$4$8 e ;aD[$蹀D$D$0L$L $ `L$D$GD$L$ D$0H L$(PT$4@D$$ $`|$D$$GD$(Ge ?D$4D$<D$@D$<|$@X$D$e ;a#4D$8@L$< $ЋD$ D$(L$L$$T$T$0\$@[l$D,$ӋD$D$,L$L$T$ T$ \$0$l$$l$t$(t$=d 5d -d |$ t$l$עD$t D$H4ËD$,$L$L$T$ T$d -d 5d \$ l$t$֢D$uD$0$D$$D$D$(D$D$,D$ D$D$D$ D$֢D$D$H4貘e ;a/l|$|1L$p $L$T$ \$L$`D$pHIR( $ҋD$ L$T$L$d|$81蜰L$pYRl$tl$t$xt$$ҋL$T$ \$D$p$L$dL$T$`T$T$tT$ T$xT$D$t$|$L L$,L$4T$0|$8t$LL$4uvtKD$p@@IPT$dT$$ыD$L$ L$h|$|t$8貴$D$h$lÍ|$|t$8菴DŽ$DŽ$lÉL$4|$|t$8dD$4$$lËB $D$D$p$L$dL$T$`T$T$tT$ T$xT$_D$L$T$ |$|5e 쳧$$lÍ|$|5e ˳$$lVe ;aalD$\D$`D$dD$hD$pPI,\$|\$$l$$ыD$L$T$\$ T$<\$P11|$Ho\$PƉЋT$<9l$HD$XL$DD$7L$@@D$TQ$ҋD$L$D$\D$`D$dD$hT$|T$\$\$`L$dD$hD$\$D$D$dD$D$8L$ L$LT$@Zl$T,$D$D$@@L$T $ЋD$L$u=.gituD$7L$DT$XD$p$L$tL$T$xT$\$L\$ \$8\$SD$L$T$u(\$7tˉщtD$7$$$lËD$p$L$tL$T$xT$\$L\$ \$8\$T$,D$L$0x$$$lƄ$$$lԓe ;aVTD$XH$L$L$\L$L$`L$ RsD$ L$T$\$ T$8\$LD$X$D$L$ T$D$DD$XHIR( $ҋD$L$ T$~D$H11 \$@K‹D$H\$89L$@T$7D$X\$L,ˋut$L$x\$tX  ˉفÀ׃ !ل?t6D$pP獴$ƔЋD$L$$$İÍ$1贏|$L$4IL$<$|L$h $L$<эt$$_L$,L$8$$DL$8uJ|$t$l/獴$!"D$(4DŽ$DŽ$İDŽ$DŽ$İ1L$|$݉DŽ$DŽ$İue ;aDB JR\$H+D$<$L$D$D$ D$L$T$HZj9tD$LD$PDÉ $l$D$袳D$ tӋL$HQT$8Y\$ |$$1L$Hq |$$ʒ  $>5D$L$ H e L$8xt$$葒x5e 胒L$D$L$`IL$$D$TD$D$XD$D$\D$ ;@D$(L$,t $D$ħD$ L$ d e N d 6$D$çD$ L$ d e  d D$D$çD$ L$ d e d i$D$H]çD$ L$ hd e vld `$D$%çD$ L$ d e .d $D$§D$ L$ (d e ,d K$D$#§D$L$ 8d e  p^=Ld ,p=d p=d p=,d o6=d o=Td o=$$$$$$L$tL$T$D$ D$D$k$ $L$tL$ CںL$D$ D$$5`L$$$$$$$$$$$$$$ $$$L$k$($)獴$L!$$$K$H$9$$$$-e k4<W$K`$$L$$PT$%D$ $H9i k4$$t̍$1KH$9$e $<*u1$J$$$ ؋$$ $U$|$$D$ H$ $렍-U,$T$D$\$ L$T$D$\$HG$$$[U$|$$D$GU$$l$D$T$ L$g\$D$T$H$Ջ$$uQP$ҋD$t$ҋ$$n$$4$$8`$$\$$4l$~D$ A$$,$$0`$$\$$,l$D$ t5$$$ É͉֋$$$$H`$$ыD$L$$$1D$$$$$$$$$$$$$獴$5HR$$$H$H$9u$ $-e k4<u$GЋ$$$U$|$$D$E$$뵍U$$ l$D$T$ L$\$D$T$H$R$HP$$ыD$$@($ $ЋD$L$*11$$$$$$ $ $H$$LT$p$P|$$H\$ŢD$ L$ $D$$L$lQ$9/$-e k4<$;E$$ $l$p$ $T$lډË$$$$9}$k4$$D$$$$$ $$$$$$$U$|$$D$A$$$U$$l$L$\$ T$pD$L$\$QL$l$$9l$p9$1#?)݉ۇ$!달$ $$\$T$$$$uCL$@L$j$\$YCL$jL$lQ$9t$-e k4<u$\C$$$U$|$$\D$B@$$$U$$l$L$\$ T$D$L$\$QL$lV$T$l$7$<D$l$@$D | $$<L$D$L$ $L$$$hD$l$l$$p\軡 贠 譠 覠 蟠 $e ;a&l|$|1=L$tD$pP 1 4͋L$t4$|$8qA|$t$8dAL$$9L$ $}lAދ\$t9||"9k4ƍ|$|AƄ$lÃva|$|@Ƅ$lÍ|$|5@Ƅ$lÍ|$|5@Ƅ$lÉ,$qމ,$pd ] V #e ;a40d $9vD$8D$,L$=*!u.D$09wx)ȋ\$4)ˉ!ˋ|$,t$‰D$8ÀSu=tD$8D$8ÀktstD$8Å~ D$8D$8q e ;avxD$L$9u_T$\$1E9}H4+9sL<*8؇ߖtVw߃ߖ8؇ߖuT$D$ÍVvD$D$D$ؙ le ;avRD$L$9u9T$\$1E9}"4+9s&<*ߖ8؇ߖtD$D$D$^ e ;aD$$L$L$ T$D$ 2D$t9|YL$9wQP9wJ\$\$ D$$)щ!ʍ L$(D$,ËD$D$ D$D$$D$(D$,覙 Je ;a$D$,L$(щ؅L$D$ $D$ T$D$ 2D$|gL$9wP9wx)щ!ʋL$ʋl$49u\$T$ $L$0L$D$ZD$ uT$ \$l$4hD$8$ËL$D$11D$8$D$8$蟘 e ;aHD$$D$(L$Xd  d e D$\d L$$D$(T$$^Z݃ uˀʼnT$DŽ$8DŽ$<$@$$D(Íx$&뱉%W׉É%k 辺M.B9wE$D$gD$ D$ D$L$u-fNau#QNu \$,‹D$hu+Infu  ՃuЋ-InfuƸ h빉$$$5tvL$4$1%$$L$4$$$L$h$ u $D$7$L$D$ D$tL$T$DŽ$8DŽ$<$@$D(11HW.V?Ѝ '9Uߋ]ts\u09uU]Uu щډRqSu,`&9u)]u$T$L$D$h\$,ӻ륉$\$D$ _L$ T$D$h\$,߻QЉJ#$8D$p$<DŽ$@DŽ$D(ÅtR@uGA=. =;9u|tkP+$8$<DŽ$@DŽ$D(É$$0$$D$l\$ L$뤸辺=.uB9uIt 11s$D$gD$ D$ D$T$$,$09W붺=.=.1u`39k=?u '9ktV=qS``&9u:N$D$D$ UD$T$ $,$0$l$D$ D$T$ $,$0bj$l$D$ D$T$ $,$0$ g$0$0"$0HP$L$T$D$ )D$L$T$ \$(l$$$$$t1Xu$Hp i b e ;avWse vu誇 se |g(Rɬ=8$S`88/mse e ;av=Yu:D$t$HP$L$T$D$ D$É 몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$tD$D$(B ;뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$ˈ 뢍|$9;u#e ;av=Yu:D$t$HP$L$T$4D$ D$c \몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$D$D$(⇢ 뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$dk d뢍|$9;u#e ;avGYuDD$t.H$L$D$D$D$ D$ KD$D$$ 렍|$9;u#e ;avD$D$Xe ;avD$D$We ;avD$D$D$D$ YJe ;avD$D$oWe ;avD$D$Xe ;av\e vu  e ,4=$c }?+ze me ;av8ܥ$qd D$D$D$kD$ HD$L$e ;aDܥ$qd D$D$HD$D$ H$L$R D$L$ T$$$1T$D$D$ L$T$D$D$L$ D$L$$, D$ L$T$D$LL$PT$TD$XD$\D+&e ;av8`ݥ$ qd D$D$D$+D$ HD$L$e ;aD`ݥ$ qd D$D$HD$D$ H$L$D$L$ T$$$1T$D$D$ L$T$D$D$L$ D$L$$ D$ L$T$D$LL$PT$TD$XD$\D&e ;av8ݥ$ qd D$D$D$D$ HD$L$e ;aDݥ$ qd D$D$HD$D$ H$L$D$L$ T$$$1T$D$D$ L$T$D$XD$L$ D$L$$D$ L$T$D$LL$PT$TD$XD$\D&e ;av8 ݥ$qd D$D$D$D$ HD$L$Qe ;aD ݥ$qd D$D$HD$GD$ H$L$D$L$ T$$$1T$D$D$ L$T$D$D$L$ D$L$$lD$ L$T$D$LL$PT$TD$XD$\Dk&e ;aI0D$4$D$8D$tD$L$ T$\$l$tct]CD$ D$$D$ l$$R$D$D$ D$D$ D$D$<D$@0É뢉$L$D$D$ L$T$\$l$tct]CD$(D$,D$(l$,$D$!D$(D$D$ D$uD$<D$@0É$D$L$T$ D$L$D$e ;av~$D$(@D$D$ `& $D$ҏD$ L$L$D$ U$D$ D$D$D$ D$4_D$L$D$,L$0$fe ;av-$D$D$5D$ L$L$D$|e ;av6$D$D$D$D$LD$L$ L$ D$$#e ;avLD$$OD$L$T$ |$OW e uD$D$ De ;a\D$LD$PD$TD$X`$D$D$TɥD$D$(L$ L$8T$T$$\$`$ D$L$$L$LD$L$ T$2L$,T$@[$D$"1ɋT$$\$8l$(t$4FˉD$"t$,9L$4T$$\$Hl$(D$@ȋR[$ӋD$D$0L$L$DuflouD$(L$HT$$듋D$`$2 D$L$D$LD$PD$TD$XL$LD$PD$DD$TL$0L$XT$L$D$D$D$L$ $D$êD$L$ $L$ȻD$D$ ݮD$D$#  $襴|$D$0G e hL$D|$<T$#WT$`$L$D$D$L$ T$Ӧ$$ $D$D$D$ tD$D$DL$L$XT$\$T$`T$T$HT$D$D$TL$ L$@$\$P\$l$Xl$l$Dl$ bƢD$L$@ e u L$THxD$ȚD$P$Ĭ111@=d ‹$̦Ћ$ @$ve ;avD$,D$봦e ;avD$D$蹴e ;avD$D$艴e ;avD$0D$Ye ;avD$D$)e ;avD$D$e ;avD$$}ije ;aAD$ tAD$ $C`$ese |$uD$ |$ËD$ ʦ$0s|$Ge  |$ G, e GкG($rD$ `T$ J e EB}e $D$ HT{}e $D$ HX^}$ e L$ A\A}e $D$ H`$}$ e udL$ Ad }e $u;D$ Hh|e $uD$ Hl@pvT$ zlɦT$ zhuɦ뼋L$ ydgɦ땋T$ z`WɦiL$ y\Fɦ;T$ zX3ɦ T$ zT ɦzɦO(ύGкȦlȦ:de ;az\D$`$ cHL$D$ 0L$ T$!D$`$ SL$D$ 0L$ T$!D$`$ L$D$ 0L$ XT$Q!D$`$ L$D$ 0L$ T$!D$`$ L$D$ 0L$ T$ D$`$ лL$D$ 0L$ T$ D$`$ CL$D$ 0L$ HT$ D$`$ YL$D$ 0L$ `T$W D$`$ 6ʼL$D$ 0L$ hT$% D$`$ %L$D$ b;T$ _ ىL$D$`$ L$D$ 0L$  T$D$`$ L$D$ 0L$ (T$D$`$ L$D$ 0L$ 0T$TD$`$ ZL$D$ 0L$ 8T$"D$`$ TL$D$ 0L$ @T$D$`$ YL$D$ 0L$ HT$D$`$ 2L$D$ `&L$ TdT$D$`$ !L$D$ `&L$ XdT$ZD$`$ 7L$D$ `&L$ \dT$(D$`$ gGL$D$ 0L$ PT$D$`$ L$D$ 0L$ `T$D$`$ L$D$ 0L$ hT$D$`$ L$D$ 0L$ pT$`D$`$ $L$D$ 0L$ xT$.D$`$ "L$D$ 0L$ T$D$`$ dۻL$D$ b;T$ _ ىL$D$`$ h0L$D$ 0L$ T$D$`$ ,L$D$ `&L$ `dT$]D$`$ RL$D$ 0L$ T$+D$`$ <ۻL$D$ 0L$ T$D$`$ L$D$ 0L$ T$D$`$ wL$D$ 0L$ T$D$`$ ]0L$D$ 0L$ T$cD$`$ s0L$D$ 0L$ T$1D$`$ wL$D$ 0L$ ȘT$D$`$ PۻL$D$ 0L$ ИT$D$`$ 7L$D$ 0L$ ؘT$D$`$ ЊL$D$ 0L$ T$iD$`$ L$D$ 0L$ T$7D$`$ ŞL$D$ `&L$ ddT$D$`$ vL$D$ 0L$ T$D$`$ QL$D$ 0L$ T$D$`$ -ƻL$D$ `&L$ hdT$oD$`$ L$D$ b;T$ _ ىL$4D$`$ +L$D$ `&L$ ldT$D$`$ +PL$D$ `&L$ pdT$D$`$ vL$D$ `&L$ tdT$r$L$` $@T$D$ T$ D$jur$L$` $LڻT$D$T$ D$6D$`$ L$D$ 0L$ T$D$`$ `ڻL$D$ b;T$ _ ىL$D$`$ HL$D$ b;T$ _ ىL$D$`$ tL$D$ b;T$ _ ىL$SD$`$ L$D$ 0L$ T$!`ȡ$Cf|$X \O e x|$PD$TD$X@$L$PL$&?D$L$ D$ L$D$`$ ֞L$D$$eD$D$DD$HD$L@$L$DL$>D$L$ D$ L$D$`$ ^L$D$.D$`$ _L$D$ 0L$  T$D$`$ tڻL$D$ 0L$ (T$D$`$ ~L$D$ b;T$ _ ىL$$dD$D$8D$<D$@@$L$8L$=D$L$ D$ L$D$`$ qL$D$%0o$L$` $+T$D$T$ D$$dD$D$,D$0D$4@$L$,L$=D$L$ D$ L$D$`$ YL$D$$cD$D$ D$$D$(@$L$ L$x $D$QL$L$D$ D$L$T$L$DT$H<"e ;anT|$1^L$XL$0$d,L$ T$T$L$ L$XQT$0$;,L$ T$T$$L$(L$XQT$@$,L$ T$T$,L$0L$XQ$T$0$+L$T$ L$4T$8L$XQ4T$0$+L$ T$T$e vu e lWFµ=hJe +e ;aD$$L$L$šD$L$Q$D$D$T D$ L$Q$D$šD$L$Q$D$šD$L$Q $D$šD$L$Q($D$hšD$L$Q0$D$QšD$L$Q8$D$:šD$L$Q@$D$#šD$L$QH$D$ šD$L$QP$D$ġD$L$QX$D$D$ f D$ L$Qh$D$D$G D$ L$Qx$D$ġD$L$ $D$ġD$D$腃`e ;aD$HT$(r91Ʉ~HZ9iH Z 8RHZjp91Ʉ HZjp91ɄH$X j$r 91Ʉ}H,X(j,r(9G1Ʉ6H4X0j4r091ɄHګD$ L$49<L$$Q\$(9D$` Il$8lt$PVD$T$l$Xl$L$\$ zd zd \$L$ э$%D$D$4 ` $|%D$  c e L$PHT$TPe \$XX l$4ht$pe n\$(X|$,xE$訪D$(D$@D$,D$DD$D$HD$4d d e  d T$8L$<\$8k ùl$L$$\$ D$PPT$$T$@T$8|$ D$Ge uWD$ D$$GD$P $D$4L$P $T$TT$T$XT$T$ D$D$PD$dLËD$ {D$${111E=d Ég{D$0XߋD$(C{\$0{D$,3{*{sx ËD$X{{ŋD$4 {؉l$4$xD$PzȋL$Pzd zd tJIE1111x‹D$`zÉ=d D$`z\$`111 $D$ bAe ;a`LD$P $ID$TD$DL$XL$HT$PZ\$`$\$D\$(3D$ L$@T$8D$0D$P $,w$>"D$D$@$L$0L$D$0L$81 \$< ى‰L$e ;alʚ;L$tT$@D$<$ $$L$L$$T$ $|$XR[t$XG[L$(赲 6Ie ;avD$$_6e ;av\ D$D$H( ${D$H(L$$ WL$浣uD$@$D$落 Ð膽 -6e ;av>D$ H$u+@$D$ $D$ $AD$u߃Ã5e ;avS D$H( ${D$H(L$$ WL$ uD$@$蹼 Ð诼 V5e ;av@ D$$D$Ht" u É$D$$ 14e ;a||$@%R狴$R|$|$Yu;D$@L$T$DT$T$HT$ $ЋD$L$ L$LD$PK'멍|$9;u#e ;avFYuCD$@L$ T$HT$T$LT$ $ЋD$L$T$ T$PD$TL$X&롍|$9;u#e ;avV YuSD$$@L$(T$PT$T$TT$ $ЋD$L$T$\$l$ l$XD$\L$`T$d\$h S&둍|$$9;u#e ;av>Yu;D$@L$T$DT$T$HT$ $ЋD$L$ L$LD$P%멍|$9;u#e ;avNYuKD$ @ L$$T$LT$T$PT$T$TT$ T$XT$ $ЋD$L$L$\D$`k%뙍|$ 9;u#e ;avV YuSD$$@$L$(T$PT$T$TT$T$XT$ T$\T$T$`T$ $ЋD$L$L$dD$h $둍|$$9;u#e ;av. Yu+D$@(L$T$e D$;A$$$L$Pc L$L$@T$T$H@Tc -ۺl$D$$ЋD$ L$L$PT$HT$dT$@T$h$T$\$T$`$T$T$T$X|$l1ST$lD$PD$pΡ$D$L 0 $T$dT$=D$D$DL$ L$P$\$L\$-l$D$ 5D$L$D e L$PH0$L$\L$ЛD$D$DL$ L$P$\$L\$-,l$D$ D$L$D e L$PH0$D$TD$cD$D$DL$ L$P$T$LT$ \$D$ [D$L$D e L$PHD$LD$x$L$4$|$t$lD$$D$($D$,$D$0"D$8L$ce ;a`$YD$ e L$$H0QQI~P e uYHD$ @aT$T$T$T$$D$D$D$ D$D$ $@aD$(D$ D$,Íx‰Y뚍x0D$$G‰ȉ\e ;a`$iD$ e uvL$H0QQI~H e u=PD$ @aT$T$T$T$$@aD$ D$ D$$Íx붍x0D$w‰ȉx2e ;av^D$(H,HpPl$L$D$D$ D$L$L$P(\$ \$\$$\$ $ҋD$D$,D$D$0ke ;avD$H@D$L$ 6e ;av+L$ T$J e uD$BÍzD$ue ;av&L$e uD$A(Íy(D$*e ;av D$L$A,|e ;av+L$ T$J e uD$BÍzD$.e ;av+L$ T$J e uD$B Íz D$ee ;a`D$dH0L$4m$|D$4H@(ʚ;\$Ciʚ;ЉCD$dH .H$tA K e u C\$h`Í{\$8耾$D$$L$dQ Y$T$D$ D$L$L$0T$\$\$ l$l$(tRT$DD$PD$TD$XD$\D$dHL$ 0 $-D$ L$L$PD$TD$DD$XD$(D$\$D$"D$PD$D$ D$D$$$L$0L$L$L$L$ L$ D$@$e L$L$,ufD$$A,$ɻe L$u5T$,QX\$8e u KD$dK{(yXD$,čy,D$$ D$HD$L0D$HD$LD$H$D$D$'ơ$D$@š$D$<  $|$e uD$@D$D$L$ e u5L$HL$QIL$T$$袂D$ L$D$,L$0 ÍxD$P7}Be ;a(D$,D$$ PSL$D$,$L$0L$L$4L$L$8L$ 3$D$ce ;aN$D$D$ L$tkuPOSIuQXu D$Ãu Ct~CuQ.u D$À-t $D$D$D$ÍD$D$L$D$ rbb-e ;ae vup e "{~;U$D$'2ue L$K Tqd $D$D$,D$ D$  $D$ƺT$D$ PrD$$L$L$|T$D$ rD$$L$L$^T$D$ qD$$L$L$T$D$ qD$$L$L$žT$D$ qD$$L$L$T$D$ VqD$$L$L$pT$D$ $qD$$L$L$T$D$ pD$$L$L$oT$D$ pD$$L$L$T$D$ pD$$L$L$T$D$ \pD$$L$L$T$D$ *pD$$L$L$T$D$ oD$$L$L$T$D$ oD$$D$D$ WҺL$D$ oD$e uD$Pqd e Í=Pqd D$vߍ=Tqd v~^)e ;a")$D$)$D$  $D$D$L$ e L$H$D$L$A Ae A$D$L$AAe ,AD$A D$ A$$hD$L$A,A0e A($3D$L$A8A<e A4A@AHe kbQDfALANAPAXe ) QTA`e Q\Ahe UQdAlApAtAxA|ǁe m5ƁfǁƁƁƁǁ$D$L$ǁǁe $D$L$ǁǁe $D$L$ǁǁe uU$ED$L$ǁǁe uL$ Ír덹r뤍rZ|r 5frydUSr/y\@ryT -ryDbry4 r\y(ryqy D$qy$D$ qyqpxD$q*3Ze D$;A$$$tg4$(2$t,$$F@uÉ7u#tɉ$D$ $볉u$듉$D$^ $X=Ye ;a0D$gd$t$l$\$ T$$D$L$T$\$DSe uC|$,͉ƋD$<끍{f_O e ;avWD$$~HL$ 1 \$ ى‰L$T$AY)t$4$l$\$D$ D$@L$$9|Ne ;av D$@D$Ne ;avB$mD$L$ AAe uAÍyeWNe ;avB$ D$L$ A8A<e uA4Íy4~eMe ;aAlD$DD$HD$pHTL$0L$0$8D$ L$L$DD$HD$pH$L$L$DL$D$ D$D$p1>L$(T$ $L$D$L$ $$D$d$D$<$D$t$D$P$$13S0$$L$2ӠD$ L$$$0$$L$ӠD$ L$$$0$$L$ҠD$ L$$ $$0$$L$ҠD$ L$$($,$4H$L$ .L$D$ $T$D$D$躟D$DHD$LT$+9/L$DT$+$4P T$ $L$(D$ D$4$4Q`T$\$DT$d)!ݍ*\$L$|$ 0$l$\l$L$D$1D$@x\$tl$ t$lD$HT$DL$d9D$0T$4|$@L$hH$L$D$8D$D$D$,L$L$(T$ T$\1ۋl$Ll$D0$T$l$\$ t$T$\$D$,L$(l$Dt$H|$Lύ+D$,5|$L0$L$hL$t$\$ l$D$L$\$iL$(T$\t$0|$LD$`D$,C5\$4l$0T$hQl$LT$$D$ L$ll$zDD$,2"se ;a$D$#D$D$ ೹ $-|$G2e  |$ G$ e up[OG D$GD$٭D$ d e uL$HL$ L$ÍxD$<T$ +ՍO ω[OzDD${Fme D$;A0BD$xL$h $oպT$D$i5D$ D$|L$L$dT$h$IκT$D$;5D$ L$T$|$T$dT$D$L$ D$xD$D$D$tL$L$\$$谑D$$D$D$R!D$ L$T$\$tDB:$$L$X$R$1L$\Idl$l$Xl$\$ T$T$t$эt$$L$LL$`T$P$$L$`u獴$twApD$p\$lT$TDŽ$DŽ$0$X$$$D$D$.D$pL$XT$T\$l $T$u f $\$u e D$;A0BD$xL$h $oպT$D$ 3D$ D$|L$L$dT$h$IκT$D$2D$ L$T$|$T$dT$D$L$ D$xD$D$D$tL$L$\$$PD$$D$D$D$ L$T$\$tDB:$$L$T$R$19L$\Ihl$l$Tl$\$ T$T$t$эt$$L$LL$`T$P$$xL$`u獴$bItwApD$l\$pT$XDŽ$DŽ$0$`$$$D$D$D$lL$TT$X\$p $T$}s d $\$hs !e D$;ABD$hL$\ $oպT$D$0D$ D$lL$L$XT$\$IκT$D${0D$L$ T$l$T$XT$L$D$ D$hD$_D$L$$L$P$Rtx$16L$PIl\$T$,$эt$ $L$DL$TT$H|$x$L$Tut$xu\thAaD$d\$`T$LD$pD$t0D$ppD$tD$p$D$D$D$dL$PT$L\$`' $T$q b QD$DL$4|$,l$@t$$ST$<[\$(D$LD$P0D$LhD$PD$L$D$D$ֶD$4$ oպL$D$9D$D$0L$ L$HT$4$IκT$D$ D$L$ T$H$T$0T$L$D$ D$DD$D$L$T$8T$T$$T$T$@T$ T$,T$T$$$ $D$D$D$ 脒D$D$DL$L$XT$\$T$`T$T$HT$1D$D$TL$ L$@$\$P\$l$Xl$l$Dl$ bD$L$@ e u L$THxD$TD$P$Ĭ111@=d ‹$Ћ$ `$Ӥve ;av/e vu:R e 瓪e Ҥe ;aD$$L$L$D$L$Q$D$lD$L$Q$D$UD$L$Q$D$>D$L$Q $D$'D$L$Q($D$D$ZD$ L$Q,$D$D$L$4 $D$D$D$Ѥe ;aD$H\$k391ɄH S kp9W1ɄFHSkp91ɄHSkp91ɄH$S$k p 91ɄtxH(S(9ujH0S0k,p,9t;1Ʉt1H4S8[4@89t 1D$É$L$T$D$ 1݉,$t$T$L$ D$\$11렉,$t$T$L$ D$\$^1W,$t$T$jL$ D$\$1,$t$T$AL$ D$\$1,$t$T$L$ D$\$14$T$l$ L$ D$\$BϤe ;a10೹$艏|$Ge  u2|$G$ e o<G D$4$D$D$L$4 $D$D$L$4 $D$D$L$4 $D$D$ D$$D$(D$,L$L$ L$L$$L$L$(D$,D$$L$ L$D$D$ bD$D$80ÍO ύo<3u2Τe ;a ೹$)|$Ge  |$G$ e urG MGD$ӍD$ Йd e uL$HL$L$ ÍxD$6T$%ՍO ω zDMyBeͤe ;a ೹$|$Ge  g|$G$ e urG MGD$ÌD$ d e uL$HL$L$ ÍxD$&T$ՍO ωzDMygBṲe ;a$D$D$D$ ೹ $틠|$Ge  5Y|$ G$ e up:OG D$GD$虋D$ d e uL$HL$ L$ÍxD$T$ ՍO ω:OzDD${5YF-ˤe ;a$D$D$D$ ೹ $轊|$Ge  4|$ G$ e up-G D$GD$iD$ d e uL$HL$ L$ÍxD$T$ ՍO ω-zDD${4Fɤe D$;A BD$TL$H $oպT$D$D$D$DL$ L$XT$H$IκT$D$D$ L$T$X$T$DT$D$L$ D$TD$D$L$L$L$1B L$L $Ѝt$$D$D$D$<$L$D$L$HD$L ` $L$DL$6SD$L$ D$L$$HL$8 $ЮD$ D$,L$@ $$H$$ыD$D$4|$P1wԤD$$D$(fD$XD$4D$PfD$pD$D$ L$ $D$hD$D$We ;avSD$D$L$ $D$D$ u 1D$ËD$$D$D$RD$浤e ;aLD$T<p$D$0111l$(EʉËD$0l$T9L$(t$P<΋7l$(9u4$|$D$L$ 뫉T$$\$4t$,|$  $D$\$T$ ŠD$PXj9;ZX\l$ +e <хuD$,D$4L$$>D$,V̤D$80$L$T$\$ l$"D$L$T$|$8We u ʉy̤D$\LD$DD$H`&$L$LD$ L$L$DD$H T$D$BD$DD$D$ D$iD$L$D$ سe ;avD$tD$1観e ;av;D$D$D$D$$D$D$D$ D$Ne ;avID$$D$ D$跹 $D$D$ἠD$H@T$$L$(D$,ತe ;avjD$(t[D$$D$ D$? $D$D$Ià|$D$(GD$,Ge u D$$ËD$$ɤOze ;a60D$DD$8$D$WARNuhQfINuXQGu|ud L$@\$0ȉݍ50 R=warnEAf=in7Agt)̃lj $D$T$D$ ϟD$D$(L$8D$(L$8A $D$įT$D$ ΟD$ D$(L$8D$(L$8鑤De ;av=D$@v&$D$D$D$D$D$ D$ ܈c  茑e ;av=D$@v&$D$D$D$D$D$ D$ ܈  ,e ;avMD$@v6$D$ D$D$$D$D$(D$ D$,D$D$0D$蜇  輐e ;av?D$Hv'@$D$D$D$D$D$ D$ 誇1  Ze ;av?D$Hv'@$D$D$D$D$D$ D$ 誇  e ;avOD$Hv7@$D$ D$D$$D$D$(D$ D$,D$D$0D$ja  芏e ;av?D$Hv'@$D$D$D$D$D$ D$ z  *e ;av?D$Hv'@$D$D$D$D$D$ D$ z  ʎe ;avOD$Hv7@$D$ D$D$$D$D$(D$ D$,D$D$0D$:1  Ze ;av?D$Hv'@ $D$D$D$D$D$ D$   e ;av?D$Hv'@ $D$D$D$D$D$ D$ 蚆q  蚍e ;avOD$Hv7@ $D$ D$D$$D$D$(D$ D$,D$D$0D$誅  *e ;avD$@ L$9D$ e ;avv0e vu  0e ƥ gbD$ $ ؇d e u܇d 0e Í=܇d ꣤cne ;av81L$ D$ T$‰$L$ϟL$D$ @|ۉL$e ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$?֟D$ uD$ D$ oze ;az>e vu  >e {蝻/Ӳ记h|$D$D$ L$ (d e ,d w%$D$kD$L$ 0d e  4d $kJD$ d c e ubHsd $8JD$ d e  c uPsd >e Íx蜡=sd 菡ڍx‰聡=sd t댍=4d eG=,d Uˉfe ;avZ(B$D$,D$D$0D$D$4D$ D$8D$D$L$T$\$ l$$D$&e vu &e `=&e pe ;avYD$$L$L$װD$L$Q$D$萳D$L$ $D$D$1D$ D$oe ;aD$HT$(r9tX1ɄtNJ Zh p9t1Ʉt@J8D$1$L$l$̹L$ D$T$1$l$t$L$ D$T$nPe ;av:1L$"D$ k\$ډ$L$zL$D$ @|ىL$ne ;aOD$ L$$1B-T$k\$, l$4|l 9t^ttD$(Ëlt |\ 9t؉,$|$t$艷\$ D$ L$$T$lt 8؇ޕt댋l t t$| t9t j<$D$D$t$rl$ D$ L$$T$\$94$D$D$|$Al$ D$ L$$T$\$D$(me ;avae $msd $D$ D$D$$D$mD$D$L$ L$e $qD$D$(D$D$,le ;avIe $sd $D$D$WpD$D$ e $D$ D$0le ;avIe $}sd $pD$D$ e $蕴D$ D$ke ;a08e v0u 8e zåc=|$趈t$諈AD$L$ $D$hD$ L$ $D$ie L$u sd 8e 0Í=sd tj8e ;a  E$*D$D$  $*|$G e uR l6 O e u!D$G GJ$|$ ÍO ω‹D$Ѝl6豁*jEe ;aOxš$)D$ e  $P " $D$4D$D$ D$K$Q|$H1  $$L$L$HL$E111D$H$GD$$L$8T$ T$ \$H\$Lkr9.L$8t$ D$$4щe Tu*륉׉z뚉l$<\$(@]$L$T$D$ t$B=L$D$T$p\$(l$<ЋT$ 덉D$4L$D$D$D$0  $m(|$D$ GD$4Ge u%D$DD$0Gp$$xËD$D֋ćd D$@ d L$,`$'D$L$, e uL$@H P$$xÍxD$@^19x‹$Bge ;aD$H L$ $D$HX9siڋjtVl$T$SÉЃt1҉SL$ $L$L$(L$L$,D$0D$4D$8  fHe ;avM'e vu 'e LW׾B='e fe ;aD$$D$$D$ D$2D$D$$ @ ЌYHf.vf.vuD$$X \HYXD$YWf.vD$(D$, $0D$L$ D$(L$,D$(ʚ;D$,ee ;av/2e vu 2e ܊2e *ee ;avFYuCD$t-H$L$D$D$cD$L$ L$ D$$ d롍|$9;u#e ;av.|e $D$D$mD$ D$kde ;av^ $譒D$D$ ,de ;avZ D$D$$嶥D$D$$ WL$guD$@D$ Ð ce ;aTD$`T$d!˄tmš$A#D$ 0 e u5 HH$D$D$D$pD$tTÍxHze $$3D$D$ L$L$$-$D$<4|$@&c$  $D$D$5D$ D$8L$L$,T$T$($`"|$D$lG e lL$hT$XWe .T$\W T$e ;av1 d $D$$D$D$D$D$q ^e ;avI6$uÍd $]D$$D$D$D$D$D$D$ P^e ;adD$$D$( e &L$H(x,e A$D$`$T$ T$\$$\$ ^|$e D$(D$H L$ ` $L$,L$T$0T$ \D$L$t@ IT$ T$T$$T$ T$ T$(T$$ыD$$ƱËD$H$L$ ` $L$,L$T$0T$ Y\D$L$t 놋D$HL$  $L$,L$T$0T$ \D$L$ t ȍ AD$H(L$  $L$,L$T$0T$ [D$L$ t ȍ `D$H,L$  $L$,L$T$0T$ [D$L$ t ȍ `$D$L$,L$0H D$(psAdsx(D$QsȋL$[|e ;a=D$$良D$( e L$H A,D$$T$ T$\$$\$ \|$e D$(D$H L$ ` $L$,L$T$0T$ VZD$L$t@ IT$ T$T$$T$T$ T$(T$$ыD$$KËD$H$L$ ` $L$,L$T$0T$ YD$L$t 놋D$HL$  $L$,L$T$0T$ YD$L$ t ȍ AD$H(L$  $L$,L$T$0T$ YYD$L$ t ȍ `D$H,L$  $L$,L$T$0T$ YD$L$ t ȍ `$zD$L$,L$0H D$(pAx D$pXYe ;aD$$)D$H L$ ` $L$ L$T$$T$ PXD$L$t I $ыD$$gËD$H$L$ ` $L$ L$T$$T$ WD$L$t 먋D$HL$  $L$ L$T$$T$ WD$L$ t ȍ cD$H(L$  $L$ L$T$$T$ uWD$L$ t ȍ `D$H,L$  $L$ L$T$$T$ 0WD$L$ t ȍ `$D$L$ L$$H W@e ;a D$$H L$ ` $L$(L$T$,T$ VD$L$tS D$L$$L$D$D$L$ T$u ËI$ыD$@L$ $D$$H$L$ ` $L$(L$T$,T$ VD$L$t pD$$HL$  $L$(L$T$,T$ UD$L$t -D$$H(L$  $L$(L$T$,T$ UD$L$t `D$$@,D$$D$(D$L$,L$ JUD$L$t `$D$L$(L$,H }Ue ;alD$p$yD$pH L$ ` $T$tT$\$x\$ TD$L$_ L$$D$4$L$D$D$L$T$ L$0T$ B $ЋD$D$@&|$X:r$D$|H|$O e |$A$L$hD$P$$|$8$l$(߉֋$\$$t$0t$P9pL$T9ËL$X9͇Ç!ݕM|$\JL$  $D$t$ @D$L$D$TL$XT$0\$\$$|$8D$TL$XD$hHL$P9D$XL$TD$XT$#L$T|$8\$,$$$<$D$TL$X!D$# ȈD$#1AD$#T$,9L$L$T$|Zj [,$ӋD$L$LT$49$,E5e uJE,t$|ЋV vuUo7j -e urlz‰WY}|W믋$$ L$4$L$8$$ËL$\Q\$09<$$T$,\$0|5e  D@$D$$ P $ED$ e $HL$4Q\$89T$T$4\$8t$T|e \$Xu"DًT$0\$,|$8$hVۉ$$$l$L$\$ T$*l$D$\$P$L$4hx$ V:U$?$$l$L$\$ T$l$D$\$P$L$\ȋL$T$1ҋ|$8$D$XL$T$1ҋ|$8$1螹 藺 =[e D$;A $$!م ل ^ ^ L$$D$($$2$HL$  $$L$$L$ `D$z&e ;ab$D$($;D$BD$($BD$%D$(H,L$ PT$X \$i,l$-,$T$\$ ?%D$tD$L$$D$D$ۅD$ L$ $D$AD$D$0+e ;a|D$D$L$ $D$:D$ AD$\$91Ʉ91Ʉ9t[1ɄtQ9u=9t 1D$É$L$T$FD$ 11ى4$T$l$9L$ D$\$1넉$L$l$FL$ D$\$<15$L$l$_FL$ D$\$D$\$1de ;avaD$$L$L$D$σD$ L$Q$D$(sB s't uuD$ À ÇD$ Td }e ;ade vug e R-蘌S $D$D$ED$ D$  $D$KT$D$ D$ $L$L$KT$D$ jD$ $L$L$T$D$ ;D$ $L$L$T$D$  D$ $L$L$]T$D$ D$ $L$L$LT$D$ D$ $L$L$:T$D$ D$ $L$L$ʺT$D$ PD$ $L$L$T$D$ !D$ $L$L$T$D$ D$ $L$L$<T$D$ D$ $L$L$'̺T$D$ D$ $L$L$T$D$ eD$ $L$L$nûT$D$ 6D$ $L$L$PT$D$ D$ $L$L$T$D$ D$ $L$L$T$D$ D$ $L$L$T$D$ zD$ $L$L$.T$D$ KD$ $L$L$ƝT$D$ D$ $D$D$ ЉL$D$ D$e uD$ sd e Í= sd D$x|e ;a @޲$虣D$D$@(@,@0L$H4 e uwL$H8Be $uND$H)e $u#D$H$D$D$D$ ËT$zҋT$z멍x8D$e ;a1pD$t@@H0@0H(P 9@(H@P(L$8 !Љƒٽ !پ ! T$@9Ët$<9ƇÇ!9Ç fL$0Y|$49\$0)Ƌ\$, D$0!΀Έ  ȉt$<$r8sd @L$$)D$)ȋ $9s*4|$,YD$@D$@D$@I I ͣe ;a5(D$<D$@D$DD$HD$L$QD$D$L$,Q(T$L$ $OT$L`5$D$ e e tL$HT$,B($D$0D$D$4D$D$8D$ vD$L$ D$,H@HD+HLkƀ11Ʌt*D$<D$@D$DL$HD$LS(ËD$HPD$ʃX89 9ӇÇ!9 u=H@Ëd d D$XD$\D$`D$dD$hL$lD$p>@D$XD$\\$`T$dL$h\>@Ë d d D$XD$\\$H\$`D$dD$PD$hT$lL$p>@3 3 3 $T$'D$K d3 ]3 膶!e ;aY$b$D$L$4T$01111D$|$ʋL$4T$z !ӋtiuŋL$,tUT$(Z+Z 9t/D$ HL$$ID$ @t$)Ƌl$D$뀋d d L$Yu;D$t%@ $D$[D$L$ D$L$ 軝멍|$9;u#e ;av7 Yu4D$t$D$L$L$D$ Y R밍|$9;uĉ#e ;av+D$$D$D$D$%D$ D$e ;av,D$D$D$$D$ڞD$ D$譜e ;av;1L$#D$ \$$L$L$D$ @=|؉L$Ne ;aD$ L$$1B=T$\$l4t$|49tt'ul\ 8ؕtD$(Ël tt$| t9t뿉4$D$D$|$ٞl$ D$ L$$T$\$둉4$D$D$l$]ٞl$ D$ L$$T$\$UD$(2e ;a$ $sd D$D$(D$臋D$ L$Pt D$,T$0$D$D$  3$D$(D$S2D$L$ D$L$ z$$D$D$D$D$ D$D$L$D$,L$0$L'e ;av{$D$D$ `@$D$(D$1D$L$ D$L$ ܻ$D$D$D$D$ D$D$L$D$,L$0$讙ie ;aoHL$TtIL$|$01ᱣ 3 $L$LL$1L$T$ L$0T$4 `@ $L$PL$0L$ T$T$8L$$D$%D$\D$D$ D$D$D$HL$L$$$T>D$L$$H e u`L$H p$J e u6BP$D$D$ L$$$ĔÍz聕ÉNjD$HtDŽ$DŽ$ĔÍy $D>}e ;avD$@D$}e ;avAD$ tHP@ D$T$L$Í0$D$ (}e ;a,L$<L$0pL$ύt$4RL$6=L$D ȍd ̍d 1111ȕ9U)˅9L$Yqe u%A 0HD$LL$PD$TD$X,Íy ˓D$D$D$D$sD$D$!$D$D$D$L$ D$LD$PD$TL$X,D$LD$PL$TT$X,ËD$HpۇT$@2I*1҉Ɖ؉11\$DD$@t$Hٲ$Q;L$yD$ D$$D$(D$ _D$$D$($D$ D$0D$L$ D$LD$PD$TL$X, ze ;avd,D$0$D$4D$D$8D$D$/T$\$D$4L$Hl$8t$0|$,A|$@ËD$<r؋\$<|$8D$0L$, 3 $t$D$l$ \$.l$t$D$0L$,T$H\$4|$8_)tBHZLkrP9kjL ͈L͉L͈LD$eJHZLkrP9kjLD$!3$L$\$t$ l$.D$L$T$\$HSPe uCHڋ|$@ˉD$!럋|$@pL$$ 3 $D$\$t$ l$-D$L$T$\$HSPe uCHڋ|$@ˋL$$|$@pZT0d 4d D$hL$lDÄ1D$#3$\$t$l$ L$,-D$L$T$\$HSPe uCHڋ|$@ΉD$#N|$@ooL$(D$"3$\$D$l$ D$ ,\$D$l$p D$"L$(T$H r`1Y1T$HZT̆d Ȇd L$hD$lD1Ԡ Ԡ We ;av(D$uD$t1D$ L$ 1qWe ;aPD$`|D$hD$0D$4 `& $D$D$L$ D$0L$4I$D$*D$0D$D$ D$D$L$D$DD$HD$LD$DD$HL$L$D$DD$D$ L$D$pD$tL$xD$|PËD$dHL$(PT$$X\$ (l$5ѳ4$|$|$,t$XsD$d@L$,AD$$T$ ‹D$( ЋT$ ‰ЁQ 9AHD$pL$tD$xD$|PD$8D$<D$@D$8D$fL$pL$(L$tL$DL$x$D$pD$D$(~dD$DH+H u@@ @P@PQsX h)݋p9`LM9EHD$D14hjB D$|DŽ$DŽ$D$PD$T$D$|D$#˞D$ L$L$PD$T$D$DD$ nL$D$ L$PL$D$D$×yu0I9$PuPH9m$}.{l 0H9Y$QD$T$8D$0D$|L$x $D$eD$t T$8D$xL$|D$ $D$D$dD$ $$L$DD$H$D$DD$fžD$ L$T$8 e uBz=T$$|$`t$xCš$D$D$,  $T$`T$＞D$ L$T$, e u:BD$$@l  $D$T$D$ D$zE=.%e ;av%e ;a td H\$D$DvD$ L$ hd e  ld ($D$wD$ L$ 1e rޞ$D$$fD$"  $D$T$"T$|$ Ge ] cfD$"$L$$L$T$"T$t|$ G e  5+fD$"$L$$L$T$"T$.|$ Ge \fD$"$L$$L$T$"T$|$ Ge [»fD$"$L$$L$T$"T$|$ Ge _fD$"$D$$D$L$"L$\|$ Ge dֻD$$(sd nռ$D$ tD$ L$ Hd e LLd $D$!ctD$ L$ Pd e Td :$D$+tD$ L$ d e $d ǻ$D$sD$ L$ d e td :$D$sD$ L$ d e ,d ߽$D$1sD$ L$ 8d e oD$L$ d e  d 6k$D$(koD$L$ d e uu d $D$D$D$  $D$[D$L$ Іd e u Ԇd 8e <Í=Ԇd #=d #낍=d #<=d #=\d n#=,d \#^=d J#=d 8#=d &#=d #6= d #=d "=d "Z=d "=Dd "=|d "= sd "8=0sd "=$sd z"=,sd h"=Ćd X"Z=Yu;D$t%H$L$[HD$L$ D$L$` ޢ멍|$9;u#e ;av>Yu;D$t%H$L$HD$L$ D$L$R` Kޢ멍|$9;u#e ;av>Yu;D$t%H$L$HD$L$ D$L$_ ݢ멍|$9;u#e ;av>Yu;D$t%H$L$[FD$L$ D$L$r_ kݢ멍|$9;u#e ;avQ D$$$D$(D$FD$@e D$ ŝD$D$,D$ȫD$L$D$0L$4 ܢe ;avOD$@ FL$ @e L$L$ $ЋD$L$ ŝ9uD$ D$$øzܢe ;av4?e vu[ ?e ̫觀3?e %ܢe ;av: D$$L$L$D$L$ $D$D$D$ ۢe ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$&D$ 1݉$L$l$%L$ D$\$6ۢqe ;av D$D$ ۢe ;avڢe ;av D$D$ڢe ;avڢe ;av D$D$mڢe ;avHڢe ;av D$D$ڢe ;av٢e ;av D$D$٢e ;av٢e ;av D$D$}٢e ;avX٢e ;av D$D$-٢e ;av٢e ;av D$D$آe ;avآe ;av D$D$آe ;avhآe ;avYD$@ GL$ @e L$L$ $ЋD$ L$9uQID$ T$$L$(111עe ;avYD$@ GL$ @e L$L$ $ЋD$ L$9uQID$ T$$L$(111pעe ;av9Ce vuV Ce ǫ{+Ce עe ;avJD$$L$L$D$O_D$ L$ $D$D$0_D$ D$֢e ;av{D$T$8ueHZjp99!˄tEH Xj r99!˄t%HZ9t@J8D$ 1111բie ;av: D$$L$L$D$L$ $D$pD$D$ բe ;avsD$H\$k39t;1Ʉt1H @S [9t 1D$É$L$T$D$ 1݉$L$l$L$ D$\$բqe ;avBD$$L$L$D$L$ $D$D$8]D$ D$Ԣe ;avWD$HT$Z*09t1Ʉt@J8D$1,$t$\$FL$ D$T$2Ԣe ;aD$$L$L$D${\D$ L$Q$D$D$\\D$ L$Q$D$D$L$Q$D$nD$L$Q$D$WD$L$ $D$pD$D$oӢ:e ;a"D$T$8JX9H Xj r91ɄJXhr9tt1ɄtjJZhp9t;1Ʉt1H$@ Z$R 9t 1D$É$D$\$D$ 1݉$L$t$DL$ D$T$1뤉4$L$\$!L$ D$T$l1e4$\$l$HL$ D$T$)1"1#Ңe ;avJD$$L$L$D$_ZD$ L$ $D$D$@ZD$ D$Ѣe ;av&D$T$8uJ@9D$ 1cѢe ;aD$$L$L$D$YD$ L$Q$D$D$L$Q $D$D$L$Q$D$D$L$ $D$D$D$ТYe ;a D$T$8HXjr91ɄJZ h p9tt1ɄtjJZhp9t;1Ʉt1HZ R@ 9t 1D$É$L$\$ D$ 1݉$L$l$L$ D$T$1뤉$L$t$L$ D$T$l1e4$\$l$ L$ D$T$)1"Ϣe ;arDD$H `9SD$L5D$($D$(L$ ‰L$0%115e yAtct]JD$<D$@L$$D$1T$D$ D$D$@D$D4Íz΢븍$wD$<T$T$$ B $ $ve L$T$$JL$,e l$99M )!Ǎ;~EPZ[$$\$l$+D$D$ t$L$bL$T$D$*L놸QDŽ$DŽ$ĘÉD$4tIL$@š$oD$L$@ e u6L$4H p $D$LD$D$ D$jxD$4.Ǣ뿋l, e, 莯ie ;aD$ HT$$\$ %$L$䟞D$ L$HD$HL$%$nD$  e L$$H|$OWe AGD$HuH@L$ IQRe uVBPe Yu3XIe uAD$(D$,ÍyŢx‰ŢzŢxÉŢ똍yŢŢR e u G>ŢŢ-xD$$pŢD$(D$,ЭKe ;avlD$ t;L$IIPXT$\$ $D$yAD$L$L$$D$(ËL$Q$Xh\$l$$D$ =xe ;aD$ P ыD$H\$ +l$- %,$L$艝D$ L$D$ HucD$uH(t @tFtD$$D$(Í$d D$FD$ L$L$$D$(1븋L$QR@D$$\$ZD$L$ nL$$D$(ÉD$D$HT$ \$ %$L$D$Hte Xu`YHte Xu9Y e u@@x1*ây"âyâ뺍yâxCe ;avSD$P,uD$D$ ËD$$ЋD$ L$\$u D$H(lj\$D$ e ;a,D$4H cfpDohu[9uQD$0u@(@t8t11ɉL$ץe ;arDL$P\$Hl$L1@9@D$ tlm6ffuыs k 9sNjKL$|$1н % $T$T$T$T$ D$$`L$L$Hu@L$HQZ[-e uDCXe ju!hRe uB됍zD농xÉ6ҍ{*xʼn몋D$ L$PT$L\$Hc C $l$ЋD$ L$PT$L\$HD$XD$\DCne ;a]XL$\Y Y+m[91aXk59D$P]u }-‹Et$(@|$Ty +z 9D$8l$D\$0q9st$4B@ 4$ыD$8L$DY:\$4l$(9#D$,q &t$09D$\hm9|$,$T$T$TT$ \$t$'D$L$oL$4T$(9D$PH \$\)K)ʋl$0)͉ۇ!l$Tl$,l$DU ue MM u+Mu$xte IbH IQ -@9,K +H  @D$`D$dD$hXËKQRe uDBPe Yu!XIe uA먍y랍x‰ҍzxÉ븢몉T$LJj rzRT$$D$L$|$ t$l$D$ L$u8D$L@ D$D$\$D$ L$ D$`L$dD$hXD$`L$dD$hXú@ e u G1$u‰]}‰ l$DUue uM}‰ҷD$`D$dL$hXÈT$'ЋD$,L$DT$'\$4l$( q11\$4l$(hBD$`D$dD$hXþ@$]E}D$ c 9$q111ۋ$Urm9fjPTR$\$t$L$ D$L$$$D$`$HT $jD$L$t&DŽ$$$Ë$D$$ SI$7D$ g e L$0HT$ P\$$7D$D$  e L$HI$7D$ @g e u?L$0HL$ HT$BY<e u Q@L$@,Íy@ҎxD$0ŽyD$ 趎T$zÉ覎먍xD$薎^xD$0胎yD$ w|$l{]{‰L{ D$@zD$8-'xD$0y‹D$ xLÉщT$ zH鍢‰ՍHx0‰z8D$趍zPD$ 認x É藍xD$(肍D$$rl$D$\$P1L$H8  fteu 8 t1, $(D$t$ۧD$ t&$$$l$Dt$X$륋$$$l$Dt$X$뎃  tz u $AD$t$WD$ t)$$$l$Dt$X$$$$l$Dt$X$ $3D$t$榝D$ t)$$$l$Dt$X$t$X $$$l$D$ $t$(D$D$ D$)$$$l$Dt$X$$$$l$Dt$X$j tz $D$t$ץD$ t)$$$l$Dt$X$$$$l$Dt$X$ $D$t$fD$ t)$$$l$Dt$X$-$$$l$Dt$X$ $ATD$t$D$ t)$$$l$Dt$X$$$$l$Dt$X$ $t$wCD$D$ ,D$L$X t)$$$l$Dt$X$@$$wCT$L$D$ t)$$$l$Dt$X$L$X낋$$kCT$L$ƣD$ t)$$$l$Dt$X$L$X %$$$l$Dt$X$[ $t$AD$D$ D$)$$$l$Dt$X$t$X $$$l$D$$$AT$`9}A$X $X$ST$4$$1D$D$P$`T$H$`|$LT$H$1|  $l$$l$?L$LT$H$`3$`T$HL$L$$ABD$LL$H$`Ӊʉ$$ut$Tm$x|$0$m:p1$Aދ|$0Éꋄ$͋L$L9E$$$L$ Q $$t$L$T$ aD$L$$`$1{$$\$T$$`$$$j$9r$Lt$Le u׍$$H$$T$$D$|$H\$T$$$LL$T$t$ l$6|$D$t$h1$$\$TH$D$$ ; $mfteu  t1$$ (L$t$蟟D$ t&$$$$Dt$T|$0랋$$$$Dt$T|$0뇃   j$$ AL$t$D$ t)$$$$Dt$T|$0 $$$$Dt$T|$0$$ 3L$t$蘞D$ t)$$$$Dt$T|$0t$T $$$$D|$0$$t$ (L$D$ ŜD$)$$$$Dt$T|$0$$$$Dt$T|$0| $$ L$t$wD$ t)$$$$Dt$T|$0s$$$$Dt$T|$0Y$$ L$t$D$ t)$$$$Dt$T|$0$$$$Dt$T|$0$$ ATL$t$臜D$ t)$$$$Dt$T|$0$$$$Dt$T|$0$$t$ wCL$D$ 跚D$D$T t)$$$$Dt$T|$0$ $wCT$D$覛D$ t)$$$$Dt$T|$0D$T낋$ $kCT$D$QD$ t)$$$$Dt$T|$0MD$T %$$$$Dt$T|$0;$$t$ AL$D$ uD$)$$$$Dt$T|$0t$T $$$$D|$0$|umȍ B9eY$@$$$<$1t  $$<L$$L$7$@$$3\$LT$H$`$$9$`L$HT$LӉʉ$~$u$x|$P$ml$,:u1%$A$ߋ\$Ll$,ʼnȉl$,9D$$$$8 ƋQ $$|$L$T$ CYD$L$$$|1?s$$|\$P$$$$$j$9r$8t$Le u׍$|w$4$$T$$|D$t$4\$P$$$8L$T$t$ l$Z.|$D$t$h1$$\$PH$$$0 9 $f=teu  t1$$ (L$|$OD$ t&$0$$l$,$|$P랋$0$$l$,$|$P뇃   j$$ AL$|$D$ t)$0$$l$,$|$P $0$$l$,$|$P$$ 3L$|$HD$ t)$0$$l$,$|$P|$P $0$$l$,$$$|$ (L$D$ uD$)$0$$l$,$|$P$0$$l$,$|$P| $$ L$|$'D$ t)$0$$l$,$|$Ps$0$$l$,$|$PY$$ L$|$诔D$ t)$0$$l$,$|$P$0$$l$,$|$P$$ ATL$|$7D$ t)$0$$l$,$|$P$0$$l$,$|$P$$|$ wCL$D$ gD$D$P t~t'$0$$l$,$$ $wCT$D$\D$ t)$0$$l$,$|$PD$P넋$ $kCT$D$D$ t)$0$$l$,$|$PSD$P '$0$$l$,$|$PA$$|$ AL$D$ +D$)$0$$l$,$|$P|$P $0$$l$,$$$$DŽ$DŽ$xÉىȾ$`|$LT$HL$`T$HL$LL $D$T$PD$L$ $\$x1l f$xDŽ$|$\$$L$HQ\$L9z$` | e u$xpщY$,$$$|$$xD$Xm1$$$,몍$$`l$L$\$ T$'l$D$\$P1L$HN$L$D$OD$L$ $\$1j NT$DŽ$ $\$$L$HQ\$L9z$` | e u$_oщ$($$$|$$D$4l1$$$(몍$$`l$L$\$ T$%l$D$\$P1L$HN獴$dnyD$L$$L$nD$ L$$\$1i wC$DŽ$ $\$$T$HZl$L9{$`<e u$#nЉى$$$$$|$$D$j1$$$$몍$$`L$T$l$ \$$t$D$l$X1 wCT$HG$ $$T$$D$oj1$ $\$|$|$\$l$ L$8$|$D$l$H1\$|hى $-HD$L$$`$1g UT$DŽ$$`$$L$HQ\$L9w$ | e u $|l$݉Ӊt$T$x\$t$|$$D$Ni1T$x\$t$뭍$$l$L$\$ T$#l$D$\$P1L$HQ$|$0D$h1$\$Hl$L$T$L$l$ \$"T$D$l$X1L$H$|C$l$p$|$$D$ch1$$|l$p$$T$\$l$ L$%"T$D$l$H1\$H$|l$l$T$$D$g1\$Hl$l$$L$T$l$ \$!|$D$l$X1 AT$H$$ D$D$\$ L$RL$\$1T$Hl$L$$|$$,D$'g1T$H$l$L$$\$L$l$ T$ t$D$l$P1L$H$6l$h$T$$@D$f1$l$h$t$T$l$ L$z t$D$l$H1T$H$H$l$d$|$$TD$1f1T$H$l$d$$L$\$l$ T$t$D$l$P1$|\$HP$|$D$e$\$HT$H-,$D$T$L$ \$D$L$T$YыT$Hc1'1DŽ$DŽ$DŽ$$$xDŽ$DŽ$DŽ$$$x~Je ;a0D$4@pVD$8H3L$,PZ9A)ډ!Ӎ1҄U 9T$$H X$L$ L$D$ ~3D$ugD$8H P @9$T$D$T$,T$ T$$T$D$L$OD$ L$L$)Ye ;a$$ 0IL$$L$PD$ L$^D$4$Q &A D$$sd D$ID$ L$iD$0D$<D$@$I L$ `@ $ D$ L$L$„H| $D$mU$Āu&@e ;ax`D$hH]@$D$D$(D$@D$DD$HD$4D$8D$<|$L1m>`gD$LD$(D$PL$4L$TT$dT$X\$@\$\\$h$\$L\$贴D$lD$(n$kD$DL$@|$T$HGWe 0D$(uKD$,D$0PgD$,D$4D$0D$d@X$D$,D$D$|$ _`É|$ H$D$ `g e L$(HL$dHT$8Zl$7$L$DыD$tL$4PI9L$`L$P ыD$t$L$PL$D$D$tHTI $/D$D$\L$T$\$ l$tp9 RL$(T$,D$l$^D$tL$ $ $T$(T$'D$ D$TL$l $aD$TD$ sd L$L$,L$D$tHTIQ\$ \$@RI $ҋD$D$XL$L$0$E؝D$L$@T$0Pe \$XX(11D$Hl$$  $םD$D$L  $םD$L$@L$0H e uTL$XHL$LD$t$T$TT$T$$T$T$HT$ D$D$L$D$D$ # xD$X/|$L.뜍-=1*xËD$X.؋\$X,$舞pùQ4hjb<9o$IH9/g yeI94hjPI9tutIL$hš$s֝D$L$h e u6L$\H 0 $D$:D$D$ D$FxD$\-뿉,$|$D$gɍPI\,$t$t4hjI,$D$DƸHPy0I9untYPuEPH9u2tɍIPIHt$\,$t$'DžɍPH뿉,$D$Ƹ닁P0I냁uwH9udtO.{u;0H9u(tɍPH0IV,$t$2хɍ0Hɉ,$D$ Ƹ땍H덍IPIHt$\L$8T$d\$eHP $D$sD$8$Y$PPT$4XI$ыD$D$@|$x1(D$D$ fDŽ$L$4L$xfDŽ$L$@$L$L$L$x $D$D$ uK1uu4D$,$簤D$tËD$,$D$r   de ;av D$ @I$ыD$D$e ;av D$@LD$e $p;Ay$Ν$T$T$h $=$T$T$d\$\$` $<$T$T$\\$\$X $<$T$T$T\$\$P( $<$T$T$L\$\$H0 $s<$T$T$D\$\$@ $L<$T$T$<\$\$8 $"D$ |1u} e ;a$D$,H9)ȉ!D$(ȃ1tlD$0$D$4D$D$D$ L$L$T$\$l$ $T$l$\$ D$L$L$8D$D$ L$t D$`DT$hL$l\Í$CD$ @$ e u/ 5)Htu11ɉL$hD$l\Í 1x5)ke ;aDD$HHy ` $ dud L$D$D$ HD$,L$0D$4D$8D$<D$@0$L$,L$D$ L$L$4D$8D$HH L$ `& $蓝D$ L$L$K=<$\$L$D$ D$D$L$D$LL$PDÉ׉ōK=뵍0$|$T$L$ \$\Ϡ|$D$L$XT$ _j9)te ׅu \(D$(\$$0$|$T$L$ l$Π|$D$L$hD$(T$ \$$딉‹D$(0$D$D$D$ D$Π|$D$L$G%e u8Pb8ge D$;A`$L$T$$  u:pat_Zhu6$$$J0 e u B,Íz,u =:stauBf=tuu Bs$$3:'t'$$ 1x$$ $D$$$L$D$ D$L$T$\$$tI$`$/D$$ 0 $$T$軐D$ L$$ e B0$$D$耐D$ L$$J e ucB $J e u;$B$D$-T$D$ D$)(Íz$뾍z 떍zQT$$\$`$$$u4U4T$$L$D$ D$HPj96JHLl$$) e <Ӆu D$`D$`Q$0$\$T$L$ l$ˠD$L$T$$We u ʉÉx D$@L$x&e $u$H4L$xŋD$@$z4 ܉$(D$L$4D$ F>$L$L$T$L$3D$ űL$L $D$P$  }KuAfteu  t1 $ (L$D$m3D$ u؃ t^ t& ulj $ AL$D$;3D$ u릉 $3T$D$3D$ tD$P $몉 $D$(T$D$ 1D$D$P$D$P$\K tft1 $ L$D$2D$  $T$D$Z2D$ D$P$량 $ATT$D$*2D$ D$P$g $D$wCT$D$ 0D$qD$P t5N$ $ wCL$D$1D$ $ $kCT$D$1D$ D$P 똋D$P$ $D$AT$D$ /D$D$P$D$P $l`&$ﲝD$$$$$L$ꎢD$L$ T$$tIDŽ$DŽ$$$$ ,D$D$$$D$ D$D$tD$L$$Bde u JhÍzh 틌$e uYy   tt$kCD$L$/D$ $$$L$D$L$ $J e uBDz7$AD$L$a/D$ $L$l$T$8n1Y Y+/Ѹm$ZTe FJP$$$\$X$l$(r4Z4\$$L$D$ LD$HPj9>JHLl$()<Ӌ e uD$X$@XD$X剄$0$\$T$L$ l$ĠD$L$T$$We u ʉÉpdD$DL$|蕺e $u$H4D$DL$|$$z4׍zP DŽ$DŽ$0$$D$燝D$ L$$$#$D$2$D$D$ D$`VD$L$$Jp e u BlÍzlb;111111 $D$D$,D$ L$lT$8h $D$T$,D$ t11mT$8L$l#L$T $Z$3D$L$/,D$ uL$T $&`&$孝D$$$$$L$D$L$ T$$ADŽ$DŽ$$$$ ,D$D$$$D$ D$D$oD$L$$J\ e u B`Íz`l$e uYy$L$޺D$D$ )D$L$T$AL$T$ t tc $ATD$L$*D$ l$$$J e uB z$wCD$L$)*D$ uL$T $n$@ $$ $T$D$L$T$\$ $U$](tIDŽ$DŽ$$$$ zD$D$!$D$ D$D$mD$L$$J\ e uB`z`>+ $D$L$(D$ $$ $D$xD$L$ T$\$l$CDŽ$DŽ$$$$ ؽD$D$0$D$ D$D$lD$L$$B\e u J`Íz`jD$4L$ T$d$㩝D$D$pL$d $L$ L$L$4L$ 0uL$ D$QD$L$t@DŽ$DŽ$$$$ ؽD$D$0$D$ D$D$kD$L$$B\e u J`Íz`D$p$al$ e T$uP x x$fD$L$&D$ uL$T$$$$L$JD$L$ T$\$l$CDŽ$DŽ$$$$ aD$D$'$D$ D$D$jD$L$$J\ e u B`Íz`zl$KHCL-e RSD$T$L$D$ ;$$T$T$,\$\$h$u4U4T$$L$D$ .D$HPj96JHLl$,) e <Ӆu D$hD$h$0$\$T$L$ l$pD$L$T$$We u ʉÉxND$Ye ;av{$D$D$ 0$D$(D$QD$L$ D$L$ c$D$D$D$D$ D$ D$L$D$ BHL$D$1$ Ӌ$PD$L$9|D$ 苣e ;a=DD$HL$L D$P0|$89D$ D$$D$(|$ t$8$tcD$L$$HL$HR\$Tk[ \$l$pK\$ D$ $҃DËD$P0|$,D$D$D$|$t$,)$bD$L$HL$HR\$Tk[ \$l$K\$ D$ $o踢e ;aT;e vTu! ;e  ȤҨ}TߒjF;!K.ɢ讠$J6{6&I$D$?D$ L$ d e d p$D$LHD$L$ d e c d $D$D$lD$ D$<  $D$D$6D$ $L$`D$xL$|$L$CD$D$ aD$L$T$\$l$ t$$D$,L$D$L$T e uBL$LH  $D$#D$D$ D$D$(L$XT$,1xD$L䕡볉낋D$|X hl$\$$L$T$ L$ D$脄D$L$ L$8|$\1脖T$\L$8L$`L$(Q\$,9]l$Xe k| ut$\Љl$HT$@\$<S$|$D$\D$T$@\$nie ;avne ;avme ;av#`G$-J$me ;av/Be vu Be Be jme ;av: D$$L$L$D$L$ $D$జD$D$ me ;aD$H\$k391ɄH Pk s9tt1ɄtjHPks9t;1Ʉt1KSX@9t 1D$É$L$\$D$ 1݉4$T$l$RL$ D$\$1뤉4$T$l$/L$ D$\$l1e4$T$l$L$ D$\$)ke ;aD$HT$$ыD$tiD$HT$$ыD$L$$L$#r$sd D$+|D$L$ e u L$HÍxD$0$(D$ 0$ D$ k e ;a.e vu  .e 轆x5e $u8 sd `5e $u sd .e Í=sd =sd 恡_jZe ;avP$@e D$Cje ;a ۫$D$$D$D$(D$9 D$D$L$ L$T$,\$3$D$BBc $۸D$T$肰D$D$HD$$D$L0Ë|$,1S}뼋D$4H}XAL$4L$L$8L$L$pBTB D$1L$$%D$HD$T$ 9} Zj 9rLÍJDŽ$DŽ$DŽ$T }@e ;alD$xT$t!م ˄t%DŽ$DŽ$DŽ$lËD$pH01)Ӊ\$D$t HT$$ыD$L$D$L$ËD$ Ћ$L$5e ;avCp$te D$sМD$ L$L$D$D$$D$ D$V5e ;avk$۩$ D$D$ $ \c Xc `c T$L$\$ L$(L$D$<L$,L$L$0L$D$ D$4$4ye ;av5D$$D$D$<MD$L$ L$D$ t4e ;av5D$$D$D$<D$L$ L$D$ $4e ;avV,|$X1{Lt$0SQ|$t$DFQL$(t|$Xt$0+Q,Í|$Xt$DQ,3e ;avV,|$X1 Lt$0P|$t$DPCޣL$(t|$Xt$0P,Í|$Xt$DP,C3e ;av4e vuj e c4Xe 2e ;avD$D$2e ;avD$D$2e ;avD$D$j2e ;av'D$D$D$4D$8D$<g"2e ;avD$D$D$D$1e ;av'D$D$D$D$D$1e ;avD$D$D$0D$4/j1e ;avD$D$D$D$_*1e ;av'D$D$D$D$D$w0e ;avD$D$0e ;avD$D$D$D$ z0e ;avL,YuI|$41HL$0t($gt$|$M|$4t${M, 0뛍|$09;u#e D$;A$9H|$t M $D$ hc lc pc PXe VH D$T Lsd : 0$D$L$6D$L$ T$|$TWGe `e $Lsd D$h$1nG `  $L$hL$$L$ $$ $IT$TZk2ϋJ9$KJL9<ދ e uE뤉D$L|$D0$t$\$L$ l$D$L$T$|$TWe u|$DˉƋD$LE`e $aD$THX$\$L$腿D$THҟ$L$L$D$L$T$ \$TCK e qSD$D$dKL$DT$`1oD$dL$DT$`\$T97l$4H$L$D$D$PL$TQ`&$T$T$0D$THP\$l$t$ |$49\le ,4HX YT$@L$<1 T$\Zʼn\$\l$0KL$8T$P$|$dt$tJD$D$8D$v D$THP\$ l$49L$@ƋTL$09lAL$<9|ÉC؉G$`e $`e D$$WD$虫,$D$X @ $$L$$L$1ɜD$L$ L$D$D$X$@ʞD$ D$TD$S+D$L$tKtID$lD$pL$lD$pm$D$(D$lD$D$ D$L)薲Ð色É $JD$ L$T$\$l$TU(5e ]$E,E8M4U0$$פD$D$tD$D$,L$ L$H*u#0u11ɅXL$TAtՃ봉 $D$PT$D$ \eD$D$,L$HD$,L$HR $D$OT$D$ eD$D$,L$HD$,L$HT$L$ D$$  PD$貧u2D$TH0L$  $eĜD$ L$ $D$6É$T$cD$L$TQ,lc -hc 9LTL$T$$|$dt$tD<D$$L$(T$ \$TC4K8e u S0l{0>}$Ɖ>B{>>1x ‰>٢ Ң ˢ &e ;aD$ $ ڤL$D$YD$D$L$ L$T$ $?T$D$+D$ L$T$u!D$$D$(D$,D$0Åtۉ$L$:¡D$L$ t!D$$D$(D$,D$0Å|ۋ lc 9}ыL$L$$L$L$(D$,D$0%e ;av< D$H$L$6D$$D$D$2D$$ }%e ;aD$$`e $Ay`e D$$WD$豤` $ Lsd L$L$L$T$ T$ .D$tD$$-Í@$D$D$ `  $ Lsd L$L$L$L$ L$ [5|$e uD$뜋D$;두«i$e ;a(D$,$9xD$,D$$ WL$諣D$,H PXl$01F9<9u9L$$))L$ !΍ 3E9wvh$L$T$D$ D$ D$$)!؉D$)ω|$T$B@D$,HI|!H轪(Ð質(Ð詪(   B#e ;a4D$XD$8$uD$8D$$ WL$su{|$|$0D$8HL$,@D$(1\$$SD$(L$,|$09}L$TL$\$X\$D$ tD$,$( D$`HT$d\$\9.HL$` e $D$(p4MD$D$\D$L$ D$,L$0$+e ;aNDD$HpU4D$D$0L$L$, $D$D$ʚ;D$ 6D$D$ L$L$T$,$T$0T$D$ʚ;D$ RD$D$(L$L$$T$$T$ T$.D$D$4D$$$D$(D$D$D$<D$@B$ @^L$4XL$D$ L$D$D$D$0L$ L$4T$T$@\$D$=D$L$1҄xD$PL$TL$@L$HL$4L$L|$X1B, 0 $T$PT$BL$T$ L$XT$\ 0 $T$HT$L$T$ L$`T$d `& $T$0T$L$ T$T$hL$lL$t $T$xT$I\$D$ l$Xl$D$D$yD$<$׉|$vE<$t$9|݉T$L$11\ we ;a D$$$KD$L$…!ڄt WD$( ÉD$L$D$$H$L$ؠD$D$D$$D$D$ؠD$L$^L$( Ue ;aD$$D$L$$L$'ؠD$Wf.u z L$ D$D$H$L$נD$D$HT$^^Y\L$  Xe ;av# D$$/D$QD$ e ;aTD$X$D$L$…!ӄ!ӄ\D$L$ $L$ נD$\YD$$E D$ L$T$XZ\$\$ދRT$99!ӄ[9!9 ӄtl$,)΋\$)$))L$L$T֠D$D$HD$$D$D$4֠D$L$H^ȋD$,11҉L$0L$@XuN11ۉT$4)ˉ$ЉD$ՠD$@YD$$% D$L$0ȋL$ D$dD$4ȉD$hTÉپxٽ ! ! ! L$0tHˉۉٿ ! ! ! M11҉T$(\$ 9߇Ç݋T$9!9 Օt9T$<\$PA9f,umÇޅÇ!uфuT11҉D$$) $L$(ʉT$ԠhYD$$D$L$$ȋL$ D$dD$(ȉD$hTÈL$Yۉٿ ! !t$ ! ݉g]ʉٽl$8ٽ !݀ ۉl$8!݀ ! ͉щD$dD$h TËD$X$D$$ӠD$ L$L$dD$hTD$dD$hT芃 胃 e ;av1D$$hD$D$ L$D$L$ Xe ;ae$L$,92D$0H P$ÅɇÇ!ݕl$(u t$ }$Ç!ƅ !؅ ؄E\$0s9tEC$K …ɇÇ!օ ֖ED$1@L$Ѝˉ:|$ R<t$ ӉXT$JT$t$0|$(Љ9}%Uu9΋z*C[9rEXCEE ESM‰U$ËUu{92΋J2J봍 '$D$&D$&؟D$ L$T$\$(SK e u:CKk$s 9srȉ0hCC C$\$0l$({뿋D$ M ׉}$\$0p\$0gËl$(Ӏ ̀ ŀ $@D$D$ǚ {e ;avZL$AAe u2AAA A$AWAÍy1Oe ;a@L$ 9 D$$H P$ƒ!ʄt2L$Qt]QYhp9~I9t$t$l$G#D$$H\$K@CHKH$@ C K$É볍 '$D$&D$&c֟D$L$T$ \$KCe u8SCk s$9s4‰*rCC C$D$$-{~ $@D$D$ܘ e ;a@D$H$P ÃÇ!HL$1m$D$(D$$D$D$ D$D$tJPX @9wH$)؉!ȉD$)ډT$l$ D$L$L$4D$8,ø 귺Hu qe ;av)0e $PD$ADsd D$  e D$;A|$1E|$<  $讷L$A e nAL$ 8c $D$D$QD$L$tGn$D$PD$[J$D$  PD$ZĘÉ$nD$L$(5D$ tyn^0$ȳD$袁 e ;avb$D$0t@D$  $ c L$4D$($D$,D$D$ D$D$4D$@D$L$L$8D$<$ge ;ac D$$$ D$L$L$D$HT$ $ыD$$:D$D$ 56D$ D$Pf@$D$D$D$ D$"D$ L$$L$D$$D$D$D$ =ËD$$D$ D$5D$D$ D$ @be ;ac D$$$ D$L$tmL$D$HT$ $ыD$$:D$D$ 56D$ D$DeD$$D$ D$D$$D$D$D$ ËD$$D$ D$5D$D$ D$?te D$;A |$l յ$D$ @sd e  HD$T$ H/$@e $F@sd  0 $D$D$ƟD$L$ T$|$TWGe  @sd L$`$1  $L$`L$$L$Ϝ$$sќ$QL$TYk1׋Q9$SQT:e <ޅux 뤉|$8D$L0$t$\$T$ l$@ǟD$L$T$|$TWe u|$8ˉƋD$LL$T @e $ED$TPX $T$\$D$TH$L$D$荽e L$ BD$TH  e $ED$ W e u @e HL$A D$ A = = = = < =  e ;av8D$t@L$ $D$D$D$D$ D$ D$ e ;a$i|$D$Ge u`L$L$$O L$(O e u,D$ GD$$D$|$fD$ ÍOω‹D$ נŋD$נOe ;av0D$ H$L$ $D$ @PD$$B詿e ;avOD$ H$L$ $ve uD$L$ ALD$$ËL$ yLD$֠:e ;avHD$ H$L$ $D$L$ A\D$A`D$AdD$AhD$$jѾe ;av?D$ H$L$ $D$ H@u L$~HHD$$je ;av D$l$D$b )e ;aD$ Hl $D$D$tËD$ H$L$ $D$ HLuD$$D$ $|ċPDX@h$D$(pڠMD$D$D$L$ D$,L$0$ e ;aPD$TH$L$D $D$THXL$ PTT$\$D$D$ T$!ل.T$4D$8$D$D$ʚ;D$ 䋠D$D$(L$L$$T$4$T$8T$D$ʚ;D$ D$D$0L$L$,T$$$T$(T$܇D$D$ ge ;av[@BJI\$D9s> q|$,%Ѡ|$pѠt$, Ѡw^D$(D$H@e/ e ;av'$=sD$ L$ D$Be ;avs`D$l~?L$h1 \$ (ʉىL$ |$8-Р|$t$8 РL$-u J9|Ƀ`ÉT$D$4L$0 $D$T$dЋD$lT$趲qe ;avD$L$ȉD$ 芲e D$;A~ԫ$D$D$D$|$1ʠ|$8ʠD$8D$(qǟ$D$$ v$L$L$T$D$ œD$ } e  PH v$D$D$ L$D$ gœD$ ` e ux 0PHD$$D$D$D$$7ƾD$D$ 薵D$L$T$ u& e u Tsd Í=Tsd Ƞt(@#x0PȠ끍xP{Ƞ'$L$; 㰠^e ;a} e v u/ e , *>oQ*ءę{գ}ܠTyze $ Lsd }$D$e L$ Psd ze $uv Yu;D$t%H$L$ D$ L$L$D$& 멍|$9;u#e ;av?Yu $L$L$D$?V|$ G e =  $L$L$D$V|$ G e zF  $D$D$D$U|$ G e O L$ sd Q.$D$ ` $D$>T$D$ &tD$`$L$L$= T$D$ sD$`$L$L$F T$D$ sD$`$D$D$ O L$D$ sD$e uD$sd m(e ,Í=sd D$zڍO z=sd D$yF y~= y/>y=sd D$yMy=sd D$ ysMyW)_oy=sd D$$[yKy=sd D$($D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8 `됍|$ 9;u#e ;av7 Yu4D$t$ҿD$L$L$D$ i b`밍|$9;uĉ#e ;avWYuTD$ t>$"D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8 _됍|$ 9;u#e ;av7 Yu4D$t$RD$L$L$D$  _밍|$9;uĉ#e ;avWYuTD$ t>$D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8  _됍|$ 9;u#e ;av7 Yu4D$t$BD$L$L$D$  ^밍|$9;uĉ#e ;avCd d t$@T$T$T$T$ $ЋD$ D$D$6^e ;av^$D$D$L$ $L$! D$L$ d e u d Í=d Bu]e ;av~|$ u/ e uD$$D$(D$,ËD$$t$D$D$D$ D$4ŦD$L$D$(L$,]fe ;aV,D$0HL$  $T$4T$\$8\$ jD$D$0HtZ@D$ $D$4D$D$8D$ Qm|$e uD$<D$@D$D,ËD$ D$D$lL$DL$PHL$0HL$8H $L$XL$L$,L$ L$ D$L$\L$L$@L$]SD$L$ D$L$$($D$lD$ FD$L$tht@D$tD$xD$tL$x$D$D$tD$D$ D$D$L$$4$8$DŽ$4DŽ$8$Í"$ D$L$DL$PHL$0HL$8H $( $L$XL$L$,L$D$ D$L$tt@D$|DŽ$D$|$$D$D$|D$D$ D$蘳D$L$$4$8$ÍPʉ$\$0D$$L$ T$\$l$t$ |$D$h$,$$0$tIL$pDŽ$DŽ$DŽ$DŽ$ 0$$D$^D$ L$$$D$p$D$h$ $D$$D$D$ D$qD$L$$4$8$Ãu E*$|$t$D$ D$l$\$lPD$ L$L$D$$($D$L$ twtIDŽ$DŽ$$$$D$$D$D$ D$臱D$L$$4$8$DŽ$4DŽ$8$Ë$,$$0$DŽ$DŽ$DŽ$DŽ$0$$L$|D$L$ $$0$8$$D$$D$D$ D$苰D$L$$4$8$Ë$,$$0$DŽ$DŽ$DŽ$ DŽ$0$$L$D$L$ $$0$ 0$$D$$D$D$ D$謯D$L$$4$8$Í$a|$G8e u#Pp$4$8$ÍP^7Ge ;aS,sd $D$0D$L$4L$ D$L$ tYQY iqAIT$8\$lu}tKm 9͇Ç9!9 u)벋D$(HP|v9wrX9D$, É\$l$D$L$<$fD$t$zwD$ t\$L$D$PD$L$T$(\$l$\D$,   +9e ;aL8D$D$D$ L$ L$T$T$(\$l$t`l$$t[\$,š$D$L$, e uBL$$H G $D$2D$D$ D$j\$T$ L$(-xD$$+H0e ;avg$MD$@@ e u*@ L$  t@D$@x 1G0e ;aVLD$PHP $T$ѳD$D$0L$ $dD$t @111҉D$Q uX0O9\$̏觛5y$$D$4e L$ sd `$D$y4e L$ sd p$D$K4e L$ sd $D$4e L$uY sd  $D$D$L$ d e u d `4e Í=d 7=sd 7랍=sd 7b=sd 7"=sd 7, e ;avBD$$L$L$D$oD$ L$ $D$dD$D$e ;avJD$T$8u1JRX@9t 1D$É$L$\$iD$ 1_e ;avBD$$L$L$D$蟧D$ L$ $D$bD$D$e ;aveD$D$L$ $D$\D$ t9D$H @T$Z R9t 1D$É$L$\$4iD$ 1te ;avBD$$L$L$D$迦D$ L$ $D$cD$D$e ;avJD$T$8u1JRX@9t 1D$É$L$\$ogD$ 1e ;avKd d t$@T$T$ $ЋD$L$ D$L$D$D$>e ;av*3e vuZ 3e q3e e ;a(D$,HL$ $2bD$ D$$WD$$L$,QQZiq 9/ZY e -蔏 荎 ae ;a4D$TD$XD$\D$`D$@ D$8HL$0 $WD$0D$$WD$ȑD$8H ] $L$ $0e L$T$TQ \$\,\$`0e B\$X(\$d\$le D$hL$$e r4y3D$4L$$HD$0<B $D$ҨD$L$ T$\$$e 1KCD$T0L$, $ZID$TP蓐$uRD$TPD$ ӥ$D$$D$D$ D$,$ID$$D$pD$tD$xPËD$TT$L$  $L$$L$D$D$ D$L$T$$@DD$8D$<@DD$L$ '$qD$ L$D$8L$<<$D$D$8D$D$ D$s[D$D$ L$L$(D$@D$DD$HD$L尻T$@D$DD$H $諳|$D$ Ge u:D$(G|$LD$$@D $T$L$@L$єAD$( D$,$Gld hd D$pL$tD$xPÍ{‰ { )$|$t$ D$$HD$4 <D$0p T$T@D$hX (D$XD y D$T3 ue ;avD$0L$ $sFD$PtFD$ ӥ$D$D$;D$ $FD$$D$D$D$ D$,ËD$ $F ee ;avD$H@ D$L$ e ;a(D$, $D$D$â|$D$L$ щ ىˁÀ׃ \$,Ⱦʚ;?ȉ=$D$iʚ;ډс=L$(Ë\$l$ ʉe ;av0D$A$D$D$ye ;av0D$A$D$D$)e ;aD$L$ $o5D$4trt D$ $8D$D$É$D$ D$ $`8D$D$$PD$"D$D$ËD$ $"8d d L$D$E e D$;AƄ$$L$0 $}4D$0D$$WD$onA$D$4$L$8$T$<$舮D$D$,$ T$(T$S$MD$ L$T$, e B@Ÿ$D$4D$XD$ L$T$,J e {B ƽ$D$/T$D$ D$P$4uZ$,$0 e u"$(Ƅ$tĔÍ($׃$$1 l$$UÉT$$\$|$x |$@t$x |$\t$@ D$(D$ S $D$ D$ L$L$S$\$\\$̓D$$D$ D$D$D$@$9Y1D$ š $蔬D$ ;L$э_ ڋe P Sw $D$)D$D$ D$ND$t8$$,$0 e u!$($_sĔÍ($tԍxÉdV$1Ƅ$sĔÍz ({z8rĔ?e ;ayH|$X1L$L0T$$$>L$L$$ WL$jL$LL|$41lL$LLRT$ $\$P\$l$Tl$ t$L$L$|$4 |$ t$4L$t|$Xt$ qHËD$P$L$TL$T$D$ ԧD$@|hL$T9w`L$LLIL$  $L$PL$D$ t$|$ nu|$X5ZFqHÐ$ǀ8H $6D$$$hQ$T$3$hH T$$\$ l$1Ʉ$$\#$@$D$=$Ћ$$$h4t$$D$$$"$$"dÉ$D$L\֋$$ttJT$8L$e $;ADŽ$@DŽ$DDŽ$HDŽ$LDŽ$P@$D$p*D$$ @ $D$O*D$$ @ $D$.*D$$  $UD$$ e *$H$ 1$$$ $$$$$$Q Z,R0$$ `E$L$$pNje j$A$QF$}D$$ Nj e $H$P@7$:D$$ Oj e $H$P $T$|$$,j絨D$ $L$$T$$$T$mP: l$$D@$ $$H Q L$T$ $ $$L$|$$ |$($$$$$$$_$$$$C$$$@$4C$  $誏D$$ S $$@L$vfD$L$ $e J$J e u~$B ]v$D$PT$D$ D$2DŽ$@DŽ$DDŽ$H$$L$$PIVĤÍz $cxzTK$t?$@$D$$HDŽ$LDŽ$PUĤÉ$$e$獴$,|$$D$(L$,$L$0rD$$$\1uDŽ$DŽ$DŽ$fDŽ$d$$\fDŽ$|$$tfDŽ$$$$D$$\$D$ND$ u$$1$!|$Ge uJàDŽ$@DŽ$DDŽ$Hp$L$P9TĤÍàW뱋$@$ $Ѝ$$$š$~D$$ S $$$L$JcD$ L$$ e B$D$nT$D$ D$~/$|$G&e uJNDŽ$@DŽ$DDŽ$Hp$L$PSĤÍN6뱍z,O$RĤÍx$Kx$y$y$y$x$ ˟e ;a^HD$8D$L$LH\$XXe x\$\X \$4Xt$`JL$LY \$P$\$T\$\$0\$D$ D$|D$$D$ЋD$L$uHÉD$ L$$$L$MSD$ tyD$ t@D$, š $WD$L$, e u6L$$H Ƹ $D$.D$D$ D$2-xxD$$fd$u^š$D$ 0 e u& ȴH$D$D$y,xȴ4D$8D$<D$@D$DD$<D$Dr~D$8D$D$ L$T$$ e BI$D$+T$D$ D$ 7B|$$uQD$@ $t$D'ğĦD$@xe u t$Dğ<Í`($|$D$DD$|$ D$@$t$DßQ|$ 됍z㽟HD$L$ T$$e J$D$2T$D$ D$1@|$$uOL$TT$LJL$XJ e uD$PBrŸ$KHÍJωËD$P赼ԉ|$ |$41蝽L$PL$4T$TT$8\$X\$z$R|$D$,GD$0Ge D$8G GGD$p@ L$|$L$t $ЋD$L$T$ \$l$CD$LD$PD$Ll$P$ mD$D$2D$LD$ D$D$D$L$DŽ$DŽ$DŽ$$$dÉp\$x9D$TD$XD$\D$` `& $D$L)D$L$ D$TL$X`&$D$xD$&)D$L$ D$\L$`$D$D$2D$TD$ D$D$D$L$DŽ$DŽ$DŽ$$$dÉ$$$DŽ$DŽ$dËD$8=z$P|$D$,GD$0Ge %D$8G GG$@ L$|$$ $ЋD$L$T$\$ BD$DD$HD$DL$H$ mD$D$2D$DD$ D$D$LD$L$DŽ$DŽ$DŽ$$$dÉpD$4\$$D$xD$(I$YOD$L$$L$xe T$4PT$(PH P $D$oD$L$T$ \$l$tID$<D$@L$e D$;A L$>D$D$h$$L$$T$訇D$ L$T$$L$T$D$ D$hD$*D$L$$l>D$D$d?I$$5:辛L$h$$A$A $$$$$e |$d$\L$hII~HL$81 ͋L$8$%$$$uMl$89|L$dQtWf.rAe u+A$DŽ$DŽ$Íy1є0f.wBf.s뵉\$`l$4$$D$ L$T$L$D$1r$$L$D$$ $L$ T$\$$F$$P$QT$0 L$\1@9D$,kut111t݋D$dHL$  $t$l$ |$e u$|D$,L$\T$0뒍 $|$$D$cӉl$XC L$ D$$D$D$D$D$D$ L$T$XuT$0ʼn΋D$,L$\-ZT$ \$$L$D$kD$L$뻋$$\$`l$4I=!Ѕ t$`&$:D$$m`&$:$L$$DI=!… Єt$`&$:D$$`&$i:$L$$L$@T$$$D$l$D$pBD$T  $:D$D$P 0 $L$lL$D$ L$T$P e u{BL$TJ e uYD$@B $D$8T$D$ D$ DŽ$D$$$D$@$Íz D$@렍z{)D$@T$$$L$t$L$xJL$T$9D$D$L 0 $L$tL$D$ L$T$L e u{BL$TJ e uYD$@B $D$8T$D$ D$ DŽ$D$$$D$@$Íz D$@렍z{)D$d$DŽ$DŽ$Í$D$dD$$L$虒$$D$_X߉‹$$9~zPË$(~׉D$p~t$|@*$_&|$$4G e  $0D$tHOL$$Q$ \$\$|\$|$ \$H$ҋD$$$L$$  8$] $%D$ e xu^$/L$tQPT$$Z$ l$$$t$=J|$ D$D$H$Ӌ$ $$FD$x$|$$D$D$x뇋$0|$0$$4L$JD$ L$$#T$D$ L$ D$jD$L$ $D$$0D$$4L$ D$D$|L$L$<$$D$L$< e L$|HD$D@$1|$ Q$$$ҍ$$跁L$L$"$$蛁L$"ujD$DPI\$X\$D$ $ыD$DHT$L$ $  $$$L$mD$t$l$t$ -獴$0D$L$T$DBJ lxD$|{JωzD$8|$hT$pD$L$D$($DŽ$DŽ$0$$D$D$ L$$$$ OD$D$@$D$ D$D$ED$L$DŽ$DDŽ$H$L$PËidenHNtity911iOωy$,|$p h@pL$HL$ e uAD$,D$0$ÍyBtxD$2t뷍z &t낉$L$D$L$ D$,L$0$\e ;avjD$ HhL$ $ơD$ ƀǀǀ e uǀD$$ǤÍ1vs[ze D$;A$I P|t#$$$$Đu҅jHptHI@pHI q11҉T$L$[ [thPmu#$$$$ĐÉl$@ED$`$\$ID$ t$H\ $豜D$Z$QtB\$@+9T$ZD$@BAxi@Bډ$T$D$D$8$QT\$PiXR,$ҋD$D$L|$`1qrD$0D$4fD$hD$PD$`fDŽ$D$LD$xD$0D$D$`$D$ڝD$ tyD$8$$HT@XI$ыD$L$ $D$D$t/t) u11ɉ$$ĐË 1Ջ$HtAHtDŽ$DŽ$ĐCAx*L$$舻D$D$ D$@HP $T$$D$ YD$D$(D$@H @ $D$^$D$L$(f.v9$#D$ L$ $D$^D$T$ $YxCYx$$$$ĐË$$$$Đ1$$$L$6D$ttL$T$Ë$1 $裕D$L$t#$$$$ĐÄtً$I $Ǖ $&D$D$ 'aD$HP11ɉʉ$D$TT$XL$\š$D$D$H @ $L$TL$D$L$ T$He ubJU$D$CT$D$ D$$@\$識$$$$ĐÍzm땉D$|$(1\.‹D$ \ЋT$ xD$,[Z[ yY`"$$D$D$$L$L$  $.ݚD$L$ T$$Be u1JD$\H` $ L$T$ED$L$ T$\zJ[1%$D$\Cve ;a D$$H8@8D$D$D$ [jL$D$ PL$$L$L$L$D$$H`uD$(D$, Í$D$L$$I` $ PL$D$>D$(D$, Be ;a4 d L$(9D$,D$,L$(T$$Zh\$$䇠D$$H|@|ƀǀǀ e fǀD$$ъD$$H`L$(A$tD$(D$$H $^QD$$u\I tDHL$X\$1.T$ Ӌ)Impt$ $ՋD$PD$$L$\$9|΋P4Ѓ É $D$(D$D$,D$| D$$놋D$$H $wPdH\ $,D$($L$,L$D$t D$$@$D$L$$Q`$0T$D$*D$$14XD$$c É $D$,D$d T$5D$ t 11D$,L$(a@e ;a`D$dL$0P82 $D$0HT$I  L$dYi[8q t$t$pt$t$tt$ t$xt$t$|t$$t$$|$T$ ,$ӋD$$tGD$0@@ td d $$`DŽ$DŽ$`ËD$dHQDŽ$DŽ$|Ë$HPI($! |$hV$HL$@`$KxD$h.KOA \ L$D$ D$ D$D$$_d|$0P $+D$D$$L$`e r됍xD$0BT$LzdBU|$LB $D${D$ L$$$DŽ$DŽ$9dÍS[BaX$ߋ$CBD$L&XLߋD$<(BD$LXDߋD$8 BD$LX<߉AD$L|$p}xŋ$A}D$HA}4ƋD$tAt$t%x,ËD$pA{ ŋD$@A؉xD$D~AyD$hrAȋL$h~Jω[AD$(|$<7D$4D$TD$ D$XD$\D$`0$D$TD$(šD$ L$L$\D$`$ OD$D$@D$\D$ D$D$«D$L$DŽ$DŽ$$$pdË+idenktity11#oh@D$hP Z@R뿉$D$ED$hH 4l$ $\$T$/!'e ;avsD$  $cD$ L$T$uL$$T$(D$,ÉD$L$T$$D$D$L$ T$ $D$L$ D$L$T$&qe ;avD$ $dD$D$L&e ;a,D$0H0tD$4D$8,@0  $D$L$0Q Y$R8 L$D$D$ D$D$D$D$D$ $D$4D$8,%De ;avD$H@ D$L$ T%e ;arpDŽ$DŽ$$D$D$tD$ $ PL$舤D$tH0H4I H8P< $T$L$xL$L$|L$ D$ L$T$\$l$$$.L$@T$X\$DD$th@pDxL@HD$|$$L$\$l$ t$詋D$,L$(T$$\$ l$$$T$L\$Hl$\3$D$D$D$L$T$ \$\`l$Lt$Hyl$4t$0\$Pxۇ:t$0D:t$0D:t$0D:|$to]E9D$ ge ;avGD$$^D$ L$A e uD$A $aÍyD$0e ;azrYX'S8#+$WGD$D$&艅D$L$ hd e ld $D$!fD$ L$ d e d $D$eD$L$ d e ] d 50$D$eD$L$ d e  d w$D$WyeD$L$ d e  d q$D$MAeD$L$ d e  d $D$c eD$L$ d e 5 d Ù$D$dD$L$ d e  d }$D$dD$L$ pd e  td Z$D$!adD$L$ d e u^ d $D$!-dD$L$ xd e u |d EX$e Í=|d ܍=d 뙍=td S=d  =d {=d iu=d W+=d E=d 3=d #O=ld e ;avFYuCD$t-P@ $T$D$D$ L$D$L$ * #롍|$9;u#e ;avBJƁǁǁe u ǁÍ1>'e ;aD$$L$L$s@D$L$Q$D$D$䇚D$ L$Q $D$ CD$L$Q$D$D$讇D$ L$Q$D$BD$L$Q$$D$?D$L$Q,$D$BD$L$4 $D$D$JD$ D$e ;aD$HT$Z*09b1ɄQHZ8:JZ hp 91ɄHZ9HZ9J X hr91ɄH(Z(j$p$9tV1ɄtLJ0Z,h0p,9t1Ʉt@4J49D$1$L$l$hHL$ D$T$1‰,$t$\$;L$ D$T$1뉉4$L$\$"HL$ D$T$M1F1?18$L$l$GL$ D$T$11,$t$\$ ;L$ D$T$~?e ;av: D$$L$L$>D$L$ $D$>D$D$ e ;av7D$L$ f.uzAHf.!L$ 12e ;aD$$L$L$D$ {D$ L$Q $D$D$\D$ L$Q$D$?D$L$Q$D$D$&D$ L$ $D$O?D$D$~Ie ;aD$T$9JX9HZ8H Z 9JZhp9t\1ɄtRHZ9uDJX9t1J$R X$@ 9t 1D$É$L$\$nED$ 111Չ$L$l$KEL$ D$T$11|1u1nne ;avBD$$L$L$=D$L$ $D$D$蘂D$ D$e ;avUD$HT$Z*09t1ɄtJ@9D$14$L$\$XDL$ D$T$e ;av/Yu,D$ t$D$D$jZQ{ J븍|$ 9;ủ#e ;av?Yuze ;avD$D$D$ e ;aD$$D$D$CtD$L$ tdt\tVL$Q$Y 1E9}(49u $hD$L$D$ L$$D$(D$ D$$D$(1D$ D$$D$(?e ;a=D$ P!ʄt ʚ;@HP!ʄt HPHHP …!фt@#@ @ f.v ،@HP$L$ D$D$D$T$ T$\$ ks4$l$荺D$D$ Y@$ԹD$ L$T$ JB\$\$j 9Çދz9!9 ȄtzjD$D$$\$(Xe ;av2L$T$JL$ J e uD$BÍzD$e ;a D$(0U $袭D$D$1,L$$TZT$\$T$$'D$HD$T$(9}jL$$D$ +D$L$(9L$$ZT$\$T$$1'D$$D$/+D$HT$(9gt\HX @9wu$)؉!ЉD$)ىL$l$ ^D$L$r:IȉD$0T$4 ù귺D$0D$4 bi [i Th Mh 0$ءD$w \We ;a0$ D$D$,1'L$(T$@ʋ+[mD$$ՋD$(HD$,T$D9|ыHPX D$ T$L$\$D$4$D$8D$D$ $L$@L$D$H|$ G e > $L$@L$D$tH|$ G e O+  $L$@L$D$ 5H|$ G e  . $L$@L$D$ G|$ G e Z $L$@L$D$ G|$ G e b> $L$@L$D$ xG|$ G e F $L$@L$D$ 9G|$ G e . $L$@L$D$F|$ G e u4  $L$@L$D$F|$ G e &XP $L$@L$D$|F|$ G e  eP $L$@L$D$=F|$ G e  - $L$@L$D$E|$ G e * .L$@ pd `$D$D$D$ D$< ` $D$-T$D$ IdD$`$L$T$D$ OcD$`$L$T$D$ cD$`$L$T$D$ UbD$ `$L$|$ Ge G̺ $L$(L$D$>|$ Ge P $L$(L$D$g>|$ G e O>L$( pd $D$$ ` $D$̺T$D$ \D$`$L$$L$PT$D$ \D$`$L$$L$O>T$D$ h\D$e D$$pd A$D$  $D$D$`=|$ G e o*  $L$ L$D$!=|$ G e  <  $L$ L$D$<|$ G e 3 L$ pd r$D$ ` $D$* T$D$ G[D$`$L$L$< T$D$ [D$`$L$L$3 T$D$ ZD$e D$pd $D$  $D$D$;|$ Ge  $L$L$D$;|$ Ge Hr $D$D$D$];|$ G e L$ pd $D$ ` $D$T$D$ YD$`$L$L$rT$D$ YD$`$D$D$ L$D$ ^YD$e uD$pd &xe DÍ=pd D$_ڍ_=pd D$_ r__a=pd D$_3 |_=pd D$ m_1< ]_* M_=pd D$$9_.O>)_=pd D$(_YP _̺^=pd D$,^V3<^=pd D$0^@^(^=pd D$4^~ _^=pd D$8t^_d^P^T^=pd D$<@^.0^=pd D$@!^-^peP^!XP]4 ].]4F]>]Z]G .]+ ]>q]Z>a] dQ]!.A]mn1]P!]-]Ee ;av*D$ D$D$D$ D$Z?Ee ;avD$ D$D$YDe ;av*D$\D$D$D$ D$YDe ;avD$\D$D$YoDe ;av*D$D$D$D$ D$dYDe ;avD$D$D$XCe ;av*D$$D$D$D$ D$XCe ;avD$$D$D$WOCe ;av*D$ D$D$D$ D$DXBe ;avD$ D$D$dWBe ;av*D$D$D$D$ D$WoBe ;avD$D$D$V/Be ;av*D$D$D$D$ D$$WAe ;avD$D$D$DVAe ;av*D$D$D$D$ D$VOAe ;avD$D$D$UAe ;av*D$D$D$D$ D$V@e ;avD$D$D$$U@e ;av/Yu,D$ t$[D$D$1™ *@븍|$ 9;ủ#e ;avWYuTD$ t>$B\D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8 ?됍|$ 9;u#e ;av7 Yu4D$t$ZD$L$L$D$ I B?밍|$9;uĉ#e ;av/Yu,D$ t$XD$D$ >븍|$ 9;ủ#e ;avWYuTD$ t>$bYD$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8i b>됍|$ 9;u#e ;av7 Yu4D$t$XD$L$L$D$  >밍|$9;uĉ#e ;av/Yu,D$ t$B\D$D$豿 =븍|$ 9;ủ#e ;avWYuTD$ t>$]D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8) "=됍|$ 9;u#e ;av7 Yu4D$t$[D$L$L$D$ ɾ <밍|$9;uĉ#e ;av/Yu,D$ t$\D$D$q j<븍|$ 9;ủ#e ;avWYuTD$ t>$b]D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8齙 ;됍|$ 9;u#e ;av7 Yu4D$t$\D$L$L$D$ 艽 ;밍|$9;uĉ#e ;av/Yu,D$ t$]D$D$1 *;븍|$ 9;ủ#e ;avWYuTD$ t>$]D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8詼 :됍|$ 9;u#e ;av7 Yu4D$t$b\D$L$L$D$ I B:밍|$9;uĉ#e ;av/Yu,D$ t$VD$D$ 9븍|$ 9;ủ#e ;avWYuTD$ t>$WD$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8i b9됍|$ 9;u#e ;av7 Yu4D$t$BVD$L$L$D$  9밍|$9;uĉ#e ;avħc $^8e ;av| c D$ c L$c T$$pd \$}\$D$ #I|$D$GD$Ge u D$ ËD$O-8he ;av1ȧc $]c $]̧c $]7e ;av| Ȼc D$ ̻c L$лc T$$pd \$\$D$ 3H|$D$GD$Ge u D$ ËD$N=7he ;av-psd $D$D$ujD$ L$L$D$6e ;avSġ$D$ | c ػc ܻc T$\$L$D$D$ D$$v6e ;a (tsd D$ ! $pd T$0T$D$ cCD$u] !$pd D$0D$D$ F|$e uD$c $[(ËD$?M$D$D$"0D$ D$;D$L$D$ L$$0$D$ D$͙D$L$ $L$ L5e ;av| ػc D$ ܻc L$c T$$pd \$)\$D$ E|$D$GD$Ge u D$ ËD$4L4he ;av2|$  e u 1LÍ$|$RW4e ;av-n$D$D$D$ L$L$D$ 4e ;av3e ;avSġ$D$  c c c T$\$L$D$D$ D$$v3e ;avO @d $nD$D$$D$D$(D$ D$,D$D$0D$CD$L$D$4L$8 3e ;avp0@d $D$8D$D$ e ;av| c D$ c L$c T$$pd \$A\$D$ |$D$GD$Ge u D$ ËD$$" he ;ae vu谉 e @:蘱ՙ$D$  $D$D$"|$ Ge B N $L$L$D$|$ Ge  $L$L$D$|$ Ge V $L$L$D$e|$ G e U, $L$L$D$&|$ G e  $D$D$D$|$ G e L$ psd wә$D$ ` $D$ NT$D$ LD$`$L$L$T$D$ D$`$L$L$VT$D$ D$`$L$L$,T$D$ D$`$L$L$T$D$ D$`$D$D$ L$D$ RD$e uGD$tsd E\e Í=tsd D$벍=psd D$K|,lV\TL N<e ;avWYuTD$ t>$D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$89 2됍|$ 9;u#e ;av7 Yu4D$t$D$L$L$D$ ه 밍|$9;uĉ#e ;av2|$  e u 1 Í $|$#we ;av-o$D$D$D$ L$L$D$,e ;ave ;avSġ$ęD$  c c  c T$\$L$D$D$ D$$e ;avO d $oD$D$$D$D$(D$ D$,D$D$0D$cD$L$D$4L$8 *e ;avp0d $D$8D$D$e ;av-po$D$D$D$ L$L$D$le ;avHe ;avSġ$D$  c c c T$\$L$D$D$ D$$e ;avO d $poD$D$$D$D$(D$ D$,D$D$0D$D$L$D$4L$8 je ;avp0d $D$8D$D$$D$L$T$\$ l$t$l$$T$(\$,L$0D$4t$8` ޝ됍|$ 9;u#e ;av7 Yu4D$t$D$L$L$D$ ` ޝ밍|$9;uĉ#e ;aT\`$9D$D$(L$lL$4T$pT$8D$<D$@D$DD$H0\$<-l$@$\$4\$vD$ L$L$DD$H$D$D$D$L$ T$$\$(l$,D$HL$LT$P\$Tl$X0Ite ;av7`d $uD$D$D$D$D$ D$ D$se ;av/`d $uD$D$D$;=D$ D$誩e ;av' `d $uD$D$D$+ be ;avD$tD$D$1e ;avD$t@D$D$e ;av2|$  e u 1+Í$|$Ǚ藨e ;av-r$D$D$zD$ L$L$D$Le ;av(e ;avSġ$gD$  0c (c ,c T$\$L$D$D$ D$$趧e ;avO Pd $rD$D$$D$D$(D$ D$,D$D$0D$胄D$L$D$4L$8 Je ;avp0Pd $D$8D$D$距e ;av-pr$D$D$oD$ L$L$D$le ;avHe ;avSġ$\D$ , 0c (c ,c T$\$L$D$D$ D$$֜e ;avO d $prD$D$$D$D$(D$ D$,D$D$0D$yD$L$D$4L$8 je ;avp0d $D$8D$D$D$  0c (c ,c T$\$L$D$D$ D$$&~e ;avO d $sD$D$$D$D$(D$ D$,D$D$0D$ZD$L$D$4L$8 }e ;avp0d $D$8D$D$D$L$D$4L$8 zae ;avp0d $D$8D$D$ rUe ;av'D$tHD$L$ D$D$ 2Ue ;avD$t @D$D$Ue ;avD$t@ D$D$Te ;av2|$  e u 1 mÍG$|$rwTe ;av-ps$D$D$&D$ L$L$D$,Te ;avTe ;avSġ$D$ D 0c (c ,c T$\$L$D$D$ D$$Se ;avO d $psD$D$$D$D$(D$ D$,D$D$0D$c0D$L$D$4L$8 *Se ;avp0d $D$8D$D$`Ae ;av-Pp$D$D$D$ L$L$D$lAe ;avHAe ;avSġ$D$ \ 0c (c ,c T$\$L$D$D$ D$$@e ;avO d $PpD$D$$D$D$(D$ D$,D$D$0D$D$L$D$4L$8 j@e ;avp0d $D$8D$D$e ;av'D$tHD$L$ D$D$ >e ;av(D$tH @D$L$ D$D$ q>e ;avD$t@D$D$0>e ;av2|$  e u 1nVÍ$|$^\=e ;av-t$D$D$D$ L$L$D$=e ;avh=e ;avSġ$D$ ` 0c (c ,c T$\$L$D$D$ D$$e ;a,sL$09D$4H @P#ҦY9? p9t]@D$$D$(D$$L$(v$D$)D$$D$D$ D$D$L$L$S9? ? e e ;a `$ΘD$D$ e ubL$HL$HL$H @$dΘD$ Xl e uL$HL$D$ ÍxD$%‰ȉލxD$%yD$%y D$%3e ;avD$PЋ$D$  e ;a3L$A$Yi yY%t/Td Pd Q e uAT$D$ $|$QЋ$D$HuWHL$$D$ L$uD$Hu@봋T$J e uBL$D$ Ë|$l$P ы$u=Ld Hd T$J e uBBJ L$D$ Ë|$!$T$݋D$멉l$\$  e ;a$D$(PH\$L$L$, $ ыD$L$\$ l$u0|$(O e uD$0D$4$Év#D$l$ D$(P ЋD$D$0D$ D$4$ Se ;ae vu e <̢E$D$nD$L$ Hd e uT Ld $D$3mD$L$ Pd e u Td e Í=Td }"=Ld n" "e ;av" B$D$L$L$D$  e ;av>e vuʉ e 臄ӬX&e K e ;avu e vuj  e ̫wU}:*Iԩ_*Ӭ1%af/! e  oe ;a`ȡ$Yɘ|$|$D$(Ge u]D$$$D$,D$D$D$D$ D$ |$GGe u D$ËD$ D$$z Ne ;avm D$D$D$D$D$$D$D$(D$D$,D$D$0D$$D$D$腢D$L$ D$4L$8 \we ;a e vup  e BSѬ#`o8/-D$ $ d e d /$D$ C׺L$D$ D$L$d e  d /$D$ D$D$ hD$L$d e uf d 1w$D$)D$D$ "D$L$d e u d  e Í= d L=d =둍=d .9=d ?e ;av: D$$L$L$GGD$L$ $D$0GD$D$ /e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$CD$ 1݉4$T$l$CL$ D$\$qe ;avDYuAD$t+H P@$D$T$L$ D$D$< 5룍|$9;u#e ;ake vu@ e r$X53>IάZ \K*$}ĘD$D$ 0`l $_ĘD$5w@@0#@4 e L$ A d $ĘD$D$ 0`l  $ØD$5w@@0#@4 e uL$A d e ËL$yL=d ?ڋL$ y1=d $Zue ;avR$B$D$(D$D$,D$D$0D$ D$4D$pD$L$T$\$ D$8L$X蝤 c"I3_( e e ;ava e vuځ  e  "2|ˬY' % e 8e ;a e vuV  e 'Z!Z25Paˬhc~i{/ e Me ;avRe vu蚀 e W!1u$e e ;av>e vu* e WBme e ;aPL$TQ|$ 1  $T$T$ T$ ܘL$TCD$D$D$D$D$THL$  $T$T$$٘D$ $HޘD$T\$ tHD$$kl$\$Q tp@ =39uPF NL$D$ $l$mA e u@@PÉH$|$'D$誔 se ;a4D$e vuo e  bjXHe +e ;a4ϩ$ٯ|$|$t$8P D$D$(D$,D$0D$ D$$$D$(D$躈D$ L$L$ D$$Ԩ$D$D$ D$D$ D$VD$L$L$HD$L4S.e ;a0Ω$D$L$4T$8PD$$D$(D$,D$D$ $D$$D$އD$ L$L$D$ Ԩ$D$D$D$D$ D$UD$L$L$Q T$`$D$D$ t $D$lD$&D$d$`Í 4$D$D$HL$dQҪ$T$T$e L$ L$DT$\$us|$H1TL$Dl$HMU]D$dH L$ ` $L$8L$Ø|$ e uD$H$D$lD$f;D$HT$@\$< 4$D$HD$l$H}D$DT$@\$ e ;ah蒓|$4ޜD$lHL$0 $D$tT1L$lI0L$(|$H1ٜ|$Ht$4ޜL$|L$\$L$`T$d Ԯ $L$HL$WL$D$ |$(W_/΋O 9u6 KOJOe OAOOQ_/93QWT2e |uD$0$H hלt$ D$$'$l$L$\$ T$ǔD$L$T$|$(We ut$ ŋD$$yל‰לL͊$D$,L$pL$L$tL$L$xL$ ID$,|< Կe ;avID$tuÉ$D$ D$D$$D$D$(D$ D$,D$D$0D$`e ;ava$D$(tu$É$D$,D$D$0D$D$4D$ D$8D$D$Yu;D$t%H$L$蛾D$ L$L$D$/ 軭멍|$9;u#e ;av0Yu-D$ t$2D$D$`/ Y뷍|$ 9;uˉ#e ;av2$Yu/t$(tUʜD$ D$,$. 뵍|$(9;uɉ#e ;avaD$$L$L$D$8/5D$ L$Q8$D$D$L$@ $D$D$4D$ D$he ;aD$D$L$ $D$8+D$ tVD$HpD$D$$L$L$ T$ T$,$+|$|1薵`$l$L$|L$xD$$L$ T$,D$|${D$$L$ T$,L$ \$|tkq9.T$,t$ D$$t. ʋ-e u뭉ω뢉l$(\$8$T$L$D$ t$pT$D$L$p\$8l$(ȋL$ 덉T$4T$PL$TD$XD$lD$pD$tD$x@l\$lT$pL$tD$x$D$PD$ 5D$L$ $L$D$lD$ $[D$D$0$ L$D$գ1D$(L$4[T$<\$@$ut$5`4$T$\$ ID$H@T$DL$HD$LD$\D$`D$dD$h0$L$\$1B9}',tT$$MыD$ L$T$\$ԋD$ Ë^ $-T$D$ $ ыD$ ^e D$;A}b$D$8 ̩ $W|$|$(e 9D$8$$$L$D$BL$4$1䯜 ` $T$4T$$T$r$$nu$$QT$$X\$ D$0il$ L$,$\$KD$D$,$L$L$ D$D$(L$ ` $T$0T$\$ \$ 壘D$KD$(L$ ` $T$0T$T$ T$ 0|$D$GD$$Ge u D$,D$,L$0L$Yu;D$t%@ $D$D$L$ D$L$b [멍|$9;u#e ;avBD$$L$L$ϗD$L$ $D$D$xD$ D$獜e ;avUD$H\$k39t1ɄtK@9D$1$t$L$˗L$ D$\$te ;av: D$$L$L$7ΗD$L$ $D$ ΗD$D$ e ;avsD$HT$(r9t;1Ʉt1J RX @9t 1D$É$D$L$ʗD$ 1݉$l$t$ʗL$ D$T$膌qe ;av*e vu  e e ?e ;avD$ $D$պe ;av#D$ $=D$D$趋e ;aD$8e $ߝe D$$WD$ :`$ rd L$L$ L$T$$T$ qD$L$1$JD$L$$He T$ P\$,Xe \$(X D$\$4Xe uV\$0X`$rd D$T$L$ X|$e uD$D$8ËD$로xD$0ݡ룍x ËD$(͡rx‹D$ 踡ÉЉ=D$8sÐi[e ;av D$D$܉e ;avD$L$ L$D$訉e ;av=|$1L$|$ 0mL$L$L$T$ D$D$Le ;avt D$$$D$(D$D$,D$D$0D$ D$4D$D$8D$GD$D$ @˩ $H|$e uD$|$< ËD$<赈pe ;avD$H@D$L$ 脈e ;avD$H@ D$L$ Te ;avD$H@D$L$ $e ;av`$|$41{|$r PmL$L$(L$ L$ L$, $L$0L$SD$D$|$4t$$詇e ;avt D$$$D$(D$D$,D$D$0D$ D$4D$D$8D$D$D$ ˩ $!G|$e uD$|$< ËD$蜞pe ;avD$H@D$L$ 䆜e ;avD$H@ D$L$ 贆e ;avD$H@D$L$ 脆e ;av* e u @Ord Í=rd @OƝ?e ;avV1$ED$ `lL$HL$H e uL$ HD$ÍxD$ LÅe ;avJ Ӯ$}ED$D$ 1L$\$$*ՋD$HD$ \$9|ۉD$ _e ;av_ D$,$D$0D$D$4D$D$ D$D$D$$$D$(D$D$D$D$ D$ ڄe ;adD$p$D$tD$D$xD$D$ HPrd ZD$0\$,L$(1 \$8SʼnT$8l$$|$P譡|$=Hrd /we ;av/e vu e ϝge Zwe ;av8$rd D$D$D$[fD$ HD$L$we ;av c D$ve ;a Ӯ$y6D$D$L$HT$P e uo\$X2$>6D$ #mL$HL$H e uL$HL$AL$ ÍxD$薍T$z舍؍xD$xu,e ;avD$ue ;avD$PPue ;av5̩$M5D$L$ Q P `L$D$Due ;av@D$ `9u+D$ uL$Q X99!ˆT$D$øte ;ad$12L$lL$hQ L$|$t$p|$,|$H ' $L$L$T$v L$T$ T$\L$`|$Ht$觑|$,t$H膑$t$,vdÍ0$ЯD$ t$e ;avD$se ;avD$D$Xse ;av3`̩$m3D$L$  L$D$fse ;avhD$ 9uPD$$uAL$\$،D$՜D$ f.D$(D$(ør|e D$;A$1$?$|$0$̏|$Dފ|$|Պ B $D$X L$T$ $$|$|t$0胏|$Dt$|b$t$DRĴË$$ =D$ D$L$L$|$$*|$`1:$. '$D$D$D$D$ D$L$ $$$t$ώ|$`$諎$t$`蛎ĴÍ0$دD$ +qVe ;av9D$@D$@ $D$<D$YD$D$ pe ;avD$pe ;a,D$0@L$4f.vH@f.vHPP$L$L$$$$Ĥ1bme ;aip3$L$|L$L$]5D$L$L$0T$ |$\1z|$\zT$\D$0D$`\$d1L$0AL$|9D$0T$x‹[,‹mt$ts11D$4$l$\$jD$L$T$ T$TˁL$$it$h|$`|$,)9l$`t$\|$h9w>l$hEl$hTt$d|$\T$`9D))ۇ!,>&99~'ȋT$T9t,$T$L$诀D$$D$hȉՉD$\$(3$T$,TQT$T$3D$L$ T$\$\l$`9~MD$L$XT$ 9t $\$l$>l$l$`l$ l$dl$Xl$\D$L$$T$T\$(믋D$`$l$\$ mD$(XgD$hL$dT$\|9w$$$pݙ ܙ ۙ `we D$;A|$p1`x|$pWx$L$p$L$t$L$x$$1111@$$$\$,l$(t$P9<‹|$<<‹?|$L$T$pL$t9dD$8 :W$111t$|$T$L$ fD$(HT$\$l$,9`t$PϋL$Pe ;avq e $uM rd L$$DOD$de uPOrd Í=rd POg=rd g8Pse ;a=@D$H 9D$LHL$PT$D$ !|$,;m2$|$e L$DL$OL$O e uwD$ GD$PGe Ou8ύt$,l L$$D$(rd @$D$$D$@É|$$L$D$,D$iD$뱍Oω‹D$ fzD$PfrD$Dzf>$L$'D$ Ne ;aP(r$D$ f$D$$Z$D$ ^ ^ $T${D$D$  $D$D$D$  $D$ߥD$D$  $D$D$D$ @e $ |$e u8D$ D$$GD$ GD$G D$GD$GD$G|$,(ËD$ aD$pHL$ ҥ $T$tT$>|$ e ut$xf,$|$D$xD$c lPI{e ;aTD$XHL$ $D$ D$$WD$șuwL$XQ|$$1Ra  $T$L$$L$t$|$|$/D$(L$X $D$t$\eD$$$&|$D$$uɐϙTÐϙTjH%e ;a9DD$L$D$D$HHL$ ҥ $T$LT$8D$|$01p`L$LQ Ru;|$0Y`D$L$|$t$P(e|$t$0eD$,D$dDÃtD$H@D$ ҥ$L$6t$ |$0d띋D$HHL$ ҥ $T$LT$J<|$ e ut$Pd<$|$D$PD$aD$dD Ge ;a$DŽ$DŽ$DŽ$$HL$8 $諚D$8D$$WD$ƙ|$e ;avZBJT$9sB\  l$9s0D L $\$L$D$ |{D$D$ 膺 >e ;ae vu e d]Xߣ裮nynO*谱+Z$D$  $D$D$0|$ Ge $L$L$D$/|$ Ge {$L$L$D$/|$ Ge 7r$L$L$D$H/|$ G e 7;$D$D$D$ /|$ G e ` D$rd e $uW rd ($D$$`D$ L$ @d e uDd e Í=Dd S=rd S렍` S=rd D$Si7;SrS{SrS#<]e ;av7 Yu4D$t$rD$L$L$D$ 詽 ;밍|$9;uĉ#e ;av:1L$"D$ k\$ډ$L$ʘL$D$ @|ىL$?;e ;aD$L$1\$ST$k, t <T9Ç9 ttD$ ËT l t |9Ç9 tȋTl 9t뵋T lt\ 9t뚉,$t$T$T$ D$L$uD$ 4:e ;av/e vuJ e l+ge 9e ;a=(e v(u e i(bsɩ_)%a`U[F1,%$D$$]D$D$ ED$D$me L$l \rd 2$D$!D$D$ 5"D$D$e L$ Xrd j$D$(!uD$D$ OD$D$ɰe L$ Prd 97$D$%c,D$D$ :"D$D$we L$@ Lrd .ռ$D$ D$D$ ]D$D$腮e L$ Trd $D$~D$D$ VD$D$3e L$x `rd ѵ$D$UD$ L$dd e . `d $|$|$$5SD$$$D$ D$ &e L$  drd e Xrd   c `d dd ̄d e Z Ȅd $c e Lrd * `c dd `d Ԅd e  Єd drd e  dc $|$|$ 5^}PD$ $D$(D$(1e L$ c lrd e Trd 9 `c dd `d d e d dc 㵻$D$荖D$ L$ld e  hd e Trd |c dd `d ԗd e FЗd ld ܗd e  ؗd $ e c  $|$|$5PD$$D$D$e L$  hrd e \rd Wc dd `d d e d c e Prd  c dd `d d e d e hrd $c e `rd Z`c dd `d d e $d e lrd dc j$D$(JpD$D$ LD$D$趫e L$ xrd ^7$D$%ܽD$D$ 1"D$D$de L$2 trd &$D$$iD$D$ HD$D$e L$ rd S$D$!%D$D$ 9"D$D$e L$j |rd =$D$ZD$D$ ]D$D$Ψe L$ prd $D$D$ L$td e  pd e trd c d e \ d drd e 2c e |rd c td pd d e d drd e c td pd d e rd e prd H c e lrd $c $D$趑D$ L$|d e  xd td pd d e d d e h d e prd >`c 5e $ dc td pd d e d e xrd c hrd e c td pd Ąd e uWd e rd u4c hrd e uc e (Í=c F=c Fō=d F뢍=c Fp=c FF=d F=dc wF=`c gF=d UF=d ‰AF\=xd ‰+F =$c F= c F=d E=c EN=d E$=c E=c E=d E=c ‰Eh=pd ‰}E8=prd iE=|rd WE=rd EE&=trd 3E=xrd !E^=dc E=d E=`c D=$c Dr=d DH= c D=d D=c D=c D=hrd Ds=c rD=ؗd `D=Зd PD=c @Dz=hd .DN=d D=dc D=`c D=lrd C=dc C,=Єd C=`c C=Ȅd C=$c C= c CY=drd C-=`d nC=`rd \C|=Trd JC=Lrd 8C=Prd &CP=Xrd C=\rd Cx+e ;av81L$ D$ T$‰$L$\mL$D$ @ |ۉL$!+e ;av0D$L$1B } f.u{D$ D$ *e ;av81L$ D$ T$‰$L$lL$D$ @|ۉL$q*e ;av0D$L$1B} f.u{D$ D$ *e ;av81L$ D$ T$‰$L$kL$D$ @(|ۉL$)e ;av0D$L$1B(} f.u{D$ D$ i)e ;av81L$ D$ T$‰$L$jL$D$ @|ۉL$)e ;avuD$L$1B}Wэ,э4Ѝ<Ћv?m[9ttD$ ÉT$,$|$\$f\$ D$L$T$D$ t(oe ;avM-e vu芧 -e X<=%^%-e 'e ;avMe vu e Lw)=&&">9e 'e ;av9e vu誦 e lƤve 0'e ;ay(e v(u@ e bMXv^頝N~ZL襤kpB[$D$'iD$D$  L$D$že L$ rd [$D$'<D$D$ = "L$D$pe L$I rd m$D$(@D$D$ & "L$D$e L$ rd $D$!D$D$  L$D$,e L$ rd ($D$$D$D$ 8"D$D$ze L$ rd m$D$(׋D$D$ i"D$D$(e L$ rd $D$+sD$D$ dD$D$6e L$U rd \$D$'iD$D$ D$D$脜e L$ rd [$D$'<D$D$ ="D$D$2e L$ rd m$D$(@D$D$ &"D$D$e L$) rd 1$D$!D$D$ D$D$e L$ rd $D$ D$ L$܄d e { ؄d _3$D$ ؃D$ L$d e 1 d $D$ 蠃D$ L$d e  d T3$D$ hD$ L$ d e  d $D$0D$ L$d e S d +$D$D$ L$d e   d Ў$D$D$ L$d e  d =$D$舂D$ L$d e u d $D$PD$ L$d e + d $|$|$$5=D$$$D$ D$ !e L$  rd $|$|$ 5`C;D$ $D$"D$"̩e L$ ] rd e rd 3 c e rd  c d d d e  d d d d e  d e rd s c rd e I c d d d e  d d d d e  d e rd   c rd e  $c d d d e S d d d d e  d e rd  `c e $ dc d d $d e   d d d ,d e Y (d e rd / c ce $ c e rd  c e rd  c e rd   c e rd Y $c e rd / `c e rd  dc d d $d e  d e rd c ke $w c d d ,d e A(d e rd c e $ c e rd  c ٥e $ $c e rd g`c e rd =dc e rd c e rd c e rd c rd e c d d 4d e _0d e rd 5 c $ e  $c d d D$L$L$8|$\5L$8L$dD$hD$\$D$D$ D$ D$<D$@L$pQT$ /e ;alD$|SHT$DL$HD$LD$PD$TD$X0D$L L$P$D$DD$YD$ L$L$TD$X$D$D$LD$D$ D$|(D$L$L$8|$\5yޛL$8L$dD$hD$\$D$D$ D$ D$<D$@L$pQT$$D$D$`+D$L$ D$ L$$1赩螑ye ;av B@D$ne ;avkzW_GG-e u<L$\$T$@$D$D$*D$L$ D$ L$$1ސye ;av B@D$讐e ;avkzW_GG-e u<L$\$T$>$D$D$)D$L$ D$ L$$15ye ;av B@D$e ;avkzW_GG-e u<L$\$T$=$D$D$ )D$L$ D$ L$$1u^ye ;aD$$|:L$ Q9|BI9‰$D$D$齖D$D$ `& $D$'D$ L$L$D$$D$D$D$D$ D$uL$ D$$g  'e ;aTWL$\f.D$4D$8B$L$&D$L$ L$4D$8S$D$'D$4D$D$ D$ŽD$XH`3$L$L$EaD$ D$0L$L$ T$T$\$X111&l$0tVAt$X͉Ɖ׋D$0L$ T$9}I [9l$,t$$|$($胼D$L$$ȋL$T$(ʋL$,\$9r4$|$bZD$L$\Y$D$$XD$ L$L$|$<1饛mD$D$D$ mD$D$D$ <$D$D$4˜{e ;aD$H~T$ 9$lD$H8 $L$ L$L$^D$ t8D$$D$D$D$D$D$ D$ QD$$D$(ËXd \d D$$L$(Ë`d dd D$$L$(言3e ;a<D$(D$,D$@H0L$$ $ŜD$$D$$WD$ML$@Q5YTl$L9T$Dd d e D$Hd T$(D$,T$(Zރ uˀD$0D$4D$8T$0D$4\$8APQLYH$T$D$D$0D$ D$D$ D$L$ T$\$@KP e CHSLD$LCTC,tTCLKPSH$D$L$D$ L$@Q9tATQ 9} J<É $ $L$@ԍ$>D$ 0m e uJL$@HQ$T$D$"e L$ uD$@H,PT$@z,xD$@╛ȋL$@맍{Hҕ{Lȕ111|=d D$H評>D$H5111T $L$@l$Ll$L<<}>e ;aD$ H~ T$49$D$ H8 $L$$L$L$(L$L$4L$ L$ D$L$t L$8D$<ËD$ $D$,D$D$0D$D$4D$ D$8D$<Ë`d dd D$8L$<|(e ;avnD$H0L$ $FœD$$ZD$HXL$ P\T$\$$\ŜD$$D$$D$ D$D$D$k|ve ;a,D$0H,HPPLXH$T$L$ݠD$ L$0QHYLiPl$(qTA q$i(iPAT-e uVAHqLAXŃq\AXq\L$T$ \$L$(L$|$l$D$ $PD$.,É|$$iHyL|$$뒃,É $e uD$0@,L$0y,1踒,{e ;a#D$H`L$ $rD$D$$WD$dD$HlT$ 9Xpl$$9݇Ç!9 tHh $ϪD$L$$T$ ͋Hl9Xp9!˄tыHttUp9}L$`'$T$l$ {D$D$HlPpHlPp@h$)c1멐UÍ0$D$ ye ;aD$H`L$ $"D$D$$WD$uvD$HtL$ `' $T$ T$\$$\$ 7wD$tLD$HtL$ `' $L$ L$L$$L$ }D$@h$$^ÐTÍ0$D$ x e ;aD$H`L$ $"D$ D$$WD$u| Hh $賨D$HpPl\$9‹l$9Ç!9 ʄtȋHt $KD$L$9‹\$l$9!9 ÄuD$됐XÐNw e ;aD|$1@ `' $L$HL$L$L$^ST$ \$D$$UD$ L$T$t0Z9ˇÇ9‡Ç!9ˇÇ u‰묉D$LL$PD=wHe ;avRBD$ HL$ @$6D$L$H e u L$ A8ËL$ y8N7ve ;avA D$H8 $L$ L$L$荽D$$D$$D$D$(D$ hve ;a$D$(D$L$,L$ T$0T$\$4\$l$8l$l$D$H$D$0$D$4$DŽ$DŽ$ Ë$$$L$L$Oe ;aD$(D$,D$0D$ H L$ $躔D$D$$WD$ΘD$ HSPI$ыD$L$T$ Be zJBL$$9|$$e L$D$ H$D$ HT$\$l$ t$e uCQh e u"pHL$(H@L$,D$0՘Ë|$eЍye밋T$ zemD$(D$,D$06՘D$(BJL$,D$0՘ÉÉ9eD$(H@D$,L$0ԘÐԘMe ;aDP|$(1eD$TH$L$ lod L$D$ D$}`D$TP ы$D$L$ L$LT$T$\$\$Hl$(,$T$L$_D$L$T$ \$L$$T$ D$TH$L$ od L$D$ D$_D$TP $T$L$ L$L$$L$ `D$L$D$XD$\D$`L$dPËD$D$XD$HD$\\$`D$LD$dPLe ;aBX$ D$D$@1'L$,T$dʋ+[mD$$ՋD$,HD$@T$h9|эࠩ$p D$L$@ D$4L$1T$0D$\$T$D$ L$T$T$0;|$DhD$0H$L$T$` ыD$ D$8L$L$ T$ZL$D$l$4,$ӋD$L$ T$D$(L$$D$\H$L$ od L$D$ D$]t$DgLD$L$=#!ƒ ЄD$\H$L$L$$L$L$(L$ ^D$L$L$pD$tXËD$\H L$< $莏D$ L$\Ae u'T$8QD$<$覒D$ D$pD$8D$tXÍyD$8Fa҉D$pL$tXËЋD$ $0Ie ;avq(D$D$ D$$@nD$D$,D$ L$0L$$$D$D$D$D$ D$!D$L$L$4D$8(Ise ;a4D$D$(D$,D$0nD$(D$8D$,L$L$0D$ D$$ L$ XDL$$$D$(D$D$ D$D$ D$aD$L$T$T$e ;aH`$D$L$PL$D$L$ T$1 t$(FЉډl$P9N\$(D$ L$4T$$D$L L$0 $ D$L$umL$ Q\$$9l$45e |uD%^늉D$,`$l$4l$L$\$ T$l$D$\$PD$,L$ D$8D$<D$@D$D`&$D$(D$ݖD$L$ D$8L$<`_D$@D$0D$Dc$D$FD$8D$D$ D$ޭD$L$D$XD$\D$`D$dL$hHÉL$XD$\T$`D$dD$hHE(e ;aED$$D$ D$CD$L$  wJu'D$$fUD$L$D$$L$(D$,ÃtD$$D$(D$,à t tu؅tstmH@ $D$ND$D$ R-D$tD$$D$(D$,ËD$$TD$L$D$$L$(D$,111D$$TD$L$L$$D$(D$, De ;aD$ $L$$L$D$L$ tltdt^uD$(D$,D$0ËD$@IT$ T$T$$T$$ыD$ L$T$D$(L$,T$01렋D$@IT$ T$T$$T$$ыD$L$T$ T$(D$,L$0'Ce ;av}D$HP $T$ L$D$ ,D$t/L$QI@9w)!ЉD$\$ } 0$8D$C͘ Bge ;a"Xe ;a-0t$@\wD$L$T$L$(ީ$qe |$|$,D$( $GD$4HP|$O e  O e uTL$,O @ $D$8D$D$UqD$(.U4D$TT$X0=e ;a@D$TL$PD$TL$P`$1|$D$TGe L$PL$DQAW e G@ $D$HD$D$LD$|$ D$D$D$D$L$ T$$tD$XL$\T$`@ËL$D L$$eD$ L$T$T$XD$\L$`@ÍWSbD$PS6D$DHP $T$ L$D$ 0D$L$T$PT$(T$TT$,D$0D$4D$8D$<D$0$zԖD$L$ D$0L$40$D$(D$TԖD$L$ D$8L$<53$D$D$0D$D$ D$֢L$D$D m;e ;a,`ީ$D$T$0-0,$\$T$D$ L$\$D$L$@T$0|$l͉D$4o >D$4$T$XD$TD$`$L$\L$D$ʚ;D$ gD$D$(ʚ;L$`)L$@D$D$, $D$L$(L$,HL$@H e L$lAT$XZl$T9M$t5e <ЅuV$|$lډɍV=ٍ0$$L$T$l$ \$D$L$l$YL$lT$XyL$lyr=RT$P\$xD$L4$l$蕝D$L$lAD$PP\$L9El$xt|5e u5U7$|$l؉U<ߍ 0 $l$xl$D$\$ T$l$D$\$PD$PL$l넉D$HT$D\$tD$`$L$\L$D$ʚ;D$ zD$D$$L$L$ T$`$T$\T$D$ʚ;D$ D$D$8L$L$D$,HP!фt@ T@HʁX݃Çށ^!΁ D$<$L$HL$L$LL$ND$ D$(HPL$T$L$, $D$<@ $D$@D$D$DD$D$D$D$>D$ L$$tD$xD$|$8ËD$(D$xD$|DŽ$8D$0D$4y$T$l$ݷD$L$ L$0D$4$D$8D$0D$D$ D$菇D$L$D$xD$|$8Í$Bߖ|$Ge u%D$xpD$|$8Í6֍$|$D$PD$q9e ;a TD$hD$lD$XH$L$P $2dD$XH,@,L$P $RgD$XD$$ H t/QY @D$8L$H t/QY @D$PL$T\$XT$\D$`D$d<111D$PD$TD$XD$\T$`L$d<ËD$8{'L$0Qk'ljD$4Y'mxÍgԺD'L$4Q-''v'9xe ;a(0D$4$۽D$D$ L$L$,$ ϖ|$D$ Ge D$,D$4H $L$8L$L$0D$4HP F$F˖|$D$4HPWe @$D$8D$D$lyd hyd |$Ge L$`AAe udyPmQe u!$A $A$ od Íy $Y y$$J =od = ̍Q/ 둉& fOϋ$ $y $y$$=xod KQ Oϋ$$_y $wy$$h=od [QJ}@POϋ$* $y $y$$=pod 5yljOϋ$}$Iy $y$$=Xod uyhkljZ8Oϋ$BD$|4y $ y$$=Pod &yljOϋ$n$:y $y$$=`od y\lju)Oϋ$]D$tOy $;y$$,=Hod QOϋ$_$+y $y$$=hod yMljOϋD$x{$j e ;a8lyd hyd $D$D$DD$D$HD$ D$D$D$SD$L$ D$$D$(D$$L$(D$<$D$@D$D$$D$D$ D$+UD$L$T$\$ u D$LL$P8ÉD$D$ L$ Xyd e \yd dd `d Pyd e Tyd $D$+=D$ L$ `yd e dyd 3$D$%.μD$D$ D$D$Se L$0 dod q#$D$$D$D$ D$D$Re L$ Dod 3$D$%μD$D$ D$D$cRe L$h \od g$D$(NμD$D$ D$D$Re L$ Lod ӽ$D$02ŽD$D$ /D$D$Qe L$ Tod $D$,⠽D$D$ ,D$D$mQe L$< lod j$D$-D$D$ -D$D$Qe L$ od QȽ$D$/ŽD$D$ /D$D$Pe L$ux tod ӽ$D$0D$D$ 7D$D${Pe L$u |od r-e Í=|od e܍=tod V|=od D=lod 2=Tod T=Lod =\od =Dod (=dod =dyd b=Tyd =\yd ךe ;avZ(B$D$,D$D$0D$D$4D$ D$8D$D$ )e )e e ;av9$Yu6t$(t /ܚpD$ L$L$,D$0$@ 뮍|$(9;u‰#e ;av9$Yu6t$(t ۚD$ L$L$,D$0$g@ `뮍|$(9;u‰#e ;av9$Yu6t$(t oۚD$ L$L$,D$0$@ 뮍|$(9;u‰#e ;av9$Yu6t$(t ۚD$ L$L$,D$0$? 蠽뮍|$(9;u‰#e ;avA(Yu>t$,t(ښ D$ L$$T$T$0D$4L$8(?? 8릍|$,9;u#e ;av9$Yu6t$(t ?ښ@D$ L$L$,D$0$> м뮍|$(9;u‰#e ;av/ Yu,D$@I$ыD$L$D$L$ z븍|$9;ủ#e ;av9Yu6t$ t ٚ0D$L$L$$D$(> 뮍|$ 9;u‰#e ;av/ Yu,D$@I$ыD$L$D$L$ 躻븍|$9;ủ#e ;av/ Yu,D$@I$ыD$L$D$L$ Z븍|$9;ủ#e ;avA Yu>t$$t(sؚ0D$L$T$T$(D$,L$0 < 躚릍|$$9;u#e ;av9Yu6t$ t ؚD$L$L$$D$(< 耺뮍|$ 9;u‰#e ;av1Yu.t$tךD$D$ /< (붍|$9;uʉ#e ;av9Yu6t$ t Cך`D$L$L$$D$(; 뮍|$ 9;u‰#e ;avEYuBD$t,HP$L$T$D$ L$D$L$ [; T뢍|$9;u#e ;avYD$$L$L$D$L$Q$D$D$xAD$ L$ $D$D$D$иe ;aD$H\$k39tI1Ʉt?KP9u1H@ S[ 9t 1D$É$\$L$WD$ 11ى$L$l$L$ D$\$$_e ;av. Yu+D$@L$ $ЋD$L$L$$D$( ˷빍|$9;u͉#e ;av. Yu+D$@L$ $ЋD$L$L$$D$( k빍|$9;u͉#e ;av. Yu+D$@L$ $ЋD$L$L$$D$( 빍|$9;u͉#e ;aD$@t)tD$D$ ÍźD$D$ ÍȲD$D$ Ãt0tutD$D$ ÍܴD$D$ ÍD$D$ Ã+uD$D$ ÍFD$D$ Ãt4 t >;eD$D$ Í0D$D$ Í ̻D$D$ 迵e ;aS0|$p1Κ ມ $^u|$|$, e t$8ҚD$hHL$$\$,9T$ \$(J,ىL$D$l$  $L$dL$D$D$lD$і|$p1N͚D$4D$pD$($D$$$D$ $0Í$T$,T$D$D$ L$\$T$D$hL$$+$|$D$8D$Ζ1 Be ;a D$$H(P$X j9?JH$k,<e u t$(њ Í$|$D$(D$6Ζ$\$T$L$ l$D$L$T$\$$S(e uC ʉʼn؉v{ ʚj5e ;avG|$1˚t$Nu&F N$u|$5 @КÍ|$4КÍ|$*Кe ;avxD$ H$P X(t:@tT$L$\$ÍC,ЉD$AD$\$Í$rrD$D$D$D$qle ;a;,L$0Qt1T$8Q$T$t$(t(0D$L$ T$T$,D$0L$4$! 蘟릍|$(9;u#e ;av1Yu.t$ t詼D$D$$?! 8붍|$ 9;uʉ#e ;av4>e vuJ >e 肙>e ՞e D$;A$1DŽ$DŽ$$Q$T$0$d$ $L$aD$0$D$0$@D$0D$$WD$$${D$u6$$/DŽ$DŽ$#%ĔÍ|$t19$Q$($+$$L$PԌe ;a`bW$D$L$lQ`|$01 l $T$L$0L$h D$0$jL$0T$4Y L$*R|$1賤L$L$\$ l$$T$(T$lT$,-,$t$t$L$\$ 辜|$ e ut$Cs`δ$|$D$D$6TD$D$p`谋e ;aPBV$D$L$\Qd|$ 1ݣ m$T$D$ D$f D$ $qiD$ tfHL$D$ $\$\$D$L$ Λ|$D$Ge uD$D$\G띋D$aD$\U놋D$D$`PŠe ;avD$L$L$D$舊e ;avD$L$ L$D$Xe D$;A$(1虢$荢$蔦$L$h$L$l$$L$pT$t$L$x$ L$|$$$3 $$֦$$$$$讦$($蛦$$L$PDe D$;ANS$ $L$@d|$(1a m$T$D$(D$d D$($fD$(t$,$gD$(HL$D$ |$X$F `l $$T$$$\$T$ 處D${$D$$  $T$T$\$ \$l$l$ ۘ|$D$Ge uD$ D$$G#D$ kD$$_ D$$Çe ;avD$D$D$D$與e D$;A$ 1ɟ$轟狴$ģ$L$h$L$l$ L$p$L$t$L$x$L$|$$c $$$$$$$ޣ$ $ˣ$$D$Hte ;abpQ$D$ L$|QdT$ m$T$tT$T$xT$ D$@PD$(|$@1p `l $L$(L$L$@L$a D$@$dD$@HL$D$$T$|Z`\$l$D$L$ ֒D$HT$tL$|$,1L$$L$,\$\$0T$4T$T$8T$|T$<-,$t$ t$L$\$ |$ e ut$,v7`δ$|$D$,D$iߋD$ $pㄚ~e ;a%drO$D$L$pQdT$ m$T$hT$\$l\$ bD$@PD$|$41 `l $L$L$L$4L$_ D$4$pbL$4IL$|$ 1蛜T$ L$L$$\$h\$(l$ll$,t$pt$054$t$t$T$L$ 螔|$ e ut$ #t$|$D$ D$UD$D$td萃e ;avD$L$L$D$Xe ;avD$L$ L$D$(e D$;A$ 1i$]$d$$ L$hT$l$$L$pT$t$L$x$L$|$$$$覟$$$$$~$ $k$$D$He ;a XD$HD$LD$PD$T0$L$dL$AD$ L$L$HD$L0$D$lD$D$ L$L$PD$TW$D$D$HD$D$ D$D$L$T$xL$(D$4T$\\$`R$ҋD$\L$L$0T$T$<\$`@$ЋD$\L$L$8T$T$,\$`@$ЋD$L$T$<$T$0T$T$8T$T$,T$ T$4T$T$(T$D$L$-D$$L$ $$XÉD$4L$(D$@D$D@$D$tD$eD$L$ D$@L$Dr)$D$ D$@D$D$ D$gD$L$$T$4T$T$(T$D$ L$녙D$L$e ;av',t$0朚D$(L$$L$TD$X,e ;a#`|$H1旚 0 $T$lT$L$T$ L$HT$L 0 $T$tT$L$T$ L$PT$T 0 $L$|L$L$T$ L$XT$\ uJ $D$&L$HL$D$ D$L$T$$T$(L$4D$d\$h@$ЋD$dL$L$0T$T$<\$h@$ЋD$dL$L$8T$T$,\$h@$ЋD$L$T$<$T$0T$T$8T$T$,T$ T$4T$T$(T$D$L$該D$$L$ $$`ÉL$4T$(D$@D$D@$$D$D$L$ D$@L$Dr)$D$ D$@D$D$ D$D$L$$T$4T$T$(T$D$ L$dL$T$R}e ;av'4t$8BD$0L$,L$dD$h4}e ;avg $<e |$|$ u(t$ND$ HT$|$$Í $|$D$D$|e $$;A\$1Ɣ  $!$ Ao$ 1j `l $$T$\$D$ b|$ e T>$ n$ 1cj `l $$T$\$D$ b|$ e =$ n$ 1 j `l $$T$\$D$ 0b|$ e ^=$ 6n$$4I m$$L$[T$D$ a|$e <$Hm$H1Ti `l $D$D$ L$ $$L1!i Q$LDŽ$P 5 $`DŽ$d `l$$\$L$D$ a|$ e <$L#m$L1h !$LDŽ$P$ c$`DŽ$d`l$$\$L$D$ `|$ e b;$Ll$L1h !$LDŽ$P$ c$`DŽ$d`l$$\$L$D$ `|$ e :$Ll$L1g Nм$LDŽ$P $`DŽ$d `l$$\$L$D$ _|$ e :$Lk$L1g !$LDŽ$P$ c$`DŽ$d`l$$\$L$D$ _|$ e s9$Lk$L1f "$LDŽ$P$ c$`DŽ$d`l$$\$L$D$ ^|$ e 8$Lj$L1f $LDŽ$P" A$`DŽ$d `l$$\$L$D$ ^|$ e )8$Lj$L1e %$LDŽ$P" B$`DŽ$d `l$$\$L$D$ ]|$ e 7$Li$L1 e nм$LDŽ$P #$`DŽ$d `l$$\$L$D$ ]|$ e 6$L i$L1d p$LDŽ$P $`DŽ$d `l$$\$L$D$ \|$ e :6$Lh$L1d $LDŽ$P $`DŽ$d `l$$\$L$D$ [|$ e 5$Lh$L1c $LDŽ$P $`DŽ$d `l$$\$L$D$ |[|$ e 4$Lg$L1b ͻ$LDŽ$P $`DŽ$d `l$$\$L$D$ Z|$ e K4$Lf$L1zb 컼$LDŽ$P $`DŽ$d `l$$\$L$D$ vZ|$ e 3$L|f$L1a $LDŽ$P $`DŽ$d `l$$\$L$D$ Y|$ e 3$Le$L1ta *$LDŽ$P $`DŽ$d `l$$\$L$D$ pY|$ e \2$Lve$L1` I$LDŽ$P $`DŽ$d `l$$\$L$D$ X|$ e 1$Ld$$4I m$$L$T$D$ X|$e <1$Hrd$H1`a $$$1_ `l $$T$c\$D$ X|$ e 0$$d$1_ `l $$T$c\$D$ W|$ e )0$c$1F_ `l $$T$c\$D$ lW|$ e /$rc$1^ `l $$T$\$D$ W|$ e 3/$c$1^ `l $$T$\$D$ V|$ e .$b$1;^ `l $$T$\$D$ aV|$ e =.$gb$$4I m$$L$vT$D$ V|$e -$Ha$H1] $ IDŽ$I $$$pG1T] `l $$T$ \$D$ zU|$ e -$pGa$pG1\ `l $$T$\$D$ !U|$ e ,$pG'a$$4I m$$L$/T$D$ T|$e ,$H`$H1E\ `l $D$D$L$ $$`F1\ `l $$T$c\$D$ 8T|$ e j+$`F>`$`F1[ `l $$T$c\$D$ S|$ e *$`F_$`F1`[ `l $$T$ \$D$ S|$ e t*$`F_$`F1[ `l $$T$c\$D$ -S|$ e )$`F3_$`F1Z `l $$T$c\$D$ R|$ e ~)$`F^$`F1UZ `l $$T$A\$D$ {R|$ e )$`F^$`F1Y `l $$T$B\$D$ "R|$ e ($`F(^$`F1Y `l $$T$\$D$ Q|$ e  ($`F]$`F1JY `l $$T$\$D$ pQ|$ e '$`Fv]$`F1X `l $$T$\$D$ Q|$ e '$`F]$`F1X o$`FDŽ$dF* $tFDŽ$xF `l$$\$-ll$D$ P|$ e l&$`F\$`F1X `l $$T$\$D$ 5P|$ e %$`F;\$`F1W $`FDŽ$dF* $tFDŽ$xF `l$$\$- ml$D$ O|$ e F%$`F[$`F1-W `l $$T$\$D$ SO|$ e $$`FY[$`F1V Æ$`FDŽ$dF* $tFDŽ$xF `l$$\$-ml$D$ N|$ e  $$`FZ$`F1KV `l $$T$\$D$ qN|$ e #$`FwZ$`F1U 톽$`FDŽ$dF* $tFDŽ$xF `l$$\$-)ml$D$ M|$ e "$`FY$$4I m$$L$QT$D$ M|$e "$HmY$H1 U `l $D$D$L$ $$A1T `l $$T$5 \$D$ L|$ e !$AY$A1T `l $$T$c\$D$ L|$ e R!$AX$A1'T `l $$T$c\$D$ ML|$ e  $ASX$A1S `l $$T$ \$D$ K|$ e \ $AW$A1uS `l $$T$c\$D$ K|$ e $AW$A1S `l $$T$c\$D$ BK|$ e f$AHW$A1R `l $$T$A\$D$ J|$ e $AV$A1jR `l $$T$B\$D$ J|$ e p$AV$A1R `l $$T$#\$D$ 7J|$ e $A=V$A1Q `l $$T$\$D$ I|$ e z$AU$A1_Q `l $$T$\$D$ I|$ e $AU$A1Q `l $$T$\$D$ ,I|$ e $A2U$A1P `l $$T$\$D$ H|$ e  $AT$A1TP `l $$T$\$D$ zH|$ e $AT$A1O `l $$T$\$D$ !H|$ e $A'T$A1O `l $$T$\$D$ G|$ e $AS$A1IO `l $$T$\$D$ oG|$ e $AuS$$4I m$$L$!T$D$ G|$e $HR$H1N $HDŽ$H"`$|$$ e (5`FS$$HDŽ$HDŽ$I$ IDŽ$I `l $D$D$D$ $$=1M `l $$T$5 \$D$ F|$e I$=R$=1M `l $$T$c\$D$ E|$ e $=Q$=1(M `l $$T$c\$D$ NE|$ e S$=TQ$=1L `l $$T$ \$D$ D|$ e $=P$=1vL `l $$T$c\$D$ D|$ e ]$=P$=1L `l $$T$c\$D$ CD|$ e $=IP$=1K `l $$T$A\$D$ C|$ e g$=O$=1kK `l $$T$B\$D$ C|$ e $=O$=1K `l $$T$#\$D$ 8C|$ e q$=>O$=1J `l $$T$\$D$ B|$ e $=N$=1`J `l $$T$\$D$ B|$ e {$=N$=1J `l $$T$\$D$ -B|$ e $=3N$=1I `l $$T$\$D$ A|$ e $=M$=1UI `l $$T$\$D$ {A|$ e  $=M$=1H `l $$T$\$D$ "A|$ e $=(M$=1H `l $$T$\$D$ @|$ e $=L$=1JH `l $$T$\$D$ p@|$ e $=vL$$4I m$$L$T$D$ @|$e $HK$H1G `ȡ $|$ lhO e $HDŽ$HDŽ$IG $ IDŽ$I ~$$$81G `l $$T$c\$D$ ;?|$e $8AK$81F `l $$T$c\$D$ >|$ e $8J$81cF `l $$T$c\$D$ >|$ e  $8J$81 F `l $$T$c\$D$ 0>|$ e  $86J$81E `l $$T$B\$D$ =|$ e * $8I$81XE `l $$T$\$D$ ~=|$ e  $8I$81D `l $$T$\$D$ %=|$ e 4 $8+I$81D `l $$T$\$D$ <|$ e  $8H$$4I m$$L$!T$D$ s<|$e > $HQH$H1C `l $D$ D$L$ $$71C `l $$T$c\$D$ ;|$ e  $7G$71dC `l $$T$c\$D$ ;|$ e  $7G$71 C `l $$T$ \$D$ 1;|$ e  $77G$71B `l $$T$c\$D$ :|$ e  $7F$71YB `l $$T$c\$D$ :|$ e $7F$71B `l $$T$B\$D$ &:|$ e %$7,F$71A `l $$T$\$D$ 9|$ e $7E$71NA `l $$T$\$D$ t9|$ e /$7zE$71@ `l $$T$\$D$ 9|$ e $7!E$71@ `l $$T$\$D$ 8|$ e 9$7D$71C@ `l $$T$\$D$ i8|$ e $7oD$$4I m$$L$T$D$ 8|$e C$HC$H1? `l $D$ D$DL$ $$`51Z? `l $$T$c\$D$ 7|$ e $`5C$`51? `l $$T$c\$D$ '7|$ e $`5-C$`51> `l $$T$ \$D$ 6|$ e $`5B$`51O> `l $$T$c\$D$ u6|$ e  $`5{B$`51= `l $$T$c\$D$ 6|$ e $`5"B$`51= `l $$T$A\$D$ 5|$ e *$`5A$`51D= `l $$T$B\$D$ j5|$ e $`5pA$`51< `l $$T$\$D$ 5|$ e 4$`5A$`51< `l $$T$\$D$ 4|$ e $`5@$`519< `l $$T$\$D$ _4|$ e >$`5e@$`51; `l $$T$\$D$ 4|$ e $`5 @$`51; `l $$T$\$D$ 3|$ e H$`5?$$4I m$$L$aκT$D$ T3|$e $H2?$H1: ` $8|$$ e k5p?$$HDŽ$HDŽ$I`l$D$D$2D$ $$21H: `l $$T$5 \$D$ n2|$e $2t>$219 `l $$T$c\$D$ 2|$ e )$2>$219 `l $$T$c\$D$ 1|$ e $2=$21=9 `l $$T$ \$D$ c1|$ e 3$2i=$218 `l $$T$c\$D$  1|$ e $2=$218 `l $$T$c\$D$ 0|$ e =$2<$2128 `l $$T$A\$D$ X0|$ e $2^<$217 `l $$T$B\$D$ /|$ e G$2<$217 `l $$T$#\$D$ /|$ e $2;$21'7 `l $$T$\$D$ M/|$ e Q$2S;$216 `l $$T$\$D$ .|$ e $2:$21u6 `l $$T$\$D$ .|$ e [$2:$216 `l $$T$\$D$ B.|$ e $2H:$215 `l $$T$\$D$ -|$ e e$29$21j5 `l $$T$\$D$ -|$ e $29$215 `l $$T$\$D$ 7-|$ e o$2=9$214 `l $$T$\$D$ ,|$ e $28$$4I m$$L$0T$D$ ,|$e y$Hc8$H14 $HDŽ$H"`$Qە|$$ e 58$$HDŽ$HDŽ$I+$ IDŽ$I `l $D$ D$3D$ $$,1I3 `l $$T$c\$D$ o+|$e  $,u7$,12 `l $$T$c\$D$ +|$ e $,7$,12 `l $$T$ \$D$ *|$ e *$,6$,1>2 `l $$T$c\$D$ d*|$ e $,j6$,11 `l $$T$c\$D$  *|$ e 4$,6$,11 `l $$T$A\$D$ )|$ e $,5$,131 `l $$T$B\$D$ Y)|$ e >$,_5$,10 `l $$T$\$D$ )|$ e $,5$,10 `l $$T$\$D$ (|$ e H$,4$,1(0 `l $$T$\$D$ N(|$ e $,T4$,1/ `l $$T$\$D$ '|$ e R$,3$,1v/ `l $$T$\$D$ '|$ e $,3$,1/ `l $$T$\$D$ C'|$ e \$,I3$$4I m$$L$+T$D$ &|$e $H2$H1g. `l $D$D$L$ $$$14. `l $$T$c\$D$ Z&|$ e /$$`2$$1- `l $$T$c\$D$ &|$ e $$2$$1- `l $$T$ \$D$ %|$ e 9$$1$$1)- `l $$T$c\$D$ O%|$ e $$U1$$1, `l $$T$c\$D$ $|$ e C$$0$$1w, `l $$T$A\$D$ $|$ e $$0$$1, `l $$T$B\$D$ D$|$ e M$$J0$$1+ `l $$T$#\$D$ #|$ e $$/$$1l+ `l $$T$\$D$ #|$ e W$$/$$1+ `l $$T$\$D$ 9#|$ e $$?/$$1* `l $$T$\$D$ "|$ e a$$.$$1a* `l $$T$\$D$ "|$ e $$.$$1* `l $$T$\$D$ ."|$ e k$$4.$$1) `l $$T$\$D$ !|$ e $$-$$1V) `l $$T$\$D$ |!|$ e u$$-$$1( `l $$T$\$D$ #!|$ e $$)-$$4I m$$L$wT$D$  |$e $H,$H1G( !$HDŽ$H DŽ$Htڕ $$$$1 ( 2$$DŽ$( $8DŽ$< `l$$\$-!l$D$  |$ e $$,$$4I m$$L$lT$D$ |$e $H+$H1%' !$HDŽ$H DŽ$HRٕ $$$|1& Q$|DŽ$ $DŽ$ `l$$\$-!l$D$ |$ e .$|*$$4I m$$L$2T$D$ |$e $Hd*$H1& !$HDŽ$H DŽ$H$,IDŽ$0I`ȡ$/͕|$ tpO e %$HDŽ$HDŽ$Iו$$$1a% $DŽ$  `ȡ $̕|$| xGe $DŽ$DŽ$$DŽ$  `l $$T$!\$D$ |$e $)$$4I m$$L$+T$D$ |$e $H($H1-$}֕ $$$P1$ `l $$T$c\$D$ :|$ e $P@($P1# `l $$T$c\$D$ |$ e p$P'$P1b# `l $$T$\$D$ |$ e $P'$P1 # `l $$T$\$D$ /|$ e z$P5'$P1" `l $$T$\$D$ |$ e $P&$P1W" `l $$T$\$D$ }|$ e $P&$$4I m$$L$#кT$D$ $|$e  $H&$H1! `l $D$ D$XԕL$ $$1n! `l $$T$c\$D$ |$ e W$%$1! `l $$T$c\$D$ ;|$ e $A%$1 `l $$T$A\$D$ |$ e a$$$1c `l $$T$B\$D$ |$ e $$$1 `l $$T$\$D$ 0|$ e k$6$$1 `l $$T$\$D$ |$ e $#$1X `l $$T$\$D$ ~|$ e u$#$1 `l $$T$\$D$ %|$ e $+#$1 `l $$T$\$D$ |$ e $"$$4I m$$L$dT$D$ s|$e $HQ"$H1 `l $D$D$ЕL$ $$ 1 `l $$T$5 \$D$ |$ e R$ !$ 1d `l $$T$c\$D$ |$ e $ !$ 1  `l $$T$c\$D$ 1|$ e \$ 7!$ 1 `l $$T$ \$D$ |$ e $ $ 1Y `l $$T$c\$D$ |$ e f$ $ 1 `l $$T$c\$D$ &|$ e $ , $ 1 `l $$T$A\$D$ |$ e p$ $ 1N `l $$T$B\$D$ t|$ e $ z$ 1 `l $$T$#\$D$ |$ e z$ !$ 1 `l $$T$\$D$ |$ e $ $ 1C `l $$T$\$D$ i|$ e $ o$ 1 `l $$T$\$D$ |$ e  $ $ 1 `l $$T$\$D$ |$ e $ $ 18 `l $$T$\$D$ ^|$ e $ d$ 1 `l $$T$\$D$ |$ e $ $ 1 `l $$T$\$D$ |$ e $ $ 1- `l $$T$\$D$ S|$ e $ Y$$4I m$$L$eT$D$ |$e '$H$H1w !$HDŽ$H DŽ$Hɕ $$$x 1; -$x DŽ$|  ` $膾|$$ e m5$$ DŽ$ DŽ$ $ DŽ$ `l $$T$!\$D$ |$e $x $$4I m$$L$"T$D$ |$e J$H`$H1 `l $D$ D$ȕL$ $$4 1 `l $$T$c\$D$  |$ e $4 $4 1s `l $$T$c\$D$  |$ e $4 $4 1 `l $$T$c\$D$ @ |$ e $4 F$4 1 `l $$T$A\$D$ |$ e '$4 $4 1h `l $$T$B\$D$ |$ e $4 $4 1 `l $$T$\$D$ 5 |$ e 1$4 ;$4 1 `l $$T$\$D$ |$ e $4 $4 1] `l $$T$\$D$ |$ e ;$4 $4 1 `l $$T$\$D$ * |$ e $4 0$4 1 `l $$T$\$D$ |$ e E$4 $$4I m$$L$T$D$ x |$e $HV$H1 $ IDŽ$I`l$D$D$ĕL$ $$ 1 `l $$T$c\$D$  |$ e $ $ 1Q `l $$T$c\$D$ w |$ e $ }$ 1 `l $$T$ \$D$  |$ e  $ $$ 1 `l $$T$c\$D$ |$ e $ $ 1F `l $$T$c\$D$ l|$ e $ r$ 1 `l $$T$A\$D$ |$ e $ $ 1 `l $$T$B\$D$ |$ e $ $ 1; `l $$T$#\$D$ a|$ e $ g$ 1 `l $$T$\$D$ |$ e ($ $ 1 `l $$T$\$D$ |$ e $ $ 10 `l $$T$\$D$ V|$ e 2$ \$ 1 `l $$T$\$D$ |$ e $ $ 1~ `l $$T$\$D$ |$ e <$ $ 1% `l $$T$\$D$ K|$ e $ Q$ 1 `l $$T$\$D$ |$ e F$ $$4I m$$L$ "T$D$ |$e ˿$Hw$H1 `l $D$ D$;L$ $$ 1 `l $$T$c\$D$  |$ e $ $ 1 `l $$T$c\$D$ |$ e $ $ 11 `l $$T$c\$D$ W|$ e #$ ]$ 1 `l $$T$c\$D$ |$ e $ $ 1 `l $$T$B\$D$ |$ e -$ $ 1& `l $$T$\$D$ L|$ e $ R$ 1 `l $$T$\$D$ |$ e 7$ $ 1t `l $$T$\$D$ |$ e $ $ 1 `l $$T$\$D$ A|$ e A$ G $ 1 `l $$T$\$D$ |$ e ƺ$ $$4I m$$L$0T$D$ |$e K$Hm $H1  `l $D$D$úL$ $$h 1 `l $$T$5 \$D$ |$ e $h  $h 1 `l $$T$c\$D$ |$ e $h $h 1' `l $$T$c\$D$ M|$ e $h S $h 1 `l $$T$ \$D$ |$ e ($h $h 1u `l $$T$c\$D$ |$ e $h $h 1 `l $$T$c\$D$ B|$ e 2$h H $h 1 `l $$T$A\$D$ |$ e $h $h 1j `l $$T$B\$D$ |$ e <$h $h 1 `l $$T$#\$D$ 7|$ e $h = $h 1 `l $$T$\$D$ |$ e F$h $h 1_ `l $$T$\$D$ |$ e ˴$h $h 1 `l $$T$\$D$ ,|$ e P$h 2$h 1 `l $$T$\$D$ |$ e ճ$h $h 1T `l $$T$\$D$ z|$ e Z$h $h 1 `l $$T$\$D$ !|$ e ߲$h '$h 1 `l $$T$\$D$ |$ e d$h $h 1I `l $$T$\$D$ o|$ e $h u$$4I m$$L$*"T$D$ |$e n$H$H1 `l $D$D$JL$ $$$ 1` `l $$T$c\$D$ |$ e $$ $$ 1 `l $$T$c\$D$ -|$ e A$$ 3$$ 1 `l $$T$ \$D$ |$ e Ư$$ $$ 1U `l $$T$c\$D$ {|$ e K$$ $$ 1 `l $$T$c\$D$ "|$ e Ю$$ ($$ 1 `l $$T$A\$D$ |$ e U$$ $$ 1J `l $$T$B\$D$ p|$ e ڭ$$ v$$ 1 `l $$T$\$D$ |$ e _$$ $$ 1 `l $$T$\$D$ |$ e $$ $$ 1? `l $$T$\$D$ e|$ e i$$ k$$ 1 `l $$T$\$D$ |$ e $$ $$ 1 `l $$T$\$D$ |$ e s$$ $$ 14 B$$ DŽ$( & $8 DŽ$< `l$$\$-ll$D$ *|$ e Ȫ$$ 0$$ 1 `l $$T$\$D$ |$ e M$$ $$ 1R B$$ DŽ$( & $8 DŽ$< `l$$\$- ml$D$ H|$ e $$ N$$ 1 `l $$T$\$D$ |$ e '$$ $$ 1p B$$ DŽ$( & $8 DŽ$< `l$$\$-ml$D$ f|$ e |$$ l$$ 1 `l $$T$\$D$ |$ e $$ $$ 1 C$$ DŽ$( & $8 DŽ$< `l$$\$-)ml$D$ |$ e V$$ $$4I m$$L$T$D$ +|$e ۦ$H $H1 `l $D$D$_L$ $$ 1u `l $$T$c\$D$ |$ e )$ $ 1 `l $$T$c\$D$ B|$ e $ H$ 1 `l $$T$ \$D$ |$ e 3$ $ 1j `l $$T$c\$D$ |$ e $ $ 1 `l $$T$c\$D$ 7|$ e =$ =$ 1 `l $$T$A\$D$ |$ e £$ $ 1_ `l $$T$B\$D$ |$ e G$ $ 1 `l $$T$\$D$ ,|$ e ̢$ 2$ 1 `l $$T$\$D$ |$ e Q$ $ 1T `l $$T$\$D$ z|$ e ֡$ $ 1 $ DŽ$ * A$ DŽ$ `l$$\$- l$D$ |$ e +$ $ 1r `l $$T$\$D$ |$ e $ $ 1 `l $$T$\$D$ ?|$ e 5$ E$ 1 `l $$T$\$D$ |$ e $ $ 1g `l $$T$\$D$ |$ e ?$ $ 1 `l $$T$\$D$ 4|$ e Ğ$ :$$4I m$$L$H"T$D$ |$e I$H$H1X `l $D$D$L$ $$ 1% `l $$T$5 \$D$ K|$ e $ Q$ 1 `l $$T$c\$D$ |$ e $ $ 1s `l $$T$c\$D$ |$ e $ $ 1 `l $$T$ \$D$ @|$ e &$ F$ 1 `l $$T$c\$D$ |$ e $ $ 1h `l $$T$c\$D$ |$ e 0$ $ 1 `l $$T$A\$D$ 5|$ e $ ;$ 1 `l $$T$B\$D$ |$ e :$ $ 1] `l $$T$#\$D$ |$ e $ $ 1 `l $$T$\$D$ *|$ e D$ 0$ 1 `l $$T$\$D$ |$ e ɘ$ $ 1R `l $$T$\$D$ x|$ e N$ ~$ 1 `l $$T$\$D$ |$ e ӗ$ %$ 1 `l $$T$\$D$ |$ e X$ $ 1G LV$ DŽ$ ' $ DŽ$ `l$$\$-ll$D$ =|$ e $ C$ 1 `l $$T$\$D$ |$ e 2$ $ 1e sV$ DŽ$ ' $ DŽ$ `l$$\$- ml$D$ [|$ e $ a$ 1 `l $$T$\$D$ |$ e  $ $ 1 V$ DŽ$ ' $ DŽ$ `l$$\$-ml$D$ y|$ e a$ $ 1 `l $$T$\$D$ |$ e $ &$ 1 V$ DŽ$ ' $ DŽ$ `l$$\$-)ml$D$ |$ e ;$ $$4I m$$L$R"T$D$ >|$e $H$H1 `l $D$D$rL$ $$X 1 `l $$T$c\$D$ |$ e $X $X 1/ `l $$T$c\$D$ U|$ e $X [$X 1 `l $$T$ \$D$ |$ e $X $X 1} `l $$T$c\$D$ |$ e $X $X 1$ `l $$T$c\$D$ J|$ e "$X P$X 1 `l $$T$A\$D$ |$ e $X $X 1r `l $$T$B\$D$ |$ e ,$X $X 1 `l $$T$\$D$ ?|$ e $X E$X 1 `l $$T$\$D$ ߕ|$ e 6$X $X 1g `l $$T$\$D$ ߕ|$ e $X $X 1 `l $$T$\$D$ 4ߕ|$ e @$X :$X 1 `l $$T$\$D$ ޕ|$ e Ō$X $X 1\ `l $$T$\$D$ ޕ|$ e J$X $X 1 `l $$T$\$D$ )ޕ|$ e ϋ$X /$X 1 `l $$T$\$D$ ݕ|$ e T$X $$4I m$$L$AT$D$ wݕ|$e ي$HU$H1 `l $D$ D$諗L$ $$ 1 `l $$T$c\$D$ ܕ|$ e '$ $ 1h `l $$T$c\$D$ ܕ|$ e $ $ 1 `l $$T$c\$D$ 5ܕ|$ e 1$ ;$ 1 `l $$T$c\$D$ ە|$ e $ $ 1] `l $$T$A\$D$ ە|$ e ;$ $ 1 `l $$T$B\$D$ *ە|$ e $ 0$ 1 `l $$T$\$D$ ڕ|$ e E$ $ 1R `l $$T$\$D$ xڕ|$ e ʆ$ ~$ 1 `l $$T$\$D$ ڕ|$ e O$ %$ 1 `l $$T$\$D$ ٕ|$ e ԅ$ $ 1G `l $$T$\$D$ mٕ|$ e Y$ s$ 1 `l $$T$\$D$ ٕ|$ e ބ$ $$4I m$$L$T$D$ ؕ|$e c$H$H18 `l $D$ D$L$ $$ 1 `l $$T$c\$D$ +ؕ|$ e $ 1$ 1ߙ `l $$T$c\$D$ ו|$ e 6$ $ 1Sߙ `l $$T$ \$D$ yו|$ e $ $ 1ޙ `l $$T$c\$D$  ו|$ e @$ &$ 1ޙ `l $$T$c\$D$ ֕|$ e Ł$ $ 1Hޙ `l $$T$A\$D$ n֕|$ e J$ t$ 1ݙ `l $$T$B\$D$ ֕|$ e π$ $ 1ݙ `l $$T$\$D$ Օ|$ e T$ $ 1=ݙ `l $$T$\$D$ cՕ|$ e $ i$ 1ܙ `l $$T$\$D$ Օ|$ e ^$ $ 1ܙ `l $$T$\$D$ ԕ|$ e ~$ $ 12ܙ `l $$T$\$D$ Xԕ|$ e h~$ ^$$4I m$$L$@T$D$ ӕ|$e }$Hߙ$H1|ۙ `l $D$ D$3L$ $$H 1Iۙ `l $$T$c\$D$ oӕ|$ e ;}$H uߙ$H 1ڙ `l $$T$c\$D$ ӕ|$ e |$H ߙ$H 1ڙ `l $$T$ \$D$ ҕ|$ e E|$H ޙ$H 1>ڙ `l $$T$c\$D$ dҕ|$ e {$H jޙ$H 1ٙ `l $$T$c\$D$  ҕ|$ e O{$H ޙ$H 1ٙ `l $$T$A\$D$ ѕ|$ e z$H ݙ$H 13ٙ `l $$T$B\$D$ Yѕ|$ e Yz$H _ݙ$H 1ؙ `l $$T$\$D$ ѕ|$ e y$H ݙ$H 1ؙ `l $$T$\$D$ Е|$ e cy$H ܙ$H 1(ؙ `l $$T$\$D$ NЕ|$ e x$H Tܙ$H 1י `l $$T$\$D$ ϕ|$ e mx$H ۙ$H 1vי `l $$T$\$D$ ϕ|$ e w$H ۙ$$4I m$$L$0T$D$ Cϕ|$e ww$H!ۙ$H1֙ `l $D$ D$wL$ $$ 1֙ `l $$T$c\$D$ Ε|$ e v$ ڙ$ 14֙ `l $$T$c\$D$ ZΕ|$ e Jv$ `ڙ$ 1ՙ `l $$T$ \$D$ Ε|$ e u$ ڙ$ 1ՙ `l $$T$c\$D$ ͕|$ e Tu$ ٙ$ 1)ՙ `l $$T$c\$D$ O͕|$ e t$ Uٙ$ 1ԙ `l $$T$B\$D$ ̕|$ e ^t$ ؙ$ 1wԙ `l $$T$\$D$ ̕|$ e s$ ؙ$ 1ԙ `l $$T$\$D$ D̕|$ e hs$ Jؙ$ 1ә `l $$T$\$D$ ˕|$ e r$ י$ 1lә `l $$T$\$D$ ˕|$ e rr$ י$ 1ә `l $$T$\$D$ 9˕|$ e q$ ?י$$4I m$$L$AT$D$ ʕ|$e |q$H֙$H1]ҙ `ȡ $y|$ O e )q$HDŽ$HDŽ$I`l$D$ D$ƄD$ $$1љ `l $$T$c\$D$ ʕ|$e rp$֙$1љ `l $$T$c\$D$ ɕ|$ e o$ՙ$1*љ `l $$T$A\$D$ Pɕ|$ e |o$Vՙ$1Й `l $$T$B\$D$ ȕ|$ e o$ԙ$1xЙ `l $$T$\$D$ ȕ|$ e n$ԙ$1Й `l $$T$\$D$ Eȕ|$ e  n$Kԙ$1ϙ `l $$T$\$D$ Ǖ|$ e m$ә$1mϙ `l $$T$\$D$ Ǖ|$ e m$ә$1ϙ `l $$T$\$D$ :Ǖ|$ e l$@ә$$4I m$$L$z"T$D$ ƕ|$e l$Hҙ$H1^Ι讀 $$$|1EΙ `l $$T$\$D$ kƕ|$ e k$|qҙ$|1͙ `l $$T$\$D$ ƕ|$ e  k$|ҙ$|1͙ `l $$T$\$D$ ŕ|$ e j$|љ$|1:͙ `l $$T$\$D$ `ŕ|$ e j$|fљ$$4I m$$L$T$D$ ŕ|$e i$HЙ$H1̙ `l $D$D$;L$ $$81Q̙ `l $$T$5 \$D$ wĕ|$ e h$8}Й$81˙ `l $$T$c\$D$ ĕ|$ e nh$8$Й$81˙ `l $$T$c\$D$ Õ|$ e g$8ϙ$81F˙ `l $$T$ \$D$ lÕ|$ e xg$8rϙ$81ʙ `l $$T$c\$D$ Õ|$ e f$8ϙ$81ʙ `l $$T$c\$D$ •|$ e f$8Ι$81;ʙ `l $$T$A\$D$ a•|$ e f$8gΙ$81ə `l $$T$B\$D$ •|$ e e$8Ι$81ə `l $$T$#\$D$ |$ e e$8͙$810ə `l $$T$\$D$ V|$ e d$8\͙$81ș `l $$T$\$D$ |$ e d$8͙$81~ș `l $$T$\$D$ |$ e c$8̙$81%ș `l $$T$\$D$ K|$ e %c$8Q̙$81Ǚ `l $$T$\$D$ |$ e b$8˙$81sǙ `l $$T$\$D$ 虿|$ e /b$8˙$81Ǚ `l $$T$\$D$ @|$ e a$8F˙$81ƙ `l $$T$\$D$ 羕|$ e 9a$8ʙ$$4I m$$L$GкT$D$ 莾|$e `$Hlʙ$H1 ƙ[x $$$1ř `l $$T$\$D$ |$ e &`$ʙ$$4I m$$L$T$D$ 追|$e _$Hə$H1<řw $$$1#ř `l $$T$c\$D$ I|$ e _$Oə$1ę `l $$T$c\$D$ |$ e ^$ș$1qę `l $$T$\$D$ 藼|$ e ^$ș$1ę `l $$T$\$D$ >|$ e ]$Dș$1Ù `l $$T$\$D$ 廕|$ e ']$Ǚ$$4I m$$L$'BT$D$ 茻|$e \$HjǙ$H1 Ù `l $D$ D$uL$ $$l1™ `l $$T$c\$D$ |$ e [$lǙ$l1}™ `l $$T$c\$D$ 裺|$ e [$lƙ$l1$™ `l $$T$c\$D$ J|$ e [$lPƙ$l1 `l $$T$c\$D$ |$ e Z$lř$l1r `l $$T$B\$D$ 蘹|$ e Z$lř$l1 `l $$T$\$D$ ?|$ e Y$lEř$l1 `l $$T$\$D$ 渕|$ e Y$lę$l1g `l $$T$\$D$ 荸|$ e X$lę$l1 `l $$T$\$D$ 4|$ e "X$l:ę$l1赿 `l $$T$\$D$ ۷|$ e W$lÙ$$4I m$$L$VT$D$ 肷|$e ,W$H`Ù$H1 `l $D$ D$qL$ $$(1̾ `l $$T$c\$D$ |$ e zV$(™$(1s `l $$T$ \$D$ 虶|$ e U$(™$(1 `l $$T$c\$D$ @|$ e U$(F™$(1 `l $$T$c\$D$ 絕|$ e  U$($(1h `l $$T$B\$D$ 莵|$ e T$($(1 `l $$T$\$D$ 5|$ e T$(;$(1趼 `l $$T$\$D$ ܴ|$ e S$($(1] `l $$T$\$D$ 胴|$ e S$($(1 `l $$T$\$D$ *|$ e R$(0$(1諻 `l $$T$\$D$ ѳ|$ e 'R$(׿$(1R `l $$T$\$D$ x|$ e Q$(~$$4I m$$L$T$D$ |$e 1Q$H$H1蜺l $$$1胺 `l $$T$\$D$ 該|$ e P$课$$4I m$$L$"T$D$ P|$e P$H.$H1͹ `l $D$D$lL$ $$1蚹 `l $$T$c\$D$ |$ e lO$ƽ$1A `l $$T$c\$D$ g|$ e N$m$1踙 `l $$T$ \$D$ |$ e vN$$1菸 `l $$T$c\$D$ 走|$ e M$軼$16 `l $$T$c\$D$ \|$ e M$b$1ݷ `l $$T$A\$D$ |$ e M$ $1脷 `l $$T$B\$D$ 誯|$ e L$谻$1+ `l $$T$#\$D$ Q|$ e L$W$1Ҷ `l $$T$\$D$ |$ e K$$1y `l $$T$\$D$ 蟮|$ e K$襺$1 `l $$T$\$D$ F|$ e J$L$1ǵ `l $$T$\$D$ |$ e #J$$1n `l $$T$\$D$ 蔭|$ e I$蚹$1 `l $$T$\$D$ ;|$ e -I$A$1輴 `l $$T$\$D$ ⬕|$ e H$踙$1c `l $$T$\$D$ 艬|$ e 7H$菸$$4I m$$L$=ST$D$ 0|$e G$H$H1譳e $$$\1蔳 `l $$T$\$D$ 身|$ e $G$\$$4I m$$L$?T$D$ a|$e F$H?$H1޲ `l $D$D$eL$ $$1諲 `l $$T$5 \$D$ Ѫ|$ e E$׶$1R `l $$T$c\$D$ x|$ e |E$~$1 `l $$T$c\$D$ |$ e E$%$1蠱 `l $$T$ \$D$ Ʃ|$ e D$̵$1G `l $$T$c\$D$ m|$ e  D$s$1 `l $$T$c\$D$ |$ e C$$1蕰 `l $$T$A\$D$ 軨|$ e C$$1< `l $$T$B\$D$ b|$ e B$h$1㯙 `l $$T$#\$D$ |$ e B$$1芯 `l $$T$\$D$ 谧|$ e A$足$11 `l $$T$\$D$ W|$ e )A$]$1خ `l $$T$\$D$ |$ e @$$1 `l $$T$\$D$ 襦|$ e 3@$諲$1& `l $$T$\$D$ L|$ e ?$R$1ͭ `l $$T$\$D$ |$ e =?$$1t `l $$T$\$D$ 蚥|$ e >$蠱$1 `l $$T$\$D$ A|$ e G>$G$$4I m$$L$T$D$ 褕|$e =$Hư$H1e^ $$$1L $DŽ$B$DŽ$ `l$$l$T$D$ H|$ e  =$N$1ɫ (k$DŽ$$DŽ$ `l$$l$T$D$ ţ|$ e e<$˯$1F ^k$DŽ$$DŽ$ `l$$l$T$D$ B|$ e ;$H$1ê yk$DŽ$$DŽ$ `l$$l$T$D$ 迢|$ e ;$Ů$1@ k$DŽ$$DŽ$ `l$$l$T$D$ <|$ e v:$B$$4I m$$L$T$D$ 㡕|$e 9$H$H1` `l $D$D$\L$ $$1- `l $$T$c\$D$ S|$ e I9$Y$1Ԩ `l $$T$c\$D$ |$ e 8$$1{ `l $$T$ \$D$ 衠|$ e S8$觬$1" `l $$T$c\$D$ H|$ e 7$N$1ɧ `l $$T$c\$D$ |$ e ]7$$1p `l $$T$A\$D$ 薟|$ e 6$蜫$1 `l $$T$B\$D$ =|$ e g6$C$1辦 `l $$T$\$D$ 䞕|$ e 5$ꪙ$1e `l $$T$\$D$ 苞|$ e q5$葪$1 `l $$T$\$D$ 2|$ e 4$8$1賥 `l $$T$\$D$ ٝ|$ e {4$ߩ$1Z `l $$T$\$D$ 耝|$ e 4$膩$1 `l $$T$\$D$ '|$ e 3$-$1訤 `l $$T$\$D$ Μ|$ e  3$Ԩ$$4I m$$L$@T$D$ u|$e 2$HS$H1 ` $YK|$$ e -25轨$$HDŽ$HDŽ$I`l$D$D$SVD$ $$1i `l $$T$5 \$D$ 菛|$e f1$蕧$1 `l $$T$c\$D$ 6|$ e 0$<$1跢 `l $$T$c\$D$ ݚ|$ e p0$㦙$1^ `l $$T$ \$D$ 脚|$ e /$芦$1 `l $$T$c\$D$ +|$ e z/$1$1謡 `l $$T$c\$D$ ҙ|$ e .$إ$1S `l $$T$A\$D$ y|$ e .$$1 `l $$T$B\$D$ |$ e  .$&$1衠 `l $$T$#\$D$ ǘ|$ e -$ͤ$1H `l $$T$\$D$ n|$ e -$t$1 `l $$T$\$D$ |$ e ,$$1薟 `l $$T$\$D$ 輗|$ e ,$£$1= `l $$T$\$D$ c|$ e +$i$1䞙 `l $$T$\$D$ |$ e '+$$1苞 `l $$T$\$D$ 豖|$ e *$跢$12 `l $$T$\$D$ X|$ e 1*$^$1ٝ `l $$T$\$D$ |$ e )$$1耝 h$DŽ$`ȡ$D|$ O e K)$DŽ$DŽ$$DŽ$ `l $$T$'\$D$ (|$e ($.$$4I m$$L$T$D$ ϔ|$e 8($H譠$H1L ` $C|$$ e '5$$HDŽ$HDŽ$I`l$D$D$ND$ $$1Û `l $$T$5 \$D$ 铕|$e '$$1j `l $$T$c\$D$ 萓|$ e &$薟$1 `l $$T$c\$D$ 7|$ e &$=$1踚 `l $$T$ \$D$ ޒ|$ e %$䞙$1_ `l $$T$c\$D$ 腒|$ e #%$苞$1 `l $$T$c\$D$ ,|$ e $$2$1譙 `l $$T$A\$D$ ӑ|$ e -$$ٝ$1T `l $$T$B\$D$ z|$ e #$耝$1 `l $$T$#\$D$ !|$ e 7#$'$1袘 `l $$T$\$D$ Ȑ|$ e "$Μ$1I `l $$T$\$D$ o|$ e A"$u$1 `l $$T$\$D$ |$ e !$$1藗 `l $$T$\$D$ 轏|$ e K!$Û$1> `l $$T$\$D$ d|$ e  $j$1喙 `l $$T$\$D$ |$ e U $$1茖 `l $$T$\$D$ 貎|$ e $踚$13 `l $$T$\$D$ Y|$ e _$_$$4I m$$L$T$D$ |$e $Hޙ$H1} !$HDŽ$H DŽ$HG $$$<1A L$<DŽ$@`ȡ$<|$ O e 9$DDŽ$HDŽ$L`l$$L$!T$D$ |$e $<$$4I m$$L$1T$D$ 訌|$e >$H膘$H1% `l $D$D$FL$ $$1 `l $$T$5 \$D$ |$ e $$1虓 `l $$T$c\$D$ 迋|$ e $ŗ$1@ `l $$T$c\$D$ f|$ e $l$1璙 `l $$T$ \$D$ |$ e $$1莒 `l $$T$c\$D$ 贊|$ e $躖$15 `l $$T$c\$D$ [|$ e %$a$1ܑ `l $$T$A\$D$ |$ e $$1胑 `l $$T$B\$D$ 詉|$ e /$试$1* `l $$T$#\$D$ P|$ e $V$1ѐ `l $$T$\$D$ |$ e 9$$1x `l $$T$\$D$ 螈|$ e $褔$1 `l $$T$\$D$ E|$ e C$K$1Ə `l $$T$\$D$ 쇕|$ e $$1m `l $$T$\$D$ 蓇|$ e M$虓$1 `l $$T$\$D$ :|$ e $@$1軎 `l $$T$\$D$ ᆕ|$ e W$璙$1b `l $$T$\$D$ 舆|$ e $莒$$4I m$$L$T$D$ /|$e a$H $H1謍 `l $D$D$c@L$ $$1y `l $$T$5 \$D$ 蟅|$ e $襑$1 `l $$T$c\$D$ F|$ e 4$L$1nj `l $$T$c\$D$ 턕|$ e $$1n `l $$T$ \$D$ 蔄|$ e >$蚐$1 `l $$T$c\$D$ ;|$ e $A$1輋 `l $$T$c\$D$ ⃕|$ e H$菙$1c `l $$T$A\$D$ 艃|$ e $菏$1 `l $$T$B\$D$ 0|$ e R$6$1豊 `l $$T$#\$D$ ׂ|$ e $ݎ$1X `l $$T$\$D$ ~|$ e \$脎$1 `l $$T$\$D$ %|$ e $+$1覉 `l $$T$\$D$ ́|$ e f$ҍ$1M ~i$DŽ$( $DŽ$ `l$$\$- l$D$ C|$ e  $I$1Ĉ `l $$T$\$D$ ꀕ|$ e @ $$1k `l $$T$\$D$ 葀|$ e  $藌$1 `l $$T$\$D$ 8|$ e J $>$1蹇 `l $$T$\$D$ |$ e  $務$1` `l $$T$\$D$ |$ e T $茋$$4I m$$L$1T$D$ -|$e  $H $H1誆 `l $D$D$a9L$ $$p1w `l $$T$c\$D$ ~|$ e ' $p裊$p1 `l $$T$c\$D$ D~|$ e  $pJ$p1Ņ `l $$T$ \$D$ }|$ e 1 $p$p1l `l $$T$c\$D$ }|$ e $p蘉$p1 `l $$T$c\$D$ 9}|$ e ;$p?$p1躄 `l $$T$A\$D$ ||$ e $p戙$p1a `l $$T$B\$D$ ||$ e E$p荈$p1 `l $$T$#\$D$ .||$ e $p4$p1诃 `l $$T$\$D$ {|$ e O$pۇ$p1V `l $$T$\$D$ |{|$ e $p肇$p1 `l $$T$\$D$ #{|$ e Y$p)$p1褂 `l $$T$\$D$ z|$ e $pІ$p1K `l $$T$\$D$ qz|$ e c$pw$p1 `l $$T$\$D$ z|$ e $p$p1虁 `l $$T$\$D$ y|$ e m$pŅ$p1@ `l $$T$\$D$ fy|$ e $pl$$4I m$$L$PT$D$  y|$e w$H넙$H1芀 `l $D$ D$A3L$ $$,1W `l $$T$c\$D$ }x|$ e $,胄$,1 `l $$T$c\$D$ $x|$ e J$,*$,1 `l $$T$c\$D$ w|$ e $,у$,1L `l $$T$c\$D$ rw|$ e T$,x$,1~ `l $$T$B\$D$ w|$ e $,$,1~ `l $$T$\$D$ v|$ e ^$,Ƃ$,1A~ `l $$T$\$D$ gv|$ e $,m$,1} `l $$T$\$D$ v|$ e h$,$,1} `l $$T$\$D$ u|$ e $,軁$,16} `l $$T$\$D$ \u|$ e r$,b$,1| `l $$T$\$D$ u|$ e $, $$4I m$$L$)T$D$ t|$e |$H舀$H1'| `ȡ $#|$ O e )$HDŽ$HDŽ$I`l$D$D$.D$ $$1{ `l $$T$5 \$D$ s|$e r$$1M{ `l $$T$c\$D$ ss|$ e $y$1z `l $$T$c\$D$ s|$ e |$ $1z `l $$T$ \$D$ r|$ e $~$1Bz `l $$T$c\$D$ hr|$ e $n~$1y `l $$T$c\$D$ r|$ e  $~$1y `l $$T$A\$D$ q|$ e $}$17y `l $$T$B\$D$ ]q|$ e $c}$1x `l $$T$#\$D$ q|$ e $ }$1x `l $$T$\$D$ p|$ e $|$1,x `l $$T$\$D$ Rp|$ e $X|$1w `l $$T$\$D$ o|$ e )${$1zw `l $$T$\$D$ o|$ e ${$1!w `l $$T$\$D$ Go|$ e 3$M{$1v `l $$T$\$D$ n|$ e $z$1ov `l $$T$\$D$ n|$ e =$z$1v `l $$T$\$D$ t$1o `l $$T$\$D$ g|$ e ;$s$1`o `l $$T$\$D$ g|$ e $s$1o `l $$T$\$D$ -g|$ e E$3s$$4I m$$L$`T$D$ f|$e $Hr$H1Qn $$$`18n `l $$T$c\$D$ ^f|$ e 2$`dr$`1m `l $$T$ \$D$ f|$ e $` r$`1m `l $$T$c\$D$ e|$ e <$`q$`1-m `l $$T$c\$D$ Se|$ e $`Yq$`1l `l $$T$\$D$ d|$ e F$`q$`1{l `l $$T$\$D$ d|$ e $`p$`1"l `l $$T$\$D$ Hd|$ e P$`Np$`1k `l $$T$\$D$ c|$ e $`o$$4I m$$L$:T$D$ c|$e Z$Hto$H1kc $$$1j `l $$T$ \$D$ c|$ e $&o$1j `l $$T$c\$D$ b|$ e G$n$1Hj `l $$T$B\$D$ nb|$ e $tn$1i `l $$T$\$D$ b|$ e Q$n$1i `l $$T$\$D$ a|$ e $m$1=i `l $$T$\$D$ ca|$ e [$im$$4I m$$L$\T$D$  a|$e $Hl$H1h ^w$ IDŽ$I $$$1Vh `l $$T$\$D$ |`|$ e 0$l$$4I m$$L$T$D$ #`|$e $Hl$H1g `l $D$D$WL$ $$P1mg `l $$T$5 \$D$ _|$ e $Pk$P1g `l $$T$c\$D$ :_|$ e $P@k$P1f `l $$T$c\$D$ ^|$ e  $Pj$P1bf `l $$T$ \$D$ ^|$ e $Pj$P1 f `l $$T$c\$D$ /^|$ e $P5j$P1e `l $$T$c\$D$ ]|$ e $Pi$P1We `l $$T$A\$D$ }]|$ e !$Pi$P1d `l $$T$B\$D$ $]|$ e $P*i$P1d `l $$T$#\$D$ \|$ e +$Ph$P1Ld `l $$T$\$D$ r\|$ e $Pxh$P1c `l $$T$\$D$ \|$ e 5$Ph$P1c `l $$T$\$D$ [|$ e $Pg$P1Ac $PDŽ$T $dDŽ$h `l$$\$- l$D$ 7[|$ e $P=g$P1b `l $$T$\$D$ Z|$ e $Pf$P1_b `l $$T$\$D$ Z|$ e $Pf$P1b `l $$T$\$D$ ,Z|$ e $P2f$P1a `l $$T$\$D$ Y|$ e #$Pe$P1Ta `l $$T$\$D$ zY|$ e $Pe$$4I m$$L$PT$D$ !Y|$e -$Hd$H1` `l $D$D$UL$ $$ 1k` `l $$T$5 \$D$ X|$ e {$ d$ 1` `l $$T$c\$D$ 8X|$ e $ >d$ 1_ `l $$T$c\$D$ W|$ e $ c$ 1`_ `l $$T$ \$D$ W|$ e  $ c$ 1_ `l $$T$c\$D$ -W|$ e $ 3c$ 1^ `l $$T$c\$D$ V|$ e $ b$ 1U^ `l $$T$A\$D$ {V|$ e $ b$ 1] `l $$T$B\$D$ "V|$ e $ (b$ 1] `l $$T$#\$D$ U|$ e $ a$ 1J] `l $$T$\$D$ pU|$ e ($ va$ 1\ `l $$T$\$D$ U|$ e $ a$ 1\ `l $$T$\$D$ T|$ e 2$ `$ 1?\ `l $$T$\$D$ eT|$ e $ k`$ 1[ `l $$T$\$D$ T|$ e <$ `$ 1[ `l $$T$\$D$ S|$ e $ _$ 14[ `l $$T$\$D$ ZS|$ e F$ `_$ 1Z `l $$T$\$D$ S|$ e $ _$$4I m$$L$ѺT$D$ R|$e P$H^$H1%Z `l $D$D$ L$ $$1Y `l $$T$c\$D$ R|$ e $^$1Y `l $$T$c\$D$ Q|$ e #$]$1@Y `l $$T$ \$D$ fQ|$ e $l]$1X `l $$T$c\$D$  Q|$ e -$]$1X `l $$T$c\$D$ P|$ e $\$15X `l $$T$A\$D$ [P|$ e 7$a\$1W `l $$T$B\$D$ P|$ e $\$1W `l $$T$\$D$ O|$ e A$[$1*W `l $$T$\$D$ PO|$ e $V[$1V `l $$T$\$D$ N|$ e K$Z$1xV `l $$T$\$D$ N|$ e $Z$1V `l $$T$\$D$ EN|$ e U$KZ$1U `l $$T$\$D$ M|$ e $Y$1mU `l $$T$\$D$ M|$ e _$Y$1U `l $$T$\$D$ :M|$ e $@Y$$4I m$$L$NT$D$ L|$e i$HX$H1^T `ȡ $|$ O e $HDŽ$HDŽ$I`l$D$ D$D$ $$G1S `l $$T$c\$D$ L|$e _$G X$G1S `l $$T$c\$D$ K|$ e $GW$G1+S `l $$T$c\$D$ QK|$ e i$GWW$G1R `l $$T$c\$D$ J|$ e $GV$G1yR `l $$T$B\$D$ J|$ e s$GV$G1 R `l $$T$\$D$ FJ|$ e $GLV$G1Q `l $$T$\$D$ I|$ e }$GU$G1nQ `l $$T$\$D$ I|$ e $GU$G1Q `l $$T$\$D$ ;I|$ e $GAU$G1P `l $$T$\$D$ H|$ e  $GT$G1cP `l $$T$\$D$ H|$ e $GT$$4I m$$L$㤺T$D$ 0H|$e $HT$H1O $$$G1O `l $$T$c\$D$ G|$ e ~$GS$G1;O `l $$T$c\$D$ aG|$ e $GgS$G1N `l $$T$\$D$ G|$ e $GS$G1N `l $$T$\$D$ F|$ e  $GR$G10N `l $$T$\$D$ VF|$ e $G\R$G1M `l $$T$\$D$ E|$ e $GR$$4I m$$L$줺T$D$ E|$e $HQ$H1!M `l $D$D$L$ $$,G1L `l $$T$c\$D$ E|$ e $,GQ$,G1L `l $$T$c\$D$ D|$ e o$,GP$,G1|$ e $FJ$F1xF `l $$T$c\$D$ >|$ e $FJ$F1F `l $$T$ \$D$ E>|$ e $FKJ$F1E `l $$T$c\$D$ =|$ e $FI$F1mE `l $$T$c\$D$ =|$ e $FI$F1E `l $$T$A\$D$ :=|$ e %$F@I$F1D `l $$T$B\$D$ <|$ e $FH$F1bD `l $$T$#\$D$ <|$ e /$FH$F1 D `l $$T$\$D$ /<|$ e $F5H$F1C `l $$T$\$D$ ;|$ e 9$FG$F1WC `l $$T$\$D$ };|$ e $FG$F1B `l $$T$\$D$ $;|$ e C$F*G$F1B `l $$T$\$D$ :|$ e ȭ$FF$F1LB `l $$T$\$D$ r:|$ e M$FxF$F1A `l $$T$\$D$ :|$ e Ҭ$FF$F1A `l $$T$\$D$ 9|$ e W$FE$$4I m$$L$2T$D$ g9|$e ܫ$HEE$H1@ `l $D$D$L$ $$F1@ `l $$T$c\$D$ 8|$ e *$FD$F1X@ `l $$T$c\$D$ ~8|$ e $FD$F1? `l $$T$ \$D$ %8|$ e 4$F+D$F1? `l $$T$c\$D$ 7|$ e $FC$F1M? `l $$T$c\$D$ s7|$ e >$FyC$F1> `l $$T$A\$D$ 7|$ e è$F C$F1> `l $$T$B\$D$ 6|$ e H$FB$F1B> `l $$T$\$D$ h6|$ e ͧ$FnB$F1= `l $$T$\$D$ 6|$ e R$FB$F1= `l $$T$\$D$ 5|$ e צ$FA$F17= `l $$T$\$D$ ]5|$ e \$FcA$F1< `l $$T$\$D$ 5|$ e $F A$F1< `l $$T$\$D$ 4|$ e f$F@$F1,< `l $$T$\$D$ R4|$ e $FX@$$4I m$$L$TT$D$ 3|$e p$H?$H1v;DŽ$H `ȡ $|$ O e $HDŽ$HDŽ$Im$$$F1; `l $$T$c\$D$ *3|$e u$F0?$F1: `l $$T$c\$D$ 2|$ e $F>$F1R: `l $$T$B\$D$ x2|$ e $F~>$F19 `l $$T$\$D$ 2|$ e $F%>$F19 `l $$T$\$D$ 1|$ e $F=$F1G9 `l $$T$\$D$ m1|$ e $Fs=$$4I m$$L$t#T$D$ 1|$e $H<$H18DŽ$H `ȡ $ߔ|$ O e 5$HDŽ$HDŽ$I`l$D$D$D$ $$E18 `l $$T$c\$D$ +0|$e ~$E1<$E17 `l $$T$c\$D$ /|$ e $E;$E1S7 `l $$T$ \$D$ y/|$ e $E;$E16 `l $$T$c\$D$  /|$ e  $E&;$E16 `l $$T$c\$D$ .|$ e $E:$E1H6 `l $$T$A\$D$ n.|$ e $Et:$E15 `l $$T$B\$D$ .|$ e $E:$E15 `l $$T$\$D$ -|$ e !$E9$E1=5 `l $$T$\$D$ c-|$ e $Ei9$E14 `l $$T$\$D$ -|$ e +$E9$E14 `l $$T$\$D$ ,|$ e $E8$E124 `l $$T$\$D$ X,|$ e 5$E^8$E13 `l $$T$\$D$ +|$ e $E8$E13 `l $$T$\$D$ +|$ e ?$E7$E1'3 `l $$T$\$D$ M+|$ e Ę$ES7$$4I m$$L$qT$D$ *|$e I$H6$H1q2 $$$E1X2 `l $$T$\$D$ ~*|$ e $E6$$4I m$$L$ҺT$D$ %*|$e 6$H6$H11 !$HDŽ$H DŽ$H $$$PE1f1 $PEDŽ$TE $dEDŽ$hE `l$$\$-!l$D$ \)|$ e K$PEb5$$4I m$$L$(T$D$ )|$e Е$H4$H10 !$HDŽ$H DŽ$H $$$ E1D0 T$ EDŽ$E ` $ה|$$ e 54$$$D+$D1!' `l $$T$\$D$ G|$ e È$DM+$$4I m$$L$IT$D$ |$e H$H*$H1k&ؔ $$$@D1R& `l $$T$c\$D$ x|$ e $@D~*$@D1% `l $$T$B\$D$ |$ e 5$@D%*$@D1% `l $$T$\$D$ |$ e $@D)$@D1G% `l $$T$\$D$ m|$ e ?$@Ds)$@D1$ `l $$T$\$D$ |$ e ą$@D)$@D1$ `l $$T$\$D$ |$ e I$@D($$4I m$$L$[DT$D$ b|$e ΄$H@($H1# `l $D$D$֔L$ $$C1# `l $$T$5 \$D$ |$ e $C'$C1S# `l $$T$c\$D$ y|$ e $C'$C1" `l $$T$c\$D$  |$ e &$C&'$C1" `l $$T$ \$D$ |$ e $C&$C1H" `l $$T$c\$D$ n|$ e 0$Ct&$C1! `l $$T$c\$D$ |$ e $C&$C1! `l $$T$A\$D$ |$ e :$C%$C1=! `l $$T$B\$D$ c|$ e $Ci%$C1 `l $$T$#\$D$ |$ e D$C%$C1 `l $$T$\$D$ |$ e $C$$C12 `l $$T$\$D$ X|$ e N$C^$$C1 `l $$T$\$D$ |$ e ~$C$$C1 `l $$T$\$D$ |$ e X~$C#$C1' `l $$T$\$D$ M|$ e }$CS#$C1 `l $$T$\$D$ |$ e b}$C"$C1u `l $$T$\$D$ |$ e |$C"$C1 `l $$T$\$D$ B|$ e l|$CH"$$4I m$$L$ T$D$ |$e {$H!$H1fϔ $$$C1M `l $$T$B\$D$ s|$ e Y{$Cy!$C1 `l $$T$\$D$ |$ e z$C !$C1 `l $$T$\$D$ |$ e cz$C $C1B `l $$T$\$D$ h|$ e y$Cn $C1 `l $$T$\$D$ |$ e my$C $$4I m$$L$T$D$ |$e x$H$H13͔ $$$tC1 `l $$T$c\$D$ @|$ e Zx$tCF$tC1 `l $$T$c\$D$ |$ e w$tC$tC1h `l $$T$B\$D$ |$ e dw$tC$tC1 `l $$T$\$D$ 5|$ e v$tC;$tC1 `l $$T$\$D$ |$ e nv$tC$tC1] `l $$T$\$D$ |$ e u$tC$$4I m$$L$DT$D$ *|$e xu$H$H1 `l $D$D$^˔L$ $$0C1t T$0CDŽ$4C# A$DCDŽ$HC `l$$\$-&l$D$ j|$ e t$0Cp$0C1 `l $$T$5 \$D$ |$ e t$0C$0C1 `l $$T$c\$D$ |$ e s$0C$0C19 `l $$T$c\$D$ _|$ e %s$0Ce$0C1 `l $$T$ \$D$ |$ e r$0C $0C1 `l $$T$c\$D$ |$ e /r$0C$0C1. `l $$T$c\$D$ T|$ e q$0CZ$0C1 `l $$T$A\$D$ |$ e 9q$0C$0C1| `l $$T$B\$D$ |$ e p$0C$0C1# `l $$T$#\$D$ I |$ e Cp$0CO$0C1 `l $$T$\$D$ |$ e o$0C$0C1q `l $$T$\$D$ |$ e Mo$0C$0C1 `l $$T$\$D$ > |$ e n$0CD$0C1 `l $$T$\$D$ |$ e Wn$0C$0C1f `l $$T$\$D$ |$ e m$0C$0C1  `l $$T$\$D$ 3 |$ e am$0C9$0C1 `l $$T$\$D$ |$ e l$0C$0C1[ `l $$T$\$D$ |$ e kl$0C$$4I m$$L$T$D$ ( |$e k$H$H1 `l $D$D$\ĔL$ $$B1r `l $$T$5 \$D$ |$ e >k$B$B1 `l $$T$c\$D$ ? |$ e j$BE$B1 `l $$T$c\$D$ |$ e Hj$B$B1g `l $$T$ \$D$ |$ e i$B$B1 `l $$T$c\$D$ 4|$ e Ri$B:$B1 `l $$T$c\$D$ |$ e h$B$B1\ `l $$T$A\$D$ |$ e \h$B$B1 `l $$T$B\$D$ )|$ e g$B/$B1 `l $$T$#\$D$ |$ e fg$B$B1Q `l $$T$\$D$ w|$ e f$B}$B1 `l $$T$\$D$ |$ e pf$B$$B1 `l $$T$\$D$ |$ e e$B$B1F `l $$T$\$D$ l|$ e ze$Br$B1 `l $$T$\$D$ |$ e d$B$B1 `l $$T$\$D$ |$ e d$B$B1; `l $$T$\$D$ a|$ e  d$Bg$B1 `l $$T$\$D$ |$ e c$B$$4I m$$L$mԺT$D$ |$e c$H$H1, `l $D$ D$㽔L$ $$B1 `l $$T$c\$D$ |$ e ab$B%$B1 `l $$T$c\$D$ |$ e a$B$B1G `l $$T$ \$D$ m|$ e ka$Bs$B1 `l $$T$c\$D$ |$ e `$B$B1 `l $$T$c\$D$ |$ e u`$B $B1< `l $$T$B\$D$ b|$ e _$Bh $B1 `l $$T$\$D$ |$ e _$B $B1 `l $$T$\$D$ |$ e _$B $B11 `l $$T$\$D$ W|$ e ^$B] $B1 `l $$T$\$D$ |$ e ^$B $B1 `l $$T$\$D$ |$ e ]$B $$4I m$$L${T$D$ L|$e ]$H* $H1 `l $D$ D$耹L$ $$dB1 `l $$T$c\$D$ |$ e f\$dB $dB1= `l $$T$c\$D$ c|$ e [$dBi $dB1 `l $$T$ \$D$ |$ e p[$dB $dB1 `l $$T$c\$D$ |$ e Z$dB $dB12 `l $$T$c\$D$ X|$ e zZ$dB^ $dB1 `l $$T$A\$D$ |$ e Y$dB $dB1 `l $$T$B\$D$ |$ e Y$dB$dB1' `l $$T$\$D$ M|$ e  Y$dBS$dB1 `l $$T$\$D$ |$ e X$dB$dB1u `l $$T$\$D$ |$ e X$dB$dB1 `l $$T$\$D$ B|$ e W$dBH$dB1 `l $$T$\$D$ |$ e W$dB$dB1j `l $$T$\$D$ |$ e V$dB$$4I m$$L$ET$D$ 7|$e 'V$H$H1 `l $D$D$kL$ $$ B1 `l $$T$5 \$D$ |$ e uU$ B$ B1( `l $$T$c\$D$ N|$ e T$ BT$ B1 `l $$T$c\$D$ |$ e T$ B$ B1v `l $$T$ \$D$ |$ e T$ B$ B1 `l $$T$c\$D$ C|$ e S$ BI$ B1 `l $$T$c\$D$ |$ e S$ B$ B1k `l $$T$A\$D$ |$ e R$ B$ B1 `l $$T$B\$D$ 8|$ e R$ B>$ B1 `l $$T$#\$D$ |$ e Q$ B$ B1` `l $$T$\$D$ |$ e "Q$ B$ B1 `l $$T$\$D$ -|$ e P$ B3$ B1 `l $$T$\$D$ |$ e ,P$ B$ B1U `l $$T$\$D$ {|$ e O$ B$ B1 `l $$T$\$D$ "|$ e 6O$ B($ B1 `l $$T$\$D$ |$ e N$ B$ B1J `l $$T$\$D$ p|$ e @N$ Bv$ B1 `l $$T$\$D$ |$ e M$ B$$4I m$$L$T$D$ |$e JM$H$H1;苭 $$$A1" `l $$T$\$D$ H|$ e L$AN$A1 `l $$T$\$D$ |$ e 7L$A$$4I m$$L$,|T$D$ |$e K$Ht$H1c $$$TA1 `l $$T$\$D$ |$ e $K$TA&$$4I m$$L$`T$D$ |$e J$H$H1D `l $D$D$L$ $$A1 `l $$T$c\$D$ 7|$ e I$A=$A1 `l $$T$c\$D$ |$ e |I$A$A1_ `l $$T$ \$D$ |$ e I$A$A1 `l $$T$c\$D$ ,|$ e H$A2$A1 `l $$T$c\$D$ |$ e  H$A$A1T `l $$T$B\$D$ z|$ e G$A$A1 `l $$T$\$D$ !|$ e G$A'$A1 `l $$T$\$D$ |$ e F$A$A1I `l $$T$\$D$ o|$ e F$Au$A1 `l $$T$\$D$ |$ e E$A$A1 `l $$T$\$D$ |$ e )E$A$A1> `l $$T$\$D$ d|$ e D$Aj$A1 `l $$T$\$D$ |$ e 3D$A$A1 `l $$T$\$D$ |$ e C$A$$4I m$$L$3ET$D$ Y|$e =C$H7$H1 `l $D$D$荦L$ $$@1 `l $$T$c\$D$ |$ e B$@$@1J `l $$T$c\$D$ p|$ e B$@v$@1 `l $$T$ \$D$ |$ e A$@$@1 `l $$T$c\$D$ |$ e A$@$@1? `l $$T$c\$D$ e|$ e @$@k$@1 `l $$T$A\$D$ |$ e $@$@$@1 `l $$T$B\$D$ |$ e ?$@$@14 `l $$T$\$D$ Z|$ e .?$@`$@1 `l $$T$\$D$ |$ e >$@$@1 `l $$T$\$D$ |$ e 8>$@$@1) `l $$T$\$D$ O|$ e =$@U$@1 `l $$T$\$D$ |$ e B=$@$@1w `l $$T$\$D$ |$ e <$@$@1 `l $$T$\$D$ D|$ e L<$@J$@1 `l $$T$\$D$ |$ e ;$@$$4I m$$L$?ET$D$ |$e V;$Hp$H1 `l $D$ D$ƠL$ $$@1 `l $$T$c\$D$ |$ e :$@$@1 `l $$T$c\$D$ |$ e ):$@$@1* `l $$T$ \$D$ P|$ e 9$@V$@1 `l $$T$c\$D$ |$ e 39$@$@1x `l $$T$c\$D$ |$ e 8$@$@1 `l $$T$B\$D$ E|$ e =8$@K$@1 `l $$T$\$D$ |$ e 7$@$@1m `l $$T$\$D$ |$ e G7$@$@1 `l $$T$\$D$ :|$ e 6$@@$@1 `l $$T$\$D$ |$ e Q6$@$$4I m$$L$T$D$ |$e 5$Hf$H1 `l $D$ D$輜L$ $$D@1 `l $$T$c\$D$ |$ e $5$D@$D@1y `l $$T$c\$D$ |$ e 4$D@$D@1 `l $$T$ \$D$ F|$ e .4$D@L$D@1 `l $$T$c\$D$ |$ e 3$D@$D@1n `l $$T$c\$D$ |$ e 83$D@$D@1 `l $$T$B\$D$ ;|$ e 2$D@A$D@1 `l $$T$\$D$ ߔ|$ e B2$D@$D@1c `l $$T$\$D$ ߔ|$ e 1$D@$D@1 `l $$T$\$D$ 0ߔ|$ e L1$D@6$D@1 `l $$T$\$D$ ޔ|$ e 0$D@$D@1X `l $$T$\$D$ ~ޔ|$ e V0$D@$D@1 `l $$T$\$D$ %ޔ|$ e /$D@+$$4I m$$L$KET$D$ ݔ|$e `/$H$H1I虗 $$$@10 `l $$T$c\$D$ Vݔ|$ e .$@\$@1 `l $$T$c\$D$ ܔ|$ e M.$@$@1~ `l $$T$c\$D$ ܔ|$ e -$@$@1% `l $$T$B\$D$ Kܔ|$ e W-$@Q$@1 `l $$T$\$D$ ۔|$ e ,$@$@1s `l $$T$\$D$ ۔|$ e a,$@$@1 `l $$T$\$D$ @۔|$ e +$@F$$4I m$$L$$T$D$ ڔ|$e k+$H$H1d ^w$ IDŽ$I`l$D$D$L$ $$?1 `l $$T$5 \$D$ ?ڔ|$ e *$?E$?1 `l $$T$c\$D$ ٔ|$ e &*$?$?1g `l $$T$c\$D$ ٔ|$ e )$?$?1 `l $$T$ \$D$ 4ٔ|$ e 0)$?:$?1 `l $$T$c\$D$ ؔ|$ e ($?$?1\ `l $$T$c\$D$ ؔ|$ e :($?$?1 `l $$T$A\$D$ )ؔ|$ e '$?/$?1ߘ `l $$T$B\$D$ ה|$ e D'$?$?1Qߘ `l $$T$#\$D$ wה|$ e &$?}$?1ޘ `l $$T$\$D$ ה|$ e N&$?$$?1ޘ `l $$T$\$D$ ֔|$ e %$?$?1Fޘ `l $$T$\$D$ l֔|$ e X%$?r$?1ݘ `l $$T$\$D$ ֔|$ e $$?$?1ݘ `l $$T$\$D$ Ք|$ e b$$?$?1;ݘ `l $$T$\$D$ aՔ|$ e #$?g$?1ܘ `l $$T$\$D$ Ք|$ e l#$?$?1ܘ `l $$T$\$D$ Ԕ|$ e "$?$$4I m$$L$T$D$ VԔ|$e v"$H4$H1ۘ# $$$x?1ۘ `l $$T$\$D$ Ӕ|$ e !$x?ߘ$$4I m$$L$T$D$ Ӕ|$e c!$Heߘ$H1ۘT $$$4?1ژ `l $$T$\$D$ Ӕ|$ e  $4?ߘ$$4I m$$L$|T$D$ Ҕ|$e P $Hޘ$H15ژ $ IDŽ$Im $$$>1ژ `l $$T$\$D$ *Ҕ|$ e $>0ޘ$>1٘ `l $$T$\$D$ є|$ e %$>ݘ$>1R٘ `l $$T$\$D$ xє|$ e $>~ݘ$$4I m$$L$$T$D$ є|$e /$Hܘ$H1ؘ ` $|$$ e 5gݘ$$HDŽ$HDŽ$I`l$D$D$D$ $$>1ؘ `l $$T$5 \$D$ 9Д|$e $>?ܘ$>1ט `l $$T$c\$D$ ϔ|$ e $>ۘ$>1aט `l $$T$c\$D$ ϔ|$ e $>ۘ$>1ט `l $$T$ \$D$ .ϔ|$ e $>4ۘ$>1֘ `l $$T$c\$D$ Δ|$ e $>ژ$>1V֘ `l $$T$c\$D$ |Δ|$ e $>ژ$>1՘ `l $$T$A\$D$ #Δ|$ e $$>)ژ$>1՘ `l $$T$B\$D$ ͔|$ e $>٘$>1K՘ `l $$T$#\$D$ q͔|$ e .$>w٘$>1Ԙ `l $$T$\$D$ ͔|$ e $>٘$>1Ԙ `l $$T$\$D$ ̔|$ e 8$>ؘ$>1@Ԙ `l $$T$\$D$ f̔|$ e $>lؘ$>1Ә `l $$T$\$D$ ̔|$ e B$>ؘ$>1Ә `l $$T$\$D$ ˔|$ e $>ט$>15Ә `l $$T$\$D$ [˔|$ e L$>aט$>1Ҙ `l $$T$\$D$ ˔|$ e $>ט$>1Ҙ `l $$T$\$D$ ʔ|$ e V$>֘$$4I m$$L$$T$D$ Pʔ|$e $H.֘$H1ј `l $D$ D$脄L$ $$h>1ј `l $$T$c\$D$ ɔ|$ e )$h>՘$h>1Aј `l $$T$c\$D$ gɔ|$ e $h>m՘$h>1И `l $$T$c\$D$ ɔ|$ e 3$h>՘$h>1И `l $$T$c\$D$ Ȕ|$ e $h>Ԙ$h>16И `l $$T$B\$D$ \Ȕ|$ e =$h>bԘ$h>1Ϙ `l $$T$\$D$ Ȕ|$ e $h> Ԙ$h>1Ϙ `l $$T$\$D$ ǔ|$ e G$h>Ә$h>1+Ϙ `l $$T$\$D$ Qǔ|$ e $h>WӘ$h>1Θ `l $$T$\$D$ Ɣ|$ e Q$h>Ҙ$h>1yΘ `l $$T$\$D$ Ɣ|$ e $h>Ҙ$h>1 Θ `l $$T$\$D$ FƔ|$ e [$h>LҘ$$4I m$$L$T$D$ Ŕ|$e $Hј$H1j͘DŽ$H $$$$>1F͘ ˽$$>DŽ$(>/ `l $$T$J\$D$ TŔ|$ e %$$>Zј$$>1̘ `l $$T$\$D$ Ĕ|$ e  $$>ј$$4I m$$L$|T$D$ Ĕ|$e / $HИ$H1̘ `l $D$ D$~L$ $$=1˘ ټ$=DŽ$= c$=DŽ$=`l$$\$L$D$ Ô|$ e S $=Ϙ$=1i˘ $=DŽ$= $=DŽ$= `l$$\$L$D$ eÔ|$ e  $=kϘ$=1ʘ .ټ$=DŽ$= c$=DŽ$=`l$$\$L$D$ ”|$ e  $=Θ$=1cʘ Nټ$=DŽ$= c$=DŽ$=`l$$\$L$D$ _”|$ e d $=eΘ$=1ɘ $=DŽ$= B$=DŽ$= `l$$\$L$D$ |$ e  $=͘$=1]ɘ (k$=DŽ$= $=DŽ$= `l$$\$L$D$ Y|$ e  $=_͘$=1Ș Ck$=DŽ$= $=DŽ$= `l$$\$L$D$ |$ e u$=̘$=1WȘ ^k$=DŽ$= $=DŽ$= `l$$\$L$D$ S|$ e $=Y̘$=1ǘ yk$=DŽ$= $=DŽ$= `l$$\$L$D$ п|$ e +$=˘$=1Qǘ k$=DŽ$= $=DŽ$= `l$$\$L$D$ M|$ e $=S˘$$4I m$$L$T$D$ |$e  $Hʘ$H1qƘ `l $D$D$(yL$ $$=1>Ƙ `l $$T$c\$D$ d|$ e Y$=jʘ$=1Ř `l $$T$c\$D$  |$ e $=ʘ$=1Ř `l $$T$ \$D$ 貽|$ e c$=ɘ$=13Ř `l $$T$c\$D$ Y|$ e $=_ɘ$=1Ę `l $$T$c\$D$ |$ e m$=ɘ$=1Ę `l $$T$A\$D$ 觼|$ e $=Ș$=1(Ę `l $$T$B\$D$ N|$ e w$=TȘ$=1Ø `l $$T$\$D$ |$ e $=ǘ$=1vØ `l $$T$\$D$ 蜻|$ e $=ǘ$=1Ø `l $$T$\$D$ C|$ e $=Iǘ$=1˜ `l $$T$\$D$ 꺔|$ e $=Ƙ$=1k˜ `l $$T$\$D$ 葺|$ e $=Ƙ$=1˜ `l $$T$\$D$ 8|$ e $=>Ƙ$=1 `l $$T$\$D$ ߹|$ e $=Ř$=1` `l $$T$\$D$ 膹|$ e $=Ř$$4I m$$L$T$D$ -|$e $$H Ř$H1 `l $D$ D$asL$ $$X=1w `l $$T$c\$D$ 蝸|$ e r$X=Ę$X=1 `l $$T$c\$D$ D|$ e $X=JĘ$X=1ſ `l $$T$c\$D$ 뷔|$ e |$X=Ø$X=1l `l $$T$B\$D$ 蒷|$ e $X=Ø$X=1 `l $$T$\$D$ 9|$ e $X=?Ø$X=1躾 `l $$T$\$D$ ඔ|$ e  $X=˜$X=1a `l $$T$\$D$ 臶|$ e $X=˜$X=1 `l $$T$\$D$ .|$ e $X=4˜$X=1诽 `l $$T$\$D$ յ|$ e $X=$$4I m$$L$Y5T$D$ ||$e $HZ$H1 !$HDŽ$H DŽ$H&o $$$<1轼 9$<DŽ$<% $<DŽ$< `l$$\$-!l$D$ 賴|$ e 4$<$$4I m$$L$VT$D$ Z|$e $H8$H1׻ |$ IDŽ$In $$$<1覻 `l $$T$ \$D$ ̳|$ e  $<ҿ$<1M `l $$T$c\$D$ s|$ e $<y$<1 `l $$T$B\$D$ |$ e $< $<1蛺 `l $$T$\$D$ |$ e $<Ǿ$<1B `l $$T$\$D$ h|$ e $<n$<1鹘 `l $$T$\$D$ |$ e $<$$4I m$$L$T$D$ 趱|$e '$H蔽$H13 `l $D$D$kL$ $$H<1 `l $$T$c\$D$ &|$ e u$H<,$H<1觸 `l $$T$c\$D$ Ͱ|$ e $H<Ӽ$H<1N `l $$T$ \$D$ t|$ e $H<z$H<1 `l $$T$c\$D$ |$ e $H<!$H<1蜷 `l $$T$c\$D$ ¯|$ e $H<Ȼ$H<1C `l $$T$A\$D$ i|$ e $H<o$H<1궘 `l $$T$B\$D$ |$ e $H<$H<1葶 `l $$T$#\$D$ 跮|$ e $H<轺$H<18 `l $$T$\$D$ ^|$ e $H<d$H<1ߵ `l $$T$\$D$ |$ e "$H< $H<1膵 `l $$T$\$D$ 謭|$ e $H<貹$H<1- `l $$T$\$D$ S|$ e ,$H<Y$H<1Դ `l $$T$\$D$ |$ e $H<$H<1{ `l $$T$\$D$ 衬|$ e 6$H<觸$H<1" `l $$T$\$D$ H|$ e $H<N$H<1ɳ `l $$T$\$D$ 䀹|$ e @$H<$$4I m$$L$aúT$D$ 薫|$e $Ht$H1 `l $D$D$eL$ $$<1ಘ `l $$T$5 \$D$ |$ e $< $<1臲 `l $$T$c\$D$ 譪|$ e $<賶$<1. `l $$T$c\$D$ T|$ e $<Z$<1ձ `l $$T$ \$D$ |$ e $<$<1| `l $$T$c\$D$ 袩|$ e '$<訵$<1# `l $$T$c\$D$ I|$ e $<O$<1ʰ `l $$T$A\$D$ |$ e 1$<$<1q `l $$T$B\$D$ 藨|$ e $<蝴$<1 `l $$T$#\$D$ >|$ e ;$<D$<1迯 `l $$T$\$D$ 委|$ e $<볘$<1f `l $$T$\$D$ 茧|$ e E$<蒳$<1 `l $$T$\$D$ 3|$ e $<9$<1贮 `l $$T$\$D$ ڦ|$ e O$<ಘ$<1[ $@<DŽ$D< `l $$T$\$D$ i|$ e $<o$<1ꭘ `l $$T$\$D$ |$ e A$<$<1葭 `l $$T$\$D$ 跥|$ e $<轱$<18 `l $$T$\$D$ ^|$ e K$<d$$4I m$$L$oT$D$ |$e $H㰘$H1肬 `l $D$D$9_L$ $$;1O `l $$T$5 \$D$ u|$ e $;{$;1 `l $$T$c\$D$ |$ e $;"$;1蝫 `l $$T$c\$D$ ã|$ e ($;ɯ$;1D `l $$T$ \$D$ j|$ e $;p$;1몘 `l $$T$c\$D$ |$ e 2$;$;1蒪 `l $$T$c\$D$ 踢|$ e $;辮$;19 `l $$T$A\$D$ _|$ e <$;e$;1੘ `l $$T$B\$D$ |$ e $; $;1臩 `l $$T$#\$D$ 譡|$ e F$;賭$;1. `l $$T$\$D$ T|$ e $;Z$;1ը `l $$T$\$D$ |$ e P$;$;1| `l $$T$\$D$ 袠|$ e $;訬$;1# `l $$T$\$D$ I|$ e Z$;O$;1ʧ `l $$T$\$D$ |$ e $;$;1q `l $$T$\$D$ 藟|$ e d$;蝫$;1 `l $$T$\$D$ >|$ e $;D$;1迦 `l $$T$\$D$ 垔|$ e n$;몘$$4I m$$L$T$D$ 茞|$e $Hj$H1 YX $$$|;1 `l $$T$c\$D$ |$ e [$|;$|;1藥 `l $$T$c\$D$ 轝|$ e $|;é$|;1> `l $$T$ \$D$ d|$ e e$|;j$|;1夘 `l $$T$c\$D$  |$ e $|;$|;1茤 `l $$T$\$D$ 貜|$ e o$|;踨$|;13 `l $$T$\$D$ Y|$ e $|;_$|;1ڣ `l $$T$\$D$ |$ e y$|;$|;1聣 `l $$T$\$D$ 觛|$ e $|;譧$$4I m$$L$6T$D$ N|$e $H,$H1ˢ `l $D$D$UL$ $$8;1蘢 `l $$T$5 \$D$ 辚|$ e $8;Ħ$8;1? `l $$T$c\$D$ e|$ e V$8;k$8;1桘 `l $$T$c\$D$  |$ e $8;$8;1荡 `l $$T$ \$D$ 賙|$ e `$8;蹥$8;14 `l $$T$c\$D$ Z|$ e $8;`$8;1۠ `l $$T$c\$D$ |$ e j$8;$8;1肠 `l $$T$A\$D$ 記|$ e $8;认$8;1) `l $$T$B\$D$ O|$ e t$8;U$8;1П `l $$T$#\$D$ |$ e $8;$8;1w `l $$T$\$D$ 蝗|$ e ~$8;裣$8;1 `l $$T$\$D$ D|$ e $8;J$8;1Ş `l $$T$\$D$ 떔|$ e $8;$8;1l `l $$T$\$D$ 蒖|$ e  $8;蘢$8;1 `l $$T$\$D$ 9|$ e $8;?$8;1躝 `l $$T$\$D$ |$ e $8;桘$8;1a `l $$T$\$D$ 臕|$ e $8;荡$8;1 `l $$T$\$D$ .|$ e !$8;4$$4I m$$L$f~T$D$ Ք|$e $H賠$H1RN $$$:19 `l $$T$c\$D$ _|$ e $:e$:1 `l $$T$\$D$ |$ e $: $:1臛 `l $$T$\$D$ 譓|$ e $:賟$:1. `l $$T$\$D$ T|$ e $:Z$$4I m$$L$T$D$ |$e "$Hٞ$H1x !$HDŽ$H DŽ$HL $$$:1< j$:DŽ$: $:DŽ$: `l$$\$-!l$D$ 2|$ e 7$:8$$4I m$$L$T$D$ ّ|$e $H距$H1VK $$$l:1= `l $$T$\$D$ c|$ e $$l:i$$4I m$$L$iT$D$  |$e $H蜘$H1臘 `ȡ $?|$ ěO e V$HDŽ$HDŽ$I`l$D$D$JD$ $$(:1 `l $$T$c\$D$ ,|$e $(:2$(:1譗 `l $$T$c\$D$ ӏ|$ e $$(:ٛ$(:1T `l $$T$ \$D$ z|$ e $(:耛$(:1 `l $$T$c\$D$ !|$ e .$(:'$(:1袖 `l $$T$c\$D$ Ȏ|$ e $(:Κ$(:1I `l $$T$A\$D$ o|$ e 8$(:u$(:1 `l $$T$B\$D$ |$ e $(:$(:1藕 `l $$T$\$D$ 轍|$ e B$(:Ù$(:1> `l $$T$\$D$ d|$ e $(:j$(:1唘 `l $$T$\$D$ |$ e L$(:$(:1茔 `l $$T$\$D$ 貌|$ e $(:踘$(:13 `l $$T$\$D$ Y|$ e V$(:_$(:1ړ `l $$T$\$D$ |$ e $(:$(:1聓 `l $$T$\$D$ 觋|$ e `$(:譗$$4I m$$L$~T$D$ N|$e $H,$H1˒ $ IDŽ$IE $$$91蚒 `l $$T$\$D$ |$ e 5$9Ɩ$91A `l $$T$\$D$ g|$ e $9m$91葘 `l $$T$\$D$ |$ e ?$9$$4I m$$L$6T$D$ 赉|$e Ľ$H蓕$H12 `l $D$ D$CL$ $$91 `l $$T$c\$D$ %|$ e $9+$91覐 `l $$T$c\$D$ ̈|$ e $9Ҕ$91M `l $$T$ \$D$ s|$ e $9y$91 `l $$T$c\$D$ |$ e $9 $91蛏 `l $$T$c\$D$ |$ e &$9Ǔ$91B `l $$T$A\$D$ h|$ e $9n$91鎘 `l $$T$B\$D$ |$ e 0$9$91萎 `l $$T$\$D$ 趆|$ e $9輒$917 `l $$T$\$D$ ]|$ e :$9c$91ލ `l $$T$\$D$ |$ e $9 $91腍 `l $$T$\$D$ 諅|$ e D$9豑$91, `l $$T$\$D$ R|$ e ɷ$9X$91ӌ `l $$T$\$D$ |$ e N$9$$4I m$$L$hT$D$ 蠄|$e Ӷ$H~$H1 $HDŽ$H DŽ$H`$a3|$$ e N5Ő$$HDŽ$HDŽ$I`ȡ$ 3|$̛ țGe $ IDŽ$$IDŽ$(IDŽ$Is$IDŽ$I( `l $D$D$=D$ $$\91 `l $$T$5 \$D$ &|$e  $\9,$\91觊 `l $$T$c\$D$ ͂|$ e $\9ӎ$\91N `l $$T$ \$D$ t|$ e $\9z$\91 `l $$T$A\$D$ |$ e $\9!$\91蜉 `l $$T$B\$D$ |$ e $\9ȍ$\91C `l $$T$#\$D$ i|$ e $\9o$\91ꈘ `l $$T$\$D$ |$ e ($\9$\91葈 `l $$T$\$D$ 跀|$ e $\9轌$\918 `l $$T$\$D$ ^|$ e 2$\9d$91߇ uƼ$9DŽ$9 ` $*/|$$ e 5莌$$H9DŽ$L9DŽ$P9`l$$L$cT$D$ |$e ($9蝋$91 Ƽ$9DŽ$9 ` $c.|$$ e 5Nj$$H9DŽ$L9DŽ$P9`l$$L$cT$D$ ~|$e $9֊$91Q Ƽ$9DŽ$9 ` $-|$$ e 5 $$H9DŽ$L9DŽ$P9`l$$L$cT$D$  ~|$e $9$91芅 Y$9DŽ$9 ` $,|$$ e 509$$H9DŽ$L9DŽ$P9`l$$L$T$D$ B}|$e  $9H$91Ä l$9DŽ$9 ` $,|$$ e 5@r$$H9DŽ$L9DŽ$P9$,9DŽ$09 `l $$T$W\$D$ c||$e $9i$91䃘 Z$9DŽ$9 ` $/+|$|$| e q5P薈D$|$H9DŽ$L9DŽ$P9`l$$L$T$D$ {|$e $9訇$91# $9DŽ$9 ` $n*|$|$x e m5`ՇD$x$H9DŽ$L9DŽ$P9`l$$L$T$D$ z|$e $9熘$91b Z$9DŽ$9 ` $)|$|$t e i5pD$t$H9DŽ$L9DŽ$P9`l$$L$T$D$ z|$e ܨ$9&$91衁 9Z$9DŽ$9 ` $(|$|$p e e5SD$p$H9DŽ$L9DŽ$P9`l$$L$T$D$ _y|$e ا$9e$$4I m$$L$ҟT$D$ y|$e ]$H䄘$H1胀 `ȡ $'|$ ԛЛO e  $HDŽ$HDŽ$I`ȡ$'|$ܛ ؛Ge $ IDŽ$$IDŽ$(IDŽ$Is$IDŽ$I(`l$D$D${2D$ $$81 ^$8DŽ$8' `ȡ $&|$ Ge $9DŽ$9DŽ$ 9c$8DŽ$8 `l $$T$D$D$ ?w|$e R$8E$81~ ^$8DŽ$8' `ȡ $ &|$ O e $9DŽ$9DŽ$ 9c$8DŽ$8 `l $$T$D$D$ nv|$e U$8t$81} $8DŽ$8# `ȡ $:%|$ O e $9DŽ$9DŽ$ 9 $8DŽ$8 `l $$T$D$D$ u|$e X$8裁$81} ^$8DŽ$8' `ȡ $i$|$ O e $9DŽ$9DŽ$ 9c$8DŽ$8 `l $$T$D$D$ t|$e [$8Ҁ$81M| "_$8DŽ$8' `ȡ $#|$ O e $9DŽ$9DŽ$ 9c$8DŽ$8 `l $$T$D$D$ s|$e ^$8$81|{ ;$8DŽ$8% `ȡ $"|$ O e $9DŽ$9DŽ$ 9A$8DŽ$8 `l $$T$D$D$ *s|$e a$80$81z ;$8DŽ$8% `ȡ $!|$ O e $9DŽ$9DŽ$ 9B$8DŽ$8 `l $$T$D$D$ Yr|$e d$8_~$81y $8DŽ$8# `ȡ $%!|$ O e $9DŽ$9DŽ$ 9#$8DŽ$8 `l $$T$D$D$ q|$e g$8}$81 y $8DŽ$8" `ȡ $T |$ $ O e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ p|$e j$8|$818x $8DŽ$8" `ȡ $|$ ,(O e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ o|$e m$8{$81gw $8DŽ$8" `ȡ $|$ 40O e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ o|$e p$8{$81v $8DŽ$8" `ȡ $|$ <8O e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ Dn|$e s$8Jz$81u +$8DŽ$8" `ȡ $|$ D@O e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ sm|$e v$8yy$81t ^$8DŽ$8' `ȡ $?|$ LHO e  $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$l\$D$ l|$e s$8x$81t M$8DŽ$8" `ȡ $h|$ TPO e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ k|$e v$8w$81Ls 8^$8DŽ$8' `ȡ $|$ \XO e  $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$ m\$D$ j|$e s$8v$81ur o$8DŽ$8" `ȡ $|$ d`O e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ #j|$e v$8)v$81q _^$8DŽ$8' `ȡ $|$ lhO e  $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$m\$D$ Li|$e s$8Ru$81p $8DŽ$8" `ȡ $|$ tpO e $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$D$D$ {h|$e v$8t$81o ^$8DŽ$8' `ȡ $G|$ |xO e  $9DŽ$9DŽ$ 9$8DŽ$8 `l $$T$)m\$D$ g|$e s$8s$$4I m$$L$&T$D$ Kg|$e $H)s$H1n ` $/|$|$l e 5sD$l$HDŽ$HDŽ$I`ȡ$|$ Ge 2$ IDŽ$$IDŽ$(Iz $$$L81n `l $$T$c\$D$ 7f|$e $L8=r$L81m `l $$T$c\$D$ e|$ e $L8q$L81_m `l $$T$c\$D$ e|$ e $L8q$L81m `l $$T$\$D$ ,e|$ e $$L82q$L81l `l $$T$\$D$ d|$ e $L8p$L81Tl ߦ$L8DŽ$P8 `l $$T$\$D$ bd|$ e $L8hp$L81k `l $$T$\$D$ d|$ e $L8p$L81k `l $$T$\$D$ c|$ e  $L8o$$4I m$$L$T$D$ Wc|$e $H5o$H1j `l $D$D$L$ $$81j `l $$T$c\$D$ b|$ e $8n$81Hj `l $$T$c\$D$ nb|$ e x$8tn$81i `l $$T$ \$D$ b|$ e $8n$81i `l $$T$c\$D$ a|$ e $8m$81=i `l $$T$c\$D$ ca|$ e $8im$81h `l $$T$A\$D$ a|$ e $8m$81h `l $$T$B\$D$ `|$ e $8l$812h `l $$T$#\$D$ X`|$ e $8^l$81g `l $$T$\$D$ _|$ e $8l$81g `l $$T$\$D$ _|$ e $8k$81'g `l $$T$\$D$ M_|$ e %$8Sk$81f `l $$T$\$D$ ^|$ e $8j$81uf `l $$T$\$D$ ^|$ e /$8j$81f $8DŽ$ 8+ $8DŽ$ 8 `l$$\$-ll$D$ ^|$ e $8j$81e `l $$T$\$D$ ]|$ e  $8i$81:e ؜$8DŽ$ 8+ $8DŽ$ 8 `l$$\$- ml$D$ 0]|$ e ^$86i$81d `l $$T$\$D$ \|$ e $8h$81Xd $8DŽ$ 8+ $8DŽ$ 8 `l$$\$-ml$D$ N\|$ e 8$8Th$81c `l $$T$\$D$ [|$ e $8g$81vc .$8DŽ$ 8+ $8DŽ$ 8 `l$$\$-)ml$D$ l[|$ e $8rg$$4I m$$L$'jT$D$ [|$e $Hf$H1b `l $D$D$GL$ $$71]b `l $$T$c\$D$ Z|$ e $7f$71b `l $$T$c\$D$ *Z|$ e j$70f$71a `l $$T$ \$D$ Y|$ e $7e$71Ra `l $$T$c\$D$ xY|$ e t$7~e$71` `l $$T$c\$D$ Y|$ e ~$7%e$71` `l $$T$A\$D$ X|$ e ~~$7d$71G` `l $$T$B\$D$ mX|$ e ~$7sd$71_ `l $$T$\$D$ X|$ e }$7d$71_ `l $$T$\$D$ W|$ e  }$7c$71<_ `l $$T$\$D$ bW|$ e |$7hc$71^ `l $$T$\$D$ W|$ e |$7c$71^ `l $$T$\$D$ V|$ e {$7b$711^ `l $$T$\$D$ WV|$ e !{$7]b$71] `l $$T$\$D$ U|$ e z$7b$71] `l $$T$\$D$ U|$ e +z$7a$$4I m$$L$6T$D$ LU|$e y$H*a$H1\ `ȡ $0|$ O e ]y$HDŽ$HDŽ$I`l$D$D$2D$ $$<71H\ `ȡ $|$ Ge x$D7DŽ$H7DŽ$L7`l$$L$cT$D$  T|$e Lx$<7&`$<71[ `ȡ $|$ O e w$D7DŽ$H7DŽ$L7`l$$L$cT$D$ yS|$e yw$<7_$<71Z `ȡ $]|$ O e &w$D7DŽ$H7DŽ$L7`l$$L$ T$D$ R|$e v$<7^$<71SZ `ȡ $|$ O e Sv$D7DŽ$H7DŽ$L7`l$$L$cT$D$ +R|$e u$<71^$<71Y `ȡ $|$ O e u$D7DŽ$H7DŽ$L7`l$$L$cT$D$ Q|$e u$<7]$<71Y `ȡ $h|$ O e t$D7DŽ$H7DŽ$L7`l$$L$AT$D$ P|$e -t$<7\$<71^X `ȡ $|$ ĜO e s$D7DŽ$H7DŽ$L7`l$$L$BT$D$ 6P|$e Zs$<7<\$<71W `ȡ $|$ ̜ȜO e s$D7DŽ$H7DŽ$L7`l$$L$#T$D$ O|$e r$<7[$<71W `ȡ $s|$ ԜМO e 4r$D7DŽ$H7DŽ$L7`l$$L$T$D$ N|$e q$<7Z$<71iV `ȡ $|$ ܜ؜O e aq$D7DŽ$H7DŽ$L7`l$$L$T$D$ AN|$e p$<7GZ$<71U `ȡ $%|$ O e p$D7DŽ$H7DŽ$L7`l$$L$T$D$ M|$e p$<7Y$<71U `ȡ $~|$ O e o$D7DŽ$H7DŽ$L7`l$$L$T$D$ L|$e ;o$<7X$<71tT `ȡ $|$ O e n$D7DŽ$H7DŽ$L7`l$$L$T$D$ LL|$e hn$<7RX$<71S `ȡ $0|$ O e n$D7DŽ$H7DŽ$L7`l$$L$T$D$ K|$e m$<7W$<71&S `ȡ $|$ O e Bm$D7DŽ$H7DŽ$L7`l$$L$T$D$ J|$e l$<7W$<71R `ȡ $|$ O e ol$D7DŽ$H7DŽ$L7`l$$L$T$D$ WJ|$e k$<7]V$$4I m$$L$QjT$D$ I|$e tk$HU$H1{Q `l $D$D$2L$ $$61HQ `l $$T$c\$D$ nI|$ e j$6tU$61P `l $$T$c\$D$ I|$ e Gj$6U$61P `l $$T$ \$D$ H|$ e i$6T$61=P `l $$T$c\$D$ cH|$ e Qi$6iT$61O `l $$T$c\$D$  H|$ e h$6T$61O `l $$T$A\$D$ G|$ e [h$6S$612O `l $$T$B\$D$ XG|$ e g$6^S$61N `l $$T$#\$D$ F|$ e eg$6S$61N `l $$T$\$D$ F|$ e f$6R$61'N `l $$T$\$D$ MF|$ e of$6SR$61M `l $$T$\$D$ E|$ e e$6Q$61uM `l $$T$\$D$ E|$ e ye$6Q$61M `l $$T$\$D$ BE|$ e d$6HQ$61L Y$6DŽ$6+ $ 7DŽ$7 `l$$\$-ll$D$ D|$ e Sd$6P$61:L `l $$T$\$D$ `D|$ e c$6fP$61K $6DŽ$6+ $ 7DŽ$7 `l$$\$- ml$D$ C|$ e -c$6O$61XK `l $$T$\$D$ ~C|$ e b$6O$61J $6DŽ$6+ $ 7DŽ$7 `l$$\$-ml$D$ B|$ e b$6N$61vJ `l $$T$\$D$ B|$ e a$6N$61J ڝ$6DŽ$6+ $ 7DŽ$7 `l$$\$-)ml$D$ B|$ e `$6N$$4I m$$L$_jT$D$ A|$e f`$HM$H17I `l $D$D$L$ $$61I `l $$T$c\$D$ *A|$ e _$60M$61H `l $$T$c\$D$ @|$ e 9_$6L$61RH `l $$T$ \$D$ x@|$ e ^$6~L$61G `l $$T$c\$D$ @|$ e C^$6%L$61G `l $$T$c\$D$ ?|$ e ]$6K$61GG `l $$T$A\$D$ m?|$ e M]$6sK$61F `l $$T$B\$D$ ?|$ e \$6K$61F `l $$T$\$D$ >|$ e W\$6J$61|$ e [$6hJ$61E `l $$T$\$D$ >|$ e a[$6J$61E `l $$T$\$D$ =|$ e Z$6I$611E `l $$T$\$D$ W=|$ e kZ$6]I$61D `l $$T$\$D$ <|$ e Y$6I$61D `l $$T$\$D$ <|$ e uY$6H$61&D `l $$T$\$D$ L<|$ e X$6RH$$4I m$$L$@T$D$ ;|$e X$HG$H1pCDŽ$H ̰$,IDŽ$0I `ȡ $|$ O e  X$HDŽ$HDŽ$IO$$$p61B `l $$T$\$D$ ;|$e lW$p6G$$4I m$$L$ٺT$D$ :|$e V$HF$H10B `l $D$D$L$ $$,61A `l $$T$c\$D$ #:|$ e ?V$,6)F$,61A `l $$T$c\$D$ 9|$ e U$,6E$,61KA `l $$T$ \$D$ q9|$ e IU$,6wE$,61@ `l $$T$c\$D$ 9|$ e T$,6E$,61@ `l $$T$c\$D$ 8|$ e ST$,6D$,61@@ `l $$T$A\$D$ f8|$ e S$,6lD$,61? `l $$T$B\$D$ 8|$ e ]S$,6D$,61? `l $$T$#\$D$ 7|$ e R$,6C$,615? `l $$T$\$D$ [7|$ e gR$,6aC$,61> `l $$T$\$D$ 7|$ e Q$,6C$,61> `l $$T$\$D$ 6|$ e qQ$,6B$,61*> `l $$T$\$D$ P6|$ e P$,6VB$,61= `l $$T$\$D$ 5|$ e {P$,6A$,61x= `l $$T$\$D$ 5|$ e P$,6A$,61= `l $$T$\$D$ E5|$ e O$,6KA$,61< `l $$T$\$D$ 4|$ e  O$,6@$$4I m$$L$ƦT$D$ 4|$e N$Hq@$H1< `l $D$D$L$ $$51; `l $$T$c\$D$ 4|$ e M$5 @$51; `l $$T$ \$D$ 3|$ e bM$5?$51+; `l $$T$c\$D$ Q3|$ e L$5W?$51: `l $$T$c\$D$ 2|$ e lL$5>$51y: `l $$T$A\$D$ 2|$ e K$5>$51 : `l $$T$B\$D$ F2|$ e vK$5L>$519 `l $$T$\$D$ 1|$ e J$5=$51n9 `l $$T$\$D$ 1|$ e J$5=$519 `l $$T$\$D$ ;1|$ e J$5A=$518 `l $$T$\$D$ 0|$ e I$5<$51c8 `l $$T$\$D$ 0|$ e I$5<$51 8 `l $$T$\$D$ 00|$ e H$56<$517 `l $$T$\$D$ /|$ e H$5;$51X7 `l $$T$\$D$ ~/|$ e G$5;$$4I m$$L$T$D$ %/|$e #G$H;$H16 ` $ ޓ e |$|$hF5p;D$h$HDŽ$HDŽ$I`l$D$D$ D$ $$516 `l $$T$5 \$D$ E.|$e F$5K:$515 `l $$T$c\$D$ -|$ e E$59$51m5 `l $$T$c\$D$ -|$ e  E$59$515 `l $$T$ \$D$ :-|$ e D$5@9$514 `l $$T$c\$D$ ,|$ e D$58$51b4 `l $$T$c\$D$ ,|$ e C$58$51 4 `l $$T$A\$D$ /,|$ e C$558$513 `l $$T$B\$D$ +|$ e B$57$51W3 `l $$T$#\$D$ }+|$ e (B$57$512 `l $$T$\$D$ $+|$ e A$5*7$512 `l $$T$\$D$ *|$ e 2A$56$51L2 `l $$T$\$D$ r*|$ e @$5x6$511 `l $$T$\$D$ *|$ e <@$56$511 `l $$T$\$D$ )|$ e ?$55$51A1 `l $$T$\$D$ g)|$ e F?$5m5$510 `l $$T$\$D$ )|$ e >$55$510 `l $$T$\$D$ (|$ e P>$54$$4I m$$L$ɦT$D$ \(|$e =$H:4$H1/ ^$,IDŽ$0I`$(ד e |$|$d^=54D$d$HDŽ$HDŽ$I`l$D$D$(D$ $$51>/ `l $$T$5 \$D$ d'|$e <$5j3$51. `l $$T$c\$D$  '|$ e <$53$51. `l $$T$c\$D$ &|$ e ;$52$513. `l $$T$ \$D$ Y&|$ e );$5_2$51- `l $$T$c\$D$ &|$ e :$52$51- `l $$T$c\$D$ %|$ e 3:$51$51(- `l $$T$A\$D$ N%|$ e 9$5T1$51, `l $$T$B\$D$ $|$ e =9$50$51v, `l $$T$#\$D$ $|$ e 8$50$51, `l $$T$\$D$ C$|$ e G8$5I0$51+ `l $$T$\$D$ #|$ e 7$5/$51k+ `l $$T$\$D$ #|$ e Q7$5/$51+ nۼ$5DŽ$ 5 $05DŽ$45 `l$$\$-fl$D$ #|$ e 6$5/$51* ۼ$5DŽ$ 5 $05DŽ$45 `l$$\$-fl$D$ "|$ e 5$5.$51* ۼ$5DŽ$ 5 $05DŽ$45 `l$$\$-fl$D$ !|$ e P5$5-$51w) ۼ$5DŽ$ 5 $05DŽ$45 `l$$\$-fl$D$ m!|$ e 4$5s-$51( `l $$T$\$D$ !|$ e *4$5-$51( $X5DŽ$\5 `l $$T$\$D$ |$ e 3$5,$51$( `l $$T$\$D$ J |$ e 3$5P,$51' `l $$T$\$D$ |$ e 2$5+$51r' `l $$T$\$D$ |$ e &2$5+$$4I m$$L$̦T$D$ ?|$e 1$H+$H1& `l $D$D$sٓL$ $$41& `l $$T$5 \$D$ |$ e 0$4*$410& `l $$T$c\$D$ V|$ e ~0$4\*$41% `l $$T$c\$D$ |$ e 0$4*$41~% `l $$T$ \$D$ |$ e /$4)$41%% `l $$T$c\$D$ K|$ e  /$4Q)$41$ `l $$T$c\$D$ |$ e .$4($41s$ `l $$T$A\$D$ |$ e .$4($41$ `l $$T$B\$D$ @|$ e -$4F($41# `l $$T$#\$D$ |$ e !-$4'$41h# `l $$T$\$D$ |$ e ,$4'$41# `l $$T$\$D$ 5|$ e +,$4;'$41" `l $$T$\$D$ |$ e +$4&$41]" `l $$T$\$D$ |$ e 5+$4&$41" `l $$T$\$D$ *|$ e *$40&$41! `l $$T$\$D$ |$ e ?*$4%$41R! `l $$T$\$D$ x|$ e )$4~%$41 `l $$T$\$D$ |$ e I)$4%%$$4I m$$L$զT$D$ |$e ($H$$H1C `l $D$D$ғL$ $$41 `l $$T$5 \$D$ 6|$ e ($4<$$41 `l $$T$c\$D$ |$ e '$4#$41^ `l $$T$c\$D$ |$ e &'$4#$41 `l $$T$ \$D$ +|$ e &$41#$41 `l $$T$c\$D$ |$ e 0&$4"$41S `l $$T$c\$D$ y|$ e %$4"$41 `l $$T$A\$D$ |$ e :%$4&"$41 `l $$T$B\$D$ |$ e $$4!$41H `l $$T$#\$D$ n|$ e D$$4t!$41 `l $$T$\$D$ |$ e #$4!$41 `l $$T$\$D$ |$ e N#$4 $41= `l $$T$\$D$ c|$ e "$4i $41 `l $$T$\$D$ |$ e X"$4 $41 `l $$T$\$D$ |$ e !$4$412 `l $$T$\$D$ X|$ e b!$4^$41 `l $$T$\$D$ |$ e  $4$41 `l $$T$\$D$ |$ e l $4$$4I m$$L$7ںT$D$ M|$e $H+$H1 `l $D$D$̓L$ $$P41 `l $$T$c\$D$ |$ e ?$P4$P41> `l $$T$c\$D$ d|$ e $P4j$P41 `l $$T$ \$D$ |$ e I$P4$P41 `l $$T$c\$D$ |$ e $P4$P413 `l $$T$c\$D$ Y|$ e S$P4_$P41 `l $$T$A\$D$ |$ e $P4$P41 `l $$T$B\$D$ |$ e ]$P4$P41( `l $$T$#\$D$ N|$ e $P4T$P41 `l $$T$\$D$ |$ e g$P4$P41v `l $$T$\$D$ |$ e $P4$P41 `l $$T$\$D$ C|$ e q$P4I$P41 `l $$T$\$D$ |$ e $P4$P41k `l $$T$\$D$ |$ e {$P4$P41 `l $$T$\$D$ 8 |$ e $P4>$P41 `l $$T$\$D$ |$ e $P4$P41` `l $$T$\$D$ |$ e  $P4$$4I m$$L$wkT$D$ - |$e $H $H1 ` $ e |$|$`05 xD$`$HDŽ$HDŽ$I$ IDŽ$I `l $D$D$œD$ $$ 41 `l $$T$c\$D$ 5 |$e T$ 4;$ 41 `l $$T$c\$D$  |$ e $ 4$ 41] `l $$T$ \$D$ |$ e ^$ 4$ 41 `l $$T$c\$D$ * |$ e $ 40$ 41 `l $$T$c\$D$  |$ e h$ 4$ 41R `l $$T$A\$D$ x |$ e $ 4~$ 41 `l $$T$B\$D$  |$ e r$ 4%$ 41 `l $$T$#\$D$ |$ e $ 4$ 41G `l $$T$\$D$ m|$ e |$ 4s$ 41 `l $$T$\$D$ |$ e $ 4$ 41 `l $$T$\$D$ |$ e $ 4$ 41< `l $$T$\$D$ b|$ e  $ 4h$ 41 `l $$T$\$D$ |$ e $ 4$ 41 `l $$T$\$D$ |$ e $ 4$ 411 `l $$T$\$D$ W|$ e $ 4]$ 41 `l $$T$\$D$ |$ e $ 4$31 h$3DŽ$3 `ȡ $ʴ |$O e $3DŽ$3DŽ$3$3DŽ$3 `l $$T$'\$D$ '|$e $3-$$4I m$$L$ T$D$ |$e  $H$H1K !$HDŽ$H g$HDŽ$H$IDŽ$I `l$D$D$躾L$ $$31 m$3DŽ$3 5 $3DŽ$3 `l$$\$L$D$ |$ e } $3$31M `l $$T$c\$D$ s|$ e  $3y$31 ݼ$3DŽ$3 c$3DŽ$3`l$$\$L$D$ |$ e ] $3$31q `l $$T$ \$D$ |$ e  $3$31 `l $$T$c\$D$ >|$ e g $3D$31 `l $$T$c\$D$ |$ e  $3 $31f `l $$T$!\$D$ |$ e q $3 $31 `l $$T$A\$D$ 3|$ e $39 $31 `l $$T$B\$D$ |$ e {$3 $31[ `l $$T$#\$D$ |$ e $3 $31 `l $$T$\$D$ (|$ e $3. $31 `l $$T$\$D$ |$ e  $3 $31P `l $$T$\$D$ v|$ e $3| $31 `l $$T$\$D$ |$ e $3# $31 `l $$T$\$D$ |$ e $3 $31E ܼ$3DŽ$3 $3DŽ$3 `l$$\$-ll$D$ ;|$ e $3A $31 `l $$T$\$D$ |$ e s$3 $31c ܼ$3DŽ$3 $3DŽ$3 `l$$\$- ml$D$ Y|$ e $3_ $31 `l $$T$\$D$ |$ e M$3 $31 ܼ$3DŽ$3 $3DŽ$3 `l$$\$-ml$D$ w|$ e $3}$31 `l $$T$\$D$ |$ e '$3$$31 ܼ$3DŽ$3 $3DŽ$3 `l$$\$-)ml$D$ |$ e |$3$$4I m$$L$ئT$D$ <|$e $H$H1 $$$@31 `l $$T$\$D$ |$ e i$@3$$4I m$$L$T$D$ m|$e $HK$H1 `l $D$D$衴L$ $$21 `l $$T$5 \$D$ |$ e <$2$21^ `l $$T$c\$D$ |$ e $2$21 `l $$T$c\$D$ +|$ e F$21$21 `l $$T$ \$D$ |$ e $2$21S `l $$T$c\$D$ y|$ e P$2$21 `l $$T$c\$D$  |$ e $2&$21 `l $$T$A\$D$ |$ e Z$2$21H `l $$T$B\$D$ n|$ e $2t$21 `l $$T$#\$D$ |$ e d$2$21 `l $$T$\$D$ |$ e $2$21= `l $$T$\$D$ c|$ e n$2i$21 `l $$T$\$D$ |$ e $2$21 `l $$T$\$D$ |$ e x$2$212 `l $$T$\$D$ X|$ e $2^$21 `l $$T$\$D$ |$ e $2$21 `l $$T$\$D$ |$ e $2$21' `l $$T$\$D$ M|$ e $2S$$4I m$$L$䦺T$D$ |$e $H$H1q `l $D$D$(L$ $$t21> `l $$T$5 \$D$ d|$ e _$t2j$t21 `l $$T$c\$D$  |$ e $t2$t21 `l $$T$c\$D$ |$ e i$t2$t213 `l $$T$ \$D$ Y|$ e $t2_$t21 `l $$T$c\$D$ |$ e s$t2$t21 `l $$T$c\$D$ |$ e $t2$t21( `l $$T$A\$D$ N|$ e }$t2T$t21 `l $$T$B\$D$ |$ e $t2$t21v `l $$T$#\$D$ |$ e $t2$t21 `l $$T$\$D$ C|$ e  $t2I$t21 `l $$T$\$D$ |$ e $t2$t21k `l $$T$\$D$ |$ e $t2$t21 `l $$T$\$D$ 8|$ e $t2>$t21 `l $$T$\$D$ |$ e  $t2$t21` `l $$T$\$D$ |$ e $t2$t21 `l $$T$\$D$ -|$ e *$t23$t21 `l $$T$\$D$ |$ e $t2$$4I m$$L$T$D$ {|$e 4$HY$H1 `l $D$D$诧L$ $$021 `l $$T$c\$D$ |$ e $02$021l `l $$T$c\$D$ |$ e $02$021 `l $$T$ \$D$ 9|$ e $02?$021 `l $$T$c\$D$ |$ e $02$021a `l $$T$c\$D$ |$ e $02$021 `l $$T$A\$D$ .|$ e $024$021 `l $$T$B\$D$ |$ e $02$021V `l $$T$\$D$ ||$ e %$02$021 `l $$T$\$D$ #|$ e $02)$021 `l $$T$\$D$ |$ e /$02$021K `l $$T$\$D$ q|$ e $02w$021 `l $$T$\$D$ |$ e 9$02$021 `l $$T$\$D$ |$ e $02$021@ `l $$T$\$D$ f|$ e C$02l$$4I m$$L$T$D$  |$e $H$H1 `ȡ $ |$O e u$HDŽ$HDŽ$I`l$D$ D$D$ $$11 `l $$T$c\$D$ /|$e $15$11 `l $$T$B\$D$ |$ e C$1$11W `l $$T$\$D$ }|$ e $1$11 `l $$T$\$D$ $|$ e M$1*$11 O$1DŽ$1& $2DŽ$2 `l$$\$-ll$D$ |$ e $1$11 `l $$T$\$D$ B|$ e '$1H$11 O$1DŽ$1& $2DŽ$2 `l$$\$- ml$D$ |$ e |$1$11: `l $$T$\$D$ `|$ e $1f$11 O$1DŽ$1& $2DŽ$2 `l$$\$-)ml$D$ |$ e V$1$$4I m$$L$:T$D$ ~|$e $H\$H1 !$HDŽ$H DŽ$H( $$$11 ݨ$1DŽ$1 $1DŽ$1 `l$$\$-!l$D$ |$ e $1$$4I m$$L$T$D$ \|$e u$H:$H1 `l $D$ D$萜L$ $$d11 `l $$T$c\$D$ |$ e $d1$d11M `l $$T$c\$D$ s|$ e H$d1y$d11 `l $$T$c\$D$ |$ e $d1 $d11 `l $$T$c\$D$ |$ e R$d1$d11B `l $$T$B\$D$ h|$ e $d1n$d11 `l $$T$#\$D$ |$ e \$d1$d11 `l $$T$\$D$ ߓ|$ e $d1$d117 `l $$T$\$D$ ]ߓ|$ e f$d1c$d11 `l $$T$\$D$ ߓ|$ e $d1 $d11 `l $$T$\$D$ ޓ|$ e p$d1$d11, `l $$T$\$D$ Rޓ|$ e $d1X$d11 `l $$T$\$D$ ݓ|$ e z$d1$$4I m$$L$WHT$D$ ݓ|$e $H~$H1m $$$ 11 `l $$T$c\$D$ *ݓ|$ e g$ 10$ 11 `l $$T$c\$D$ ܓ|$ e $ 1$ 11R `l $$T$c\$D$ xܓ|$ e q$ 1~$ 11 `l $$T$\$D$ ܓ|$ e $ 1%$ 11 `l $$T$\$D$ ۓ|$ e {$ 1$ 11G `l $$T$\$D$ mۓ|$ e $ 1s$$4I m$$L$T$D$ ۓ|$e $H$H1 `ȡ $ Ě|$O e 2$HDŽ$HDŽ$I蓔$$$01* `l $$T$\$D$ Pړ|$e $0V$01 `l $$T$\$D$ ٓ|$ e $0$01x `l $$T$\$D$ ٓ|$ e $0$$4I m$$L$&T$D$ Eٓ|$e $$H#$H1 `l $D$ D$yL$ $$01 `l $$T$c\$D$ ؓ|$ e r$0$016 `l $$T$c\$D$ \ؓ|$ e $0b$01ߗ `l $$T$c\$D$ ؓ|$ e |$0 $01ߗ `l $$T$c\$D$ ד|$ e $0$01+ߗ `l $$T$A\$D$ Qד|$ e $0W$01ޗ `l $$T$B\$D$ ֓|$ e  $0$01yޗ `l $$T$\$D$ ֓|$ e $0$01 ޗ `l $$T$\$D$ F֓|$ e $0L$01ݗ `l $$T$\$D$ Փ|$ e $0$01nݗ `l $$T$\$D$ Փ|$ e $0$01ݗ `l $$T$\$D$ ;Փ|$ e $0A$$4I m$$L$V(T$D$ ԓ|$e )$H$H1_ܗ `l $D$D$L$ $$T01,ܗ `l $$T$c\$D$ Rԓ|$ e w$T0X$T01ۗ `l $$T$c\$D$ ӓ|$ e $T0ߗ$T01zۗ `l $$T$ \$D$ ӓ|$ e $T0ߗ$T01!ۗ `l $$T$c\$D$ Gӓ|$ e $T0Mߗ$T01ڗ `l $$T$c\$D$ ғ|$ e $T0ޗ$T01oڗ `l $$T$A\$D$ ғ|$ e $T0ޗ$T01ڗ `l $$T$B\$D$ <ғ|$ e $T0Bޗ$T01ٗ `l $$T$#\$D$ ѓ|$ e $T0ݗ$T01dٗ `l $$T$\$D$ ѓ|$ e $T0ݗ$T01 ٗ `l $$T$\$D$ 1ѓ|$ e $$T07ݗ$T01ؗ `l $$T$\$D$ Г|$ e $T0ܗ$T01Yؗ `l $$T$\$D$ Г|$ e .$T0ܗ$T01ؗ `l $$T$\$D$ &Г|$ e $T0,ܗ$T01ח `l $$T$\$D$ ϓ|$ e 8$T0ۗ$T01Nח `l $$T$\$D$ tϓ|$ e $T0zۗ$T01֗ `l $$T$\$D$ ϓ|$ e B$T0!ۗ$$4I m$$L$ȵT$D$ Γ|$e $Hڗ$$ d Ye $t X d t$$ l $D$4"T$D$ FΓ|$Ge Vpl$$L$eT$D$ ͓|$Ge ep$ d  m$D$2D$.D$ $$H1@՗萇$$$01'՗ $0DŽ$0# 4"$$0DŽ$(0 `l$$\$L$D$ #͓|$e $0)ٗ$01ԗ bU$0DŽ$0' e$$0DŽ$(0`l$$\$L$D$ ̓|$ e  $0ؗ$$H m$$L$T$D$ G̓|$e $H%ؗ$H1ӗ $$$/1ӗ `l $$T$4"\$D$ ˓|$ e $/ח$/1Rӗ `l $$T$e\$D$ x˓|$ e }$/~ח$$H m$$L$!T$D$ ˓|$e $H֗$H1җ 2$HDŽ$H% ` $y e |$|$\50RחD$\$HDŽ$HDŽ$H$HDŽ$Hl$$$/1җ `l $$T$4"\$D$ )ʓ|$e ɾ$//֗$/1ї `l $$T$e\$D$ ɓ|$ e N$/՗$$H m$$L$T$D$ wɓ|$e ӽ$HU՗$H1З ` $[x e |$|$Xt5@՗D$X$HDŽ$HDŽ$H$$$D/1З `l $$T$4"\$D$ ȓ|$e ʼ$D/ԗ$D/12З `l $$T$e\$D$ Xȓ|$ e O$D/^ԗ$$H m$$L$0T$D$ Ǔ|$e Ի$Hӗ$H1|ϗ́ $$$/1cϗ `l $$T$4"\$D$ Ǔ|$ e <$/ӗ$/1 ϗ `l $$T$e\$D$ 0Ǔ|$ e $/6ӗ$$H m$$L$eT$D$ Ɠ|$e F$Hҗ$H1TΗ `R$HDŽ$H DŽ$H聀 $$$.1Η k$.DŽ$.* ` $cu e |$|$T5PҗD$T$.DŽ$.DŽ$.e$.DŽ$. `l $$T$`R\$D$ œ|$e $.ї$$H m$$L$"T$D$ eœ|$e o$HCї$H1̗2 $$$x.1̗ `l $$T$4"\$D$ ē|$ e ׷$x.З$x.1p̗ `l $$T$e\$D$ ē|$ e \$x.З$$H m$$L$*"T$D$ =ē|$e $HЗ$H1˗ ~ $$$4.1˗ `l $$T$4"\$D$ Ó|$ e I$4.ϗ$4.1H˗ `l $$T$e\$D$ nÓ|$ e ε$4.tϗ$$H m$$L$T$D$ Ó|$e S$HΗ$H1ʗ| $$$-1yʗ `l $$T$4"\$D$ “|$ e $-Η$-1 ʗ `l $$T$e\$D$ F“|$ e @$-LΗ$$H m$$L$R"T$D$ |$e ų$H͗$H1jɗ{ $$$-1Qɗ `l $$T$4"\$D$ w|$ e -$-}͗$$H m$$L$@T$D$ |$e $H̗$H1ȗz $$$h-1ȗ `l $$T$4"\$D$ |$ e $h-̗$h-1)ȗ `l $$T$e\$D$ O|$ e $h-U̗$$H m$$L$GкT$D$ |$e $$H˗$H1sǗy $$$$-1ZǗ `l $$T$4"\$D$ 耿|$ e $$-˗$$-1Ǘ `l $$T$e\$D$ '|$ e $$--˗$$H m$$L$=ST$D$ ξ|$e $Hʗ$H1KƗx $$$,12Ɨ `l $$T$4"\$D$ X|$ e $,^ʗ$,1ŗ `l $$T$e\$D$ |$ e $,ʗ$$H m$$L$T$D$ 覽|$e $Hɗ$H1#ŗsw $$$,1 ŗ `l $$T$4"\$D$ 0|$ e p$,6ɗ$,1ė `l $$T$e\$D$ ׼|$ e $,ȗ$$H m$$L$@T$D$ ~|$e z$H\ȗ$H1× ` $bk e |$|$P5`ȗD$P$HDŽ$HDŽ$Hu$$$X,1× `l $$T$4"\$D$ 踻|$e q$X,Ǘ$X,19× `l $$T$e\$D$ _|$ e $X,eǗ$$H m$$L$T$D$ |$e {$HƗ$H1— ` $i e |$|$L5pQǗD$L$HDŽ$HDŽ$Ht$$$+1— `l $$T$4"\$D$ @|$e r$+FƗ$+1 `l $$T$e\$D$ 繓|$ e $+ŗ$$H m$$L$T$D$ 莹|$e |$Hlŗ$H1 !$HDŽ$H DŽ$H8s $$$+1 L$+DŽ$+`ȡ$hȚ ̚|$O e ѧ$+DŽ$+DŽ$+`l$$L$!T$D$ 菸|$e Q$+ė$$H m$$L$1T$D$ 6|$e ֦$Hė$H1賿r $$$H+1蚿 `l $$T$4"\$D$ |$ e >$H+×$H+1A `l $$T$e\$D$ g|$ e å$H+m×$$H m$$L$T$D$ |$e H$H—$H1苾p $$$+1r `l $$T$4"\$D$ 蘶|$ e $+—$+1 `l $$T$e\$D$ ?|$ e 5$+E—$$H m$$L$1T$D$ 浓|$e $H$H1co $$$*1J `l $$T$4"\$D$ p|$ e "$*v$*1 `l $$T$e\$D$ |$ e $*$$H m$$L$PT$D$ 辴|$e ,$H$H1; `ȡ $cК Ԛ|$O e ١$HDŽ$HDŽ$H=n$$$|*1Ի `l $$T$4"\$D$ |$e <$|*$|*1{ `l $$T$e\$D$ 衳|$ e $|*觿$$H m$$L$0ݻT$D$ H|$e F$H&$H1ź `ȡ $,bؚ ܚ|$O e $HDŽ$HDŽ$Hl$$$8*1^ `l $$T$4"\$D$ 脲|$e V$8*芾$8*1 `l $$T$e\$D$ +|$ e ۞$8*1$$H m$$L$`T$D$ ұ|$e `$H谽$H1Ok $$$)16 `l $$T$4"\$D$ \|$ e ȝ$)b$)1ݸ `l $$T$e\$D$ |$ e M$) $$H m$$L$PT$D$ 誰|$e Ҝ$H舼$H1'wj $$$)1 `l $$T$4"\$D$ 4|$ e :$):$)1起 `l $$T$e\$D$ ۯ|$ e $)ỗ$$H m$$L$ѺT$D$ 肯|$e D$H`$H1Oi $$$()1涗 `l $$T$4"\$D$ |$ e $()$()1荶 `l $$T$e\$D$ 賮|$ e 1$()蹺$$H m$$L$NT$D$ Z|$e $H8$H1׵'h $$$(1辵 `l $$T$4"\$D$ 䭓|$ e $(깗$$H m$$L$nT$D$ 苭|$e $Hi$H1 ` $o\ e |$|$HD5ֹD$H$HDŽ$HDŽ$Hg$$$(1蟴 `l $$T$4"\$D$ Ŭ|$e $(˸$(1F `l $$T$e\$D$ l|$ e $(r$$H m$$L$2T$D$ |$e $H$H1萳 `R$HDŽ$H DŽ$He $$$\(1T !$\(DŽ$`( 4"$p(DŽ$t( `l$$\$-`Rl$D$ J|$ e $\(P$$H m$$L$(T$D$ |$e >$H϶$H1n b2$HDŽ$H d $$$(1= `l $$T$4"\$D$ c|$ e $(i$$H m$$L$IT$D$  |$e $H赗$H1臱c $$$'1n `l $$T$4"\$D$ 蔩|$ e {$'蚵$'1 `l $$T$e\$D$ ;|$ e $'A$$H m$$L$ T$D$ ⨓|$e $H$H1_b $$$'1F `l $$T$4"\$D$ l|$ e $'r$'1 `l $$T$e\$D$ |$ e r$'$$H m$$L$mԺT$D$ 躧|$e $H蘳$H17a $$$L'1 `l $$T$4"\$D$ D|$ e _$L'J$L'1Ů `l $$T$e\$D$ 릓|$ e $L'$$H m$$L$T$D$ 蒦|$e i$Hp$H1_` $$$'1 `l $$T$e\$D$ |$ e ю$'"$$H m$$L$?ET$D$ å|$e V$H衱$H1@ ` $T e |$|$D5D$D$HDŽ$HDŽ$H@_$$$&1׬ `l $$T$4"\$D$ |$e M$&$&1~ `l $$T$e\$D$ 褤|$ e Ҍ$&誰$$H m$$L$$T$D$ K|$e W$H)$H1ȫ^ $$$&1诫 `l $$T$e\$D$ գ|$ e $&ۯ$$H m$$L$aúT$D$ ||$e D$HZ$H1I] $$$<&1ગ `l $$T$4"\$D$ |$ e $<& $<&1自 `l $$T$e\$D$ 譢|$ e 1$<&賮$$H m$$L$oT$D$ T|$e $H2$H1ѩ!\ $$$%1踩 `l $$T$4"\$D$ ޡ|$ e $%䭗$%1_ `l $$T$e\$D$ 腡|$ e $%苭$$H m$$L$T$D$ ,|$e ($H $H1詨 ` $P|$|$@ e ɇ5wD$@$HDŽ$HDŽ$H`ȡ$O |$O e d$HDŽ$HDŽ$H[Z$$$%1 `l $$T$4"\$D$ |$e dž$%$%1虧 `l $$T$e\$D$ 迟|$ e L$%ū$$H m$$L$ҟT$D$ f|$e х$HD$H1㦗 `ȡ $JN |$O e ~$HDŽ$HDŽ$H`ȡ$M |$O e &$HDŽ$HDŽ$HX$$$p%1. K$p%DŽ$t%& `ȡ $yM |$O e $%DŽ$%DŽ$%4"$%DŽ$% `l $$T$D$D$ ܝ|$e $p%⩗$p%1] %$p%DŽ$t%* `ȡ $L |$O e $%DŽ$%DŽ$%e$%DŽ$% `l $$T$D$D$  |$e  $p%$$H m$$L$&T$D$ 貜|$e $H萨$H1/V $$$,%1 `l $$T$4"\$D$ <|$ e $,%B$,%1轣 `l $$T$e\$D$ 㛓|$ e |$,%駗$$H m$$L$ƦT$D$ 芛|$e $Hh$H1WU $$$$1 `l $$T$4"\$D$ |$ e i$$$$H m$$L$T$D$ 軚|$e $H虦$H18 ` $I|$|$< e 5D$<$HDŽ$HDŽ$H8T$$$`$1ϡ `l $$T$4"\$D$ |$e ~$`$$`$1v `l $$T$e\$D$ 蜙|$ e j~$`$袥$$H m$$L$ɦT$D$ C|$e }$H!$H1 ^$HDŽ$H`$H|$|$8 e x}5vD$8$HDŽ$HDŽ$HR$$$$1? `l $$T$4"\$D$ e|$e |$$k$$1柗 `l $$T$e\$D$  |$ e S|$$$$H m$$L$̦T$D$ 賗|$e {$H董$H10Q $$$#1 `l $$T$4"\$D$ =|$ e @{$#C$#1辞 `l $$T$e\$D$ 䖓|$ e z$#ꢗ$$H m$$L$զT$D$ 苖|$e Jz$Hi$H1XP $$$#1 `l $$T$4"\$D$ |$ e y$#$#1薝 `l $$T$e\$D$ 輕|$ e 7y$#¡$$H m$$L$7ںT$D$ c|$e x$HA$H10O $$$P#1ǜ `l $$T$4"\$D$ 픓|$ e $x$P#$$H m$$L$wkT$D$ 蔔|$e w$Hr$H1 ` $xC|$|$4 e Jw5ߠD$4$HDŽ$HDŽ$H$HDŽ$HM$$$ #1萛 `l $$T$4"\$D$ 趓|$e v$ #輟$ #17 `l $$T$e\$D$ ]|$ e  v$ #c$$H m$$L$ T$D$ |$e u$H➗$H1聚L $$$"1h `l $$T$4"\$D$ 莒|$ e t$"蔞$"1 `l $$T$e\$D$ 5|$ e t$";$$H m$$L$ئT$D$ ܑ|$e t$H躝$H1YK $$$"1@ `l $$T$4"\$D$ f|$ e ls$"l$"1瘗 `l $$T$e\$D$  |$ e r$"$$H m$$L$䦺T$D$ 贐|$e vr$H蒜$H11J $$$@"1 `l $$T$4"\$D$ >|$ e q$@"D$@"1迗 `l $$T$e\$D$ 叓|$ e cq$@"뛗$$H m$$L$T$D$ 茏|$e p$Hj$ d $ e p d >I$$ l $D$UYT$D$ |$Ge 5pl$$D$ bYL$D$ Ď|$Ge o!$ d  m$D$CD$HD$ $$ $$$T1 `l $$T$bY\$D$ 惓|$ e {a$T쏗$$H m$$L$T$D$ 荃|$e a$$$H m$$L$T$D$ u|$e N$}$1x `l $$T$bY\$D$ p|$ e fH$|$$H m$$L$PT$D$ p|$e G$$u$$H m$$L$NT$D$ !i|$e >$+$f$$H m$$L$T$D$ zZ|$e *$|$ e $ J$$H m$$L$T$D$ >|$e $ $|$$ ϴ$|$$0D$>' $|$$ ϴ$|$$tD$z>`$|$@D$Y> ϴ$|$$D$7>( $|$$ ϴ$|$$D$= ϴ$|$$D$= $|$$-ɣ $|$$u $|$$HD$!t ϴ$|$$&D$!+t $|$$HD$s!s ϴ$|$$&D$Q!s ϴ$|$$&D$/!r`$|$D$!q $|$$HD$ q ϴ$|$$'D$ q $|$$HD$ p ϴ$|$$L'D$ p ϴ$|$$L'D$d o $|$$HD$B n ϴ$|$$'D$ xn ϴ$|$$'D$m $|$$HD$em ϴ$|$$'D$l ϴ$|$$'D$ol $|$$HD$vk ϴ$|$$(D$T\k $|$$HD$2j ϴ$|$$\(D$1j $|$$HD$Fi ϴ$|$$(D$h ϴ$|$$(D$Ph`$|$D$g $|$$HD$gGg ϴ$|$$(D$Ef $|$$HD$#4f ϴ$|$$()D$e ϴ$|$$()D$>e $|$$HD$d ϴ$|$$)D$+d ϴ$|$$)D$yc $|$$HD$Wc ϴ$|$$)D$5b ϴ$|$$)D$"b $|$$HD$a ϴ$|$$8*D$a ϴ$|$$8*D$`` $|$$HD$_ ϴ$|$$|*D$_)_ ϴ$|$$|*D$=^C^ $|$$HD$] ϴ$|$$*D$C] ϴ$|$$*D$\ $|$$HD$0\ ϴ$|$$+D$[ ϴ$|$$+D$g:[ $|$$HD$EZ ϴ$|$$H+D$#'Z ϴ$|$$H+D$Y $|$$HD$Y ϴ$|$$+D$X'X $|$$HD$nW ϴ$|$$+D$oV ϴ$|$$+D$MxV`$|$pD$,U $|$$HD$ oU ϴ$|$$X,D$T ϴ$|$$X,D$yT`$|$`D$S $|$$HD$pS ϴ$|$$,D$aR ϴ$|$$,D$?zR $|$$HD$Q ϴ$|$$,D$gQ ϴ$|$$,D$P $|$$HD$TP ϴ$|$$$-D$O ϴ$|$$$-D$s^O $|$$HD$QN ϴ$|$$h-D$/KN ϴ$|$$h-D$ M $|$$HD$8M ϴ$|$$-D$L $|$$HD$%L ϴ$|$$-D$K ϴ$|$$-D$c/K $|$$HD$AJ ϴ$|$$4.D$J ϴ$|$$4.D$I $|$$HD$ I ϴ$|$$x.D$H ϴ$|$$x.D$H $|$$HD$u{G ϴ$|$$.D$SG`$|$PD$2[F $|$$HD$E ϴ$|$$/D$)E ϴ$|$$/D$D $|$$HD$D ϴ$|$$D/D$C ϴ$|$$D/D$f C`$|$@D$EvB $|$$HD$#B ϴ$|$$/D$A ϴ$|$$/D$!A`$|$0D$_@ $|$$HD$? ϴ$|$$/D$zm? ϴ$|$$/D$X> $|$$HD$6Z> ϴ$|$$0D$= ϴ$|$$0D$:=ep= d $O<Vp;=X d ; $|$$HD$=$ d $0; ϴ$|$$T0D$X: ϴ$|$$T0D$6-: ϴ$|$$T0D$9 ϴ$|$$T0D$79 ϴ$|$$T0D$8 ϴ$|$$T0D$A8 ϴ$|$$T0D$7 ϴ$|$$T0D$jK7 ϴ$|$$T0D$H6 ϴ$|$$T0D$&U6 ϴ$|$$T0D$5 ϴ$|$$T0D$_5 ϴ$|$$T0D$4 ϴ$|$$T0D$i4 ϴ$|$$T0D$|3 ϴ$|$$T0D$Zs3 $|$$HD$82 ϴ$|$$0D$F2 ϴ$|$$0D$1 ϴ$|$$0D$P1 ϴ$|$$0D$0 ϴ$|$$0D$Z0 ϴ$|$$0D$l/ ϴ$|$$0D$Jd/ ϴ$|$$0D$(. ϴ$|$$0D$n. ϴ$|$$0D$- ϴ$|$$0D$x- $|$$HD$, ϴ$|$$0D$~K, ϴ$|$$0D$\+ ϴ$|$$0D$:U+@ * $|$$HD$e* ϴ$|$$ 1D$) ϴ$|$$ 1D$o) ϴ$|$$ 1D$( ϴ$|$$ 1D$y( ϴ$|$$ 1D$d' ϴ$|$$ 1D$B' $|$$HD$ & ϴ$|$$d1D$ p& ϴ$|$$d1D$ % ϴ$|$$d1D$ z% ϴ$|$$d1D$ $ ϴ$|$$d1D$v $ ϴ$|$$d1D$T $ ϴ$|$$d1D$2 # ϴ$|$$d1D$ # ϴ$|$$d1D$ " ϴ$|$$d1D$ " ϴ$|$$d1D$ ! ϴ$|$$d1D$ '! $|$$HD$f u  ϴ$|$$1D$D  $|$$HD$"  ϴ$|$$1D$  ϴ$|$$1D$  ϴ$|$$1D$ n ϴ$|$$1D$  ϴ$|$$1D$x H ϴ$|$$1D$V  ϴ$|$$1D$4 " ϴ$|$$1D$  ϴ$|$$1D$ , $|$$HD$ " ϴ$|$$02D$  ϴ$|$$02D$ , ϴ$|$$02D$^  ϴ$|$$02D$< 6 ϴ$|$$02D$  ϴ$|$$02D$ @ ϴ$|$$02D$  ϴ$|$$02D$ J ϴ$|$$02D$  ϴ$|$$02D$p T ϴ$|$$02D$N  ϴ$|$$02D$, ^ ϴ$|$$02D$  ϴ$|$$02D$h $|$$HD$ ϴ$|$$t2D$; ϴ$|$$t2D$ ϴ$|$$t2D$`E ϴ$|$$t2D$> ϴ$|$$t2D$O ϴ$|$$t2D$ ϴ$|$$t2D$Y ϴ$|$$t2D$  ϴ$|$$t2D$c  ϴ$|$$t2D$r  ϴ$|$$t2D$Pm  ϴ$|$$t2D$.  ϴ$|$$t2D$ w  ϴ$|$$t2D$  ϴ$|$$t2D$  ϴ$|$$t2D$  ϴ$|$$t2D$  $|$$HD$b ϴ$|$$2D$@^ ϴ$|$$2D$ ϴ$|$$2D$h ϴ$|$$2D$ ϴ$|$$2D$r ϴ$|$$2D$ ϴ$|$$2D$t| ϴ$|$$2D$R ϴ$|$$2D$0 ϴ$|$$2D$  ϴ$|$$2D$ ϴ$|$$2D$ ϴ$|$$2D$ ϴ$|$$2D$ ϴ$|$$2D$d ϴ$|$$2D$B) ϴ$|$$2D$  $|$$HD$ ϴ$|$$@3D$ $|$$HD$ ϴ$|$$3D$n ϴ$|$$3D$v ϴ$|$$3D$TH ϴ$|$$3D$2 ϴ$|$$3D$" ϴ$|$$3D$w ϴ$|$$3D$ ϴ$|$$3D$Q ϴ$|$$3D$ ϴ$|$$3D$f[ ϴ$|$$3D$D ϴ$|$$3D$"e ϴ$|$$3D$ ϴ$|$$3D$o ϴ$|$$3D$ ϴ$|$$3D$y ϴ$|$$3D$x ϴ$|$$3D$V ϴ$|$$3D$4 ϴ$|$$3D$ ϴ$|$$3D$ ϴ$|$$3D$m $|$$HD$I ϴ$|$$3D$D ϴ$|$$ 4D$^ ϴ$|$$ 4D$<P ϴ$|$$ 4D$ ϴ$|$$ 4D$Z ϴ$|$$ 4D$ ϴ$|$$ 4D$d ϴ$|$$ 4D$ ϴ$|$$ 4D$pn ϴ$|$$ 4D$N ϴ$|$$ 4D$,x ϴ$|$$ 4D$  ϴ$|$$ 4D$ ϴ$|$$ 4D$ ϴ$|$$ 4D$ ϴ$|$$ 4D$ ϴ$|$$ 4D$``$|$ D$? $|$$HD$[ ϴ$|$$P4D$ ϴ$|$$P4D$e ϴ$|$$P4D$ ϴ$|$$P4D$o ϴ$|$$P4D$s ϴ$|$$P4D$Qy ϴ$|$$P4D$/ ϴ$|$$P4D$  ϴ$|$$P4D$ ϴ$|$$P4D$ ϴ$|$$P4D$ ϴ$|$$P4D$ ϴ$|$$P4D$c ϴ$|$$P4D$A ϴ$|$$P4D$& ϴ$|$$P4D$ $|$$HD$ ϴ$|$$4D$~ ϴ$|$$4D$ ϴ$|$$4D$u ϴ$|$$4D$S  ϴ$|$$4D$1 ϴ$|$$4D$ ϴ$|$$4D$ ϴ$|$$4D$! ϴ$|$$4D$ ϴ$|$$4D$+ ϴ$|$$4D$e ϴ$|$$4D$C5 ϴ$|$$4D$! ϴ$|$$4D$? ϴ$|$$4D$ ϴ$|$$4D$I ϴ$|$$4D$ $|$$HD$w ϴ$|$$4D$U ϴ$|$$4D$3& ϴ$|$$4D$ ϴ$|$$4D$0 ϴ$|$$4D$ ϴ$|$$4D$: ϴ$|$$4D$ ϴ$|$$4D$gD ϴ$|$$4D$E ϴ$|$$4D$#N ϴ$|$$4D$ ϴ$|$$4D$X ϴ$|$$4D$ ϴ$|$$4D$b ϴ$|$$4D$y ϴ$|$$4D$Wl ϴ$|$$4D$5 $|$$HD$? ϴ$|$$5D$ ϴ$|$$5D$I ϴ$|$$5D$ ϴ$|$$5D$S ϴ$|$$5D$i ϴ$|$$5D$GE ϴ$|$$5D$% ϴ$|$$5D$ ϴ$|$$5D$D ϴ$|$$5D$ ϴ$|$$5D$ ϴ$|$$5D${ ϴ$|$$5D$Y( ϴ$|$$5D$7 ϴ$|$$5D$2 ϴ$|$$5D$ ϴ$|$$5D$< ϴ$|$$5D$ ϴ$|$$5D$F ϴ$|$$5D$k ϴ$|$$5D$IP`$|$D$( $|$$HD$ ϴ$|$$5D$ ϴ$|$$5D$ ϴ$|$$5D$ ϴ$|$$5D$~) ϴ$|$$5D$\鮿 ϴ$|$$5D$:3 ϴ$|$$5D$鸾 ϴ$|$$5D$= ϴ$|$$5D$½ ϴ$|$$5D$G ϴ$|$$5D$̼ ϴ$|$$5D$nQ ϴ$|$$5D$Lֻ ϴ$|$$5D$*[ ϴ$|$$5D$ ϴ$|$$5D$e ϴ$|$$5D$`$|$D$& $|$$HD$Ǹ ϴ$|$$5D$_L ϴ$|$$5D$=ѷ ϴ$|$$5D$V ϴ$|$$5D$۶ ϴ$|$$5D$` ϴ$|$$5D$ ϴ$|$$5D$j ϴ$|$$5D$q ϴ$|$$5D$Ot ϴ$|$$5D$- ϴ$|$$5D$ ~ ϴ$|$$5D$ ϴ$|$$5D$鈲 ϴ$|$$5D$  $|$$HD$[ ϴ$|$$,6D$a ϴ$|$$,6D$?e ϴ$|$$,6D$ ϴ$|$$,6D$o ϴ$|$$,6D$ ϴ$|$$,6D$y ϴ$|$$,6D$ ϴ$|$$,6D$s郭 ϴ$|$$,6D$Q ϴ$|$$,6D$/鍬 ϴ$|$$,6D$  ϴ$|$$,6D$闫 ϴ$|$$,6D$ ϴ$|$$,6D$顪 ϴ$|$$,6D$& ϴ$|$$,6D$c髩 $|$$HD$A ϴ$|$$p6D$~% $|$$HD$k ϴ$|$$6D$ ϴ$|$$6D$u ϴ$|$$6D$ ϴ$|$$6D$k ϴ$|$$6D$I ϴ$|$$6D$'鉤 ϴ$|$$6D$ ϴ$|$$6D$铣 ϴ$|$$6D$ ϴ$|$$6D$面 ϴ$|$$6D$}" ϴ$|$$6D$[駡 ϴ$|$$6D$9, ϴ$|$$6D$鱠 ϴ$|$$6D$6 $|$$HD$鄟 ϴ$|$$6D$  ϴ$|$$6D$^ ϴ$|$$6D$m ϴ$|$$6D$K8 ϴ$|$$6D$)齜 ϴ$|$$6D$ ϴ$|$$6D$闛 ϴ$|$$6D$ ϴ$|$$6D$q ϴ$|$$6D$ ϴ$|$$6D$]{ ϴ$|$$6D$; ϴ$|$$6D$酘 ϴ$|$$6D$  ϴ$|$$6D$鏗 ϴ$|$$6D$ ϴ$|$$6D$陖 ϴ$|$$6D$o ϴ$|$$6D$M飕 ϴ$|$$6D$+( $|$$HD$ v ϴ$|$$<7D$鉓 ϴ$|$$<7D$(鶒 ϴ$|$$<7D$U ϴ$|$$<7D$c邑i ϴ$|$$<7D$7鯐== ϴ$|$$<7D$ ܏j ϴ$|$$<7D$ 闎 ϴ$|$$<7D$6č ϴ$|$$<7D$c ϴ$|$$<7D$[鐌a ϴ$|$$<7D$/齋5K ϴ$|$$<7D$ x ϴ$|$$<7D$饉 ϴ$|$$<7D$D҈ ϴ$|$$<7D$q ϴ$|$$<7D$S鞇W*M集 $|$$HD$: ϴ$|$$7D$鿅 ϴ$|$$7D$D ϴ$|$$7D$Ʉ ϴ$|$$7D$N ϴ$|$$7D$qӃ ϴ$|$$7D$OX ϴ$|$$7D$-݂ ϴ$|$$7D$ b ϴ$|$$7D$ ϴ$|$$7D$l ϴ$|$$7D$ ϴ$|$$7D$v ϴ$|$$7D$a ϴ$|$$7D$? ϴ$|$$7D$ $|$$HD$S~ ϴ$|$$8D$} ϴ$|$$8D$-} ϴ$|$$8D$| ϴ$|$$8D$s| ϴ$|$$8D$Q{ ϴ$|$$8D$/z ϴ$|$$8D$ fz ϴ$|$$8D$y ϴ$|$$8D$@y ϴ$|$$8D$x ϴ$|$$8D$Jx ϴ$|$$8D$cw ϴ$|$$8D$ATw ϴ$|$$8D$v ϴ$|$$8D$^v ϴ$|$$8D$u ϴ$|$$8D$hu ϴ$|$$8D$t ϴ$|$$8D$urt ϴ$|$$8D$Ss $|$$HD$1Es ϴ$|$$L8D$r ϴ$|$$L8D$ߒOr ϴ$|$$L8D$ߒq ϴ$|$$L8D$ߒAq ϴ$|$$L8D$ߒp ϴ$|$$L8D$eߒKp ϴ$|$$L8D$Cߒo ϴ$|$$L8D$!ߒUo%ܖn`$|$D$ޒQn $|$$HD$ޒm ϴ$|$$8D$ޒwmۖl ϴ$|$$8D$ޒtlۖk ϴ$|$$8D$Xޒwk^ۖj ϴ$|$$8D$,ޒtj2ۖi ϴ$|$$8D$ޒwiۖh ϴ$|$$8D$ݒthږg ϴ$|$$8D$ݒwgږf ϴ$|$$8D$|ݒtfږe ϴ$|$$8D$PݒweVږd ϴ$|$$8D$$ݒzd*ږc ϴ$|$$8D$ܒ}cٖb ϴ$|$$8D$ܒbٖa ϴ$|$$8D$ܒaٖ` ϴ$|$$8D$tܒ`zٖ` ϴ$|$$8D$Hܒ_Nٖ_ ϴ$|$$8D$ܒ^"ٖ^ ϴ$|$$8D$ے]ؖ ] ϴ$|$$8D$ے\ؖ\ ϴ$|$$8D$ے[ؖ[ ϴ$|$$8D$lےZpؖZdؖFYZؖX $|$$HD$(ےX ϴ$|$$9D$ےX`$|$D$ڒW ϴ$|$$9D$ڒW`$|$pD$ڒV ϴ$|$$9D$ڒ V`$|$`D$_ڒ}U ϴ$|$$9D$=ڒU`$|$PD$ڒyT ϴ$|$$9D$ْT`$|$@D$ْZS ϴ$|$$9D$ْR`$|$0D$ْPR ϴ$|$$9D$tْQ`$|$ D$SْFQ ϴ$|$$9D$1ْP`$|$D$ْ ϴ$|$$(:D$`Ԓ> ϴ$|$$(:D$>Ԓ= ϴ$|$$(:D$Ԓ#= ϴ$|$$(:D$Ӓ< ϴ$|$$(:D$Ӓ-< ϴ$|$$(:D$Ӓ; ϴ$|$$(:D$Ӓ7; ϴ$|$$(:D$rӒ: ϴ$|$$(:D$PӒA: ϴ$|$$(:D$.Ӓ9 ϴ$|$$(:D$ ӒK9Ж8 $|$$HD$ҒA8 ϴ$|$$l:D$Ғ7 $|$$HD$Ғ.7 ϴ$|$$:D$zҒ6 $|$$HD$XҒ5 ϴ$|$$:D$6ҒM5 ϴ$|$$:D$Ғ4 ϴ$|$$:D$ђW4 ϴ$|$$:D$ђ3 $|$$HD$ђD3 ϴ$|$$8;D$ђ2 ϴ$|$$8;D$jђN2 ϴ$|$$8;D$Hђ1 ϴ$|$$8;D$&ђX1 ϴ$|$$8;D$ђ0 ϴ$|$$8;D$Вb0 ϴ$|$$8;D$В/ ϴ$|$$8;D$Вl/ ϴ$|$$8;D$|В. ϴ$|$$8;D$ZВv. ϴ$|$$8;D$8В- ϴ$|$$8;D$В- ϴ$|$$8;D$ϒ- ϴ$|$$8;D$ϒ, ϴ$|$$8;D$ϒ, ϴ$|$$8;D$ϒ+ ϴ$|$$8;D$lϒ+ $|$$HD$Jϒg* ϴ$|$$|;D$(ϒ) ϴ$|$$|;D$ϒq) ϴ$|$$|;D$Β( ϴ$|$$|;D$Β{( ϴ$|$$|;D$Β( ϴ$|$$|;D$~Β' ϴ$|$$|;D$\Β ' ϴ$|$$|;D$:Β& $|$$HD$Β% ϴ$|$$;D$͒|% ϴ$|$$;D$͒% ϴ$|$$;D$͒$ ϴ$|$$;D$͒ $ ϴ$|$$;D$n͒# ϴ$|$$;D$L͒# ϴ$|$$;D$*͒" ϴ$|$$;D$͒" ϴ$|$$;D$̒! ϴ$|$$;D$̒)! ϴ$|$$;D$̒  ϴ$|$$;D$̒3  ϴ$|$$;D$^̒ ϴ$|$$;D$<̒= ϴ$|$$;D$̒ ϴ$|$$;D$˒G ϴ$|$$;D$˒ $|$$HD$˒ ϴ$|$$<D$˒ ϴ$|$$<D$p˒$ ϴ$|$$<D$N˒ ϴ$|$$<D$,˒. ϴ$|$$<D$ ˒ ϴ$|$$<D$ʒ  ϴ$|$$<D$ʒ ϴ$|$$<D$ʒ* ϴ$|$$<D$ʒ ϴ$|$$<D$`ʒ4 ϴ$|$$<D$>ʒ ϴ$|$$<D$ʒ> ϴ$|$$<D$ɒ ϴ$|$$<D$ɒH ϴ$|$$<D$ɒ ϴ$|$$<D$ɒR ϴ$|$$<D$rɒ $|$$HD$Pɒ% ϴ$|$$H<D$.ɒ ϴ$|$$H<D$ ɒ/ ϴ$|$$H<D$Ȓ ϴ$|$$H<D$Ȓ9 ϴ$|$$H<D$Ȓ ϴ$|$$H<D$ȒC ϴ$|$$H<D$bȒ ϴ$|$$H<D$@ȒM ϴ$|$$H<D$Ȓ ϴ$|$$H<D$ǒW ϴ$|$$H<D$ǒ ϴ$|$$H<D$ǒa ϴ$|$$H<D$ǒ  ϴ$|$$H<D$tǒk  ϴ$|$$H<D$Rǒ  ϴ$|$$H<D$0ǒu  $|$$HD$ǒ  ϴ$|$$<D$ƒH  ϴ$|$$<D$ƒ  ϴ$|$$<D$ƒR  ϴ$|$$<D$ƒ  ϴ$|$$<D$dƒ\  ϴ$|$$<D$Bƒ $|$$HD$ ƒ1 ϴ$|$$<D$Œ $|$$HD$Œ ϴ$|$$X=D$ŒP ϴ$|$$X=D$Œ ϴ$|$$X=D$vŒZ ϴ$|$$X=D$TŒ ϴ$|$$X=D$2Œd ϴ$|$$X=D$Œ ϴ$|$$X=D$Ēn ϴ$|$$X=D$Ē ϴ$|$$X=D$Ēx $|$$HD$Ē ϴ$|$$=D$fĒK ϴ$|$$=D$DĒ ϴ$|$$=D$"ĒU ϴ$|$$=D$Ē ϴ$|$$=D$Ò_ ϴ$|$$=D$Ò ϴ$|$$=D$Òi ϴ$|$$=D$xÒ ϴ$|$$=D$VÒs ϴ$|$$=D$4Ò ϴ$|$$=D$Ò} ϴ$|$$=D$’ ϴ$|$$=D$’ ϴ$|$$=D$’  ϴ$|$$=D$’ $|$$HD$h’ ϴ$|$$=D$F’d ϴ$|$$=D$$’ ϴ$|$$=D$’ ϴ$|$$=D$u ϴ$|$$=D$ ϴ$|$$=D$+ ϴ$|$$=D$z ϴ$|$$=D$X ϴ$|$$=D$6< ϴ$|$$=D$ $|$$HD$ ϴ$|$$$>D$@ ϴ$|$$$>D$ $|$$HD$  ϴ$|$$h>D$j ϴ$|$$h>D$H ϴ$|$$h>D$& ϴ$|$$h>D$ ϴ$|$$h>D$⿒ ϴ$|$$h>D$( ϴ$|$$h>D$螿 ϴ$|$$h>D$|2 ϴ$|$$h>D$Z ϴ$|$$h>D$8< ϴ$|$$h>D$ $|$$HD$ ϴ$|$$>D$Ҿ ϴ$|$$>D$谾 ϴ$|$$>D$莾 ϴ$|$$>D$l# ϴ$|$$>D$J ϴ$|$$>D$(- ϴ$|$$>D$ ϴ$|$$>D$佒7 ϴ$|$$>D$½ ϴ$|$$>D$蠽A ϴ$|$$>D$~ ϴ$|$$>D$\K ϴ$|$$>D$: ϴ$|$$>D$U ϴ$|$$>D$ ϴ$|$$>D$Լ_ ϴ$|$$>D$貼`$|$D$葼 $|$$HD$o ϴ$|$$>D$M@ ϴ$|$$>D$+ ϴ$|$$>D$ J $|$$HD$绒 ϴ$|$$4?D$Ż $|$$HD$裻 ϴ$|$$x?D$聻  $|$$HD$_t ϴ$|$$?D$= ϴ$|$$?D$~ ϴ$|$$?D$ ϴ$|$$?D$׺ ϴ$|$$?D$赺  ϴ$|$$?D$蓺 ϴ$|$$?D$q ϴ$|$$?D$O ϴ$|$$?D$-! ϴ$|$$?D$  ϴ$|$$?D$鹒+ ϴ$|$$?D$ǹ ϴ$|$$?D$襹5 ϴ$|$$?D$胹 ϴ$|$$?D$a? ϴ$|$$?D$? ϴ$|$$?D$I $|$$HD$ ϴ$|$$@D$ٸ ϴ$|$$@D$跸 ϴ$|$$@D$蕸 ϴ$|$$@D$s ϴ$|$$@D$Q ϴ$|$$@D$/ ϴ$|$$@D$ " $|$$HD$뷒 ϴ$|$$D@D$ɷ ϴ$|$$D@D$觷 ϴ$|$$D@D$腷 ϴ$|$$D@D$c ϴ$|$$D@D$A# ϴ$|$$D@D$ ϴ$|$$D@D$- ϴ$|$$D@D$۶ ϴ$|$$D@D$蹶7 ϴ$|$$D@D$藶 ϴ$|$$D@D$uA ϴ$|$$D@D$S $|$$HD$1 ϴ$|$$@D$ ϴ$|$$@D$ ϴ$|$$@D$˵ ϴ$|$$@D$詵( ϴ$|$$@D$臵 ϴ$|$$@D$e2 ϴ$|$$@D$C ϴ$|$$@D$!< ϴ$|$$@D$ ϴ$|$$@D$ݴF $|$$HD$軴 ϴ$|$$@D$虴 ϴ$|$$@D$w ϴ$|$$@D$U# ϴ$|$$@D$3 ϴ$|$$@D$- ϴ$|$$@D$ﳒ ϴ$|$$@D$ͳ7 ϴ$|$$@D$諳 ϴ$|$$@D$艳A ϴ$|$$@D$gƿ ϴ$|$$@D$EK ϴ$|$$@D$#о ϴ$|$$@D$U ϴ$|$$@D$߲ڽ ϴ$|$$@D$轲_ $|$$HD$蛲魼 ϴ$|$$AD$y2 ϴ$|$$AD$W鷻 ϴ$|$$AD$5< ϴ$|$$AD$ ϴ$|$$AD$F ϴ$|$$AD$ϱ˹ ϴ$|$$AD$譱P ϴ$|$$AD$英ո ϴ$|$$AD$iZ ϴ$|$$AD$G߷ ϴ$|$$AD$%d ϴ$|$$AD$ ϴ$|$$AD$ᰒn ϴ$|$$AD$述 $|$$HD$蝰A ϴ$|$$TAD${ƴ $|$$HD$Y. ϴ$|$$AD$7鳳 ϴ$|$$AD$8 $|$$HD$頲 ϴ$|$$ BD$ѯ% ϴ$|$$ BD$误骱 ϴ$|$$ BD$药/ ϴ$|$$ BD$k鴰 ϴ$|$$ BD$I9 ϴ$|$$ BD$'龯 ϴ$|$$ BD$C ϴ$|$$ BD$㮒Ȯ ϴ$|$$ BD$M ϴ$|$$ BD$蟮ҭ ϴ$|$$ BD$}W ϴ$|$$ BD$[ܬ ϴ$|$$ BD$9a ϴ$|$$ BD$ ϴ$|$$ BD$k ϴ$|$$ BD$ӭ ϴ$|$$ BD$豭u $|$$HD$菭é ϴ$|$$dBD$mH ϴ$|$$dBD$Kͨ ϴ$|$$dBD$)R ϴ$|$$dBD$ק ϴ$|$$dBD$嬒\ ϴ$|$$dBD$ì ϴ$|$$dBD$衬f ϴ$|$$dBD$ ϴ$|$$dBD$]p ϴ$|$$dBD$; ϴ$|$$dBD$z ϴ$|$$dBD$ ϴ$|$$dBD$ի鄣 $|$$HD$賫Ң ϴ$|$$BD$葫W ϴ$|$$BD$oܡ ϴ$|$$BD$Ma ϴ$|$$BD$+ ϴ$|$$BD$ k ϴ$|$$BD$窒 ϴ$|$$BD$Ūu ϴ$|$$BD$裪 ϴ$|$$BD$聪 ϴ$|$$BD$_ ϴ$|$$BD$=鉝 $|$$HD$ל ϴ$|$$BD$\ ϴ$|$$BD$ש ϴ$|$$BD$赩f ϴ$|$$BD$蓩 ϴ$|$$BD$qp ϴ$|$$BD$O ϴ$|$$BD$-z ϴ$|$$BD$  ϴ$|$$BD$騒鄘 ϴ$|$$BD$Ǩ  ϴ$|$$BD$襨鎗 ϴ$|$$BD$胨 ϴ$|$$BD$a阖 ϴ$|$$BD$? ϴ$|$$BD$颕 ϴ$|$$BD$' ϴ$|$$BD$٧鬔 $|$$HD$跧 ϴ$|$$0CD$蕧 ϴ$|$$0CD$s ϴ$|$$0CD$Q鉒 ϴ$|$$0CD$/ ϴ$|$$0CD$ 铑 ϴ$|$$0CD$릒 ϴ$|$$0CD$ɦ靐 ϴ$|$$0CD$触" ϴ$|$$0CD$腦駏 ϴ$|$$0CD$c, ϴ$|$$0CD$A鱎 ϴ$|$$0CD$6 ϴ$|$$0CD$黍 ϴ$|$$0CD$ۥ@ ϴ$|$$0CD$蹥Ō ϴ$|$$0CD$藥J ϴ$|$$0CD$uϋ ϴ$|$$0CD$ST $|$$HD$1r ϴ$|$$tCD$ ϴ$|$$tCD$| ϴ$|$$tCD$ˤ ϴ$|$$tCD$詤醈 ϴ$|$$tCD$臤  ϴ$|$$tCD$e鐇 $|$$HD$C ϴ$|$$CD$!} ϴ$|$$CD$ ϴ$|$$CD$ݣ釅 ϴ$|$$CD$軣  ϴ$|$$CD$虣鑄 $|$$HD$w ϴ$|$$CD$U~ ϴ$|$$CD$3 ϴ$|$$CD$鈂 ϴ$|$$CD$  ϴ$|$$CD$͢钁 ϴ$|$$CD$諢 ϴ$|$$CD$艢需 ϴ$|$$CD$g! ϴ$|$$CD$E ϴ$|$$CD$#+ ϴ$|$$CD$~ ϴ$|$$CD$ߡ5~ ϴ$|$$CD$轡} ϴ$|$$CD$蛡?} ϴ$|$$CD$y| ϴ$|$$CD$WI| ϴ$|$$CD$5{ $|$$HD${ ϴ$|$$@DD$z ϴ$|$$@DD$Ϡ&z ϴ$|$$@DD$譠y ϴ$|$$@DD$苠0y ϴ$|$$@DD$ix ϴ$|$$@DD$G:x $|$$HD$%w ϴ$|$$DD$'w ϴ$|$$DD$្v ϴ$|$$DD$迟1v ϴ$|$$DD$蝟u ϴ$|$$DD${;u ϴ$|$$DD$Yt ϴ$|$$DD$7Et ϴ$|$$DD$s ϴ$|$$DD$Os ϴ$|$$DD$ўr ϴ$|$$DD$诞Yr $|$$HD$荞q ϴ$|$$DD$kq ϴ$|$$DD$Ip ϴ$|$$DD$'p ϴ$|$$DD$o ϴ$|$$DD$㝒(o ϴ$|$$DD$n ϴ$|$$DD$蟝2n ϴ$|$$DD$}m ϴ$|$$DD$[,Q ϴ$|$$FD$P ϴ$|$$FD$6P ϴ$|$$FD$ؕO ϴ$|$$FD$趕@O ϴ$|$$FD$蔕N ϴ$|$$FD$rJN ϴ$|$$FD$PM ϴ$|$$FD$.TM ϴ$|$$FD$ L ϴ$|$$FD$ꔒ^L ϴ$|$$FD$ȔK`$|$D$觔K $|$$HD$腔J ϴ$|$$,GD$c?J ϴ$|$$,GD$AI ϴ$|$$,GD$II ϴ$|$$,GD$H ϴ$|$$,GD$ۓSH ϴ$|$$,GD$蹓G ϴ$|$$,GD$藓]G ϴ$|$$,GD$uF ϴ$|$$,GD$SgF ϴ$|$$,GD$1E ϴ$|$$,GD$qE ϴ$|$$,GD$풒D ϴ$|$$,GD$˒{D ϴ$|$$,GD$詒D $|$$HD$臒NC ϴ$|$$GD$eB ϴ$|$$GD$CXB ϴ$|$$GD$!A ϴ$|$$GD$bA ϴ$|$$GD$ݑ@ ϴ$|$$GD$軑l@ $|$$HD$虑? ϴ$|$$GD$wY? ϴ$|$$GD$U> ϴ$|$$GD$3c> ϴ$|$$GD$= ϴ$|$$GD$m= ϴ$|$$GD$͐< ϴ$|$$GD$諐w< ϴ$|$$GD$艐; ϴ$|$$GD$g; ϴ$|$$GD$E; ϴ$|$$GD$#:)9 $|$$HD$9 ϴ$|$$D$Տ9 ϴ$|$$D$賏8 ϴ$|$$D$葏8 ϴ$|$$D$o7 ϴ$|$$D$M7 ϴ$|$$D$+6 ϴ$|$$D$ $6 ϴ$|$$D$玒5 ϴ$|$$D$Ŏ.5 ϴ$|$$D$裎4 ϴ$|$$D$聎84 ϴ$|$$D$_3 ϴ$|$$D$=B3 ϴ$|$$D$2 ϴ$|$$D$L2 $|$$HD$׍1 ϴ$|$$ D$赍1 ϴ$|$$ D$蓍0 ϴ$|$$ D$q)0 ϴ$|$$ D$O/ ϴ$|$$ D$-3/ ϴ$|$$ D$ . ϴ$|$$ D$錒=. ϴ$|$$ D$nj- ϴ$|$$ D$襌G- ϴ$|$$ D$背, ϴ$|$$ D$aQ, ϴ$|$$ D$?+ ϴ$|$$ D$[+ ϴ$|$$ D$* ϴ$|$$ D$ًe* ϴ$|$$ D$跋) ϴ$|$$ D$蕋o) $|$$HD$s( ϴ$|$$PD$QB( ϴ$|$$PD$/' ϴ$|$$PD$ L' ϴ$|$$PD$늒& ϴ$|$$PD$ɊV& ϴ$|$$PD$觊% ϴ$|$$PD$腊0% ϴ$|$$PD$c$ ϴ$|$$PD$A:$ ϴ$|$$PD$# ϴ$|$$PD$D# ϴ$|$$PD$ۉ" ϴ$|$$PD$蹉N" ϴ$|$$PD$藉! ϴ$|$$PD$uX! ϴ$|$$PD$S  ϴ$|$$PD$1b  ϴ$|$$PD$ $|$$HD$툒5 ϴ$|$$D$ˈ $|$$HD$詈  ϴ$|$$D$臈 ϴ$|$$D$e ϴ$|$$D$C ϴ$|$$D$! ϴ$|$$D$ ϴ$|$$D$݇( $|$$HD$軇 ϴ$|$$`D$虇 ϴ$|$$`D$w ϴ$|$$`D$U ϴ$|$$`D$3 ϴ$|$$`D$) ϴ$|$$`D$ ϴ$|$$`D$͆3 ϴ$|$$`D$諆 $|$$HD$艆  ϴ$|$$D$g ϴ$|$$D$E* ϴ$|$$D$# ϴ$|$$D$4 ϴ$|$$D$߅ ϴ$|$$D$轅& ϴ$|$$D$蛅 ϴ$|$$D$y0 ϴ$|$$D$W ϴ$|$$D$5: ϴ$|$$D$ ϴ$|$$D$, ϴ$|$$D$τ ϴ$|$$D$譄6 ϴ$|$$D$苄 ϴ$|$$D$i@ ϴ$|$$D$G M  $|$$HD$  ϴ$|$$D$(  ϴ$|$$D$׃  ϴ$|$$D$赃2  ϴ$|$$D$蓃  ϴ$|$$D$q<  ϴ$|$$D$O  ϴ$|$$D$-F  ϴ$|$$D$  ϴ$|$$D$邒P ϴ$|$$D$ǂ ϴ$|$$D$襂Z ϴ$|$$D$胂 ϴ$|$$D$ad ϴ$|$$D$? ϴ$|$$D$n ϴ$|$$D$ ϴ$|$$D$فx~ $|$$HD$譁n ϴ$|$$,D$苁 ϴ$|$$,D$ix ϴ$|$$,D$G ϴ$|$$,D$% ϴ$|$$,D$ ϴ$|$$,D$ဒ ϴ$|$$,D$迀 ϴ$|$$,D$蝀 ϴ$|$$,D${ ϴ$|$$,D$Y ϴ$|$$,D$7% $|$$HD$s ϴ$|$$pD$ ϴ$|$$pD$} ϴ$|$$pD$ ϴ$|$$pD$ ϴ$|$$pD$k  ϴ$|$$pD$I ϴ$|$$pD$' ϴ$|$$pD$ ϴ$|$$pD$~  ϴ$|$$pD$~ ϴ$|$$pD$~* ϴ$|$$pD$}~ ϴ$|$$pD$[~4 ϴ$|$$pD$9~ ϴ$|$$pD$~> ϴ$|$$pD$} $|$$HD$} ϴ$|$$D$} ϴ$|$$D$} ϴ$|$$D$m} ϴ$|$$D$K}% ϴ$|$$D$)} ϴ$|$$D$}/ ϴ$|$$D$| ϴ$|$$D$|  ϴ$|$$D$| ϴ$|$$D$| ϴ$|$$D$]| ϴ$|$$D$;| ϴ$|$$D$| ϴ$|$$D${' ϴ$|$$D${ ϴ$|$$D${1 ϴ$|$$D${ ϴ$|$$D$o{; $|$$HD$M{ ϴ$|$$D$+{ ϴ$|$$D$ { ϴ$|$$D$z ϴ$|$$D$z ϴ$|$$D$z" ϴ$|$$D$z ϴ$|$$D$_z, ϴ$|$$D$=z ϴ$|$$D$z6 ϴ$|$$D$y ϴ$|$$D$y@ ϴ$|$$D$y ϴ$|$$D$yJ ϴ$|$$D$qy ϴ$|$$D$OyT ϴ$|$$D$-y ϴ$|$$D$ y^ $|$$HD$x ϴ$|$$<D$x1u $|$$HD$x ϴ$|$$D$yx ϴ$|$$D$Wx ϴ$|$$D$5x ϴ$|$$D$x ϴ$|$$D$w ϴ$|$$D$w$ ϴ$|$$D$w ϴ$|$$D$w. ϴ$|$$D$iw ϴ$|$$D$Gw8 ϴ$|$$D$%w ϴ$|$$D$wB ϴ$|$$D$v ϴ$|$$D$vL ϴ$|$$D$v ϴ$|$$D${vV ϴ$|$$D$Yv`$|$D$8v $|$$HD$v ϴ$|$$D$u7r ϴ$|$$D$u4 ϴ$|$$D$u ϴ$|$$D$u> ϴ$|$$D$bu ϴ$|$$D$@uH ϴ$|$$D$u ϴ$|$$D$tR ϴ$|$$D$t ϴ$|$$D$t\ ϴ$|$$D$t ϴ$|$$D$ttf ϴ$|$$D$Rt ϴ$|$$D$0tp ϴ$|$$D$t ϴ$|$$D$sz ϴ$|$$D$s ϴ$|$$D$s`$|$D$s $|$$HD$es[ ϴ$|$$D$Cs ϴ$|$$D$!se ϴ$|$$D$r ϴ$|$$D$ro ϴ$|$$D$r ϴ$|$$D$ry ϴ$|$$D$wr ϴ$|$$D$Ur ϴ$|$$D$3r ϴ$|$$D$r ϴ$|$$D$q ϴ$|$$D$q ϴ$|$$D$q ϴ$|$$D$q $|$$HD$gq ϴ$|$$D$Eqt ϴ$|$$D$#q ϴ$|$$D$q* ϴ$|$$D$p ϴ$|$$D$p $|$$HD$p ϴ$|$$D$yp ϴ$|$$D$Wp( ϴ$|$$D$5p ϴ$|$$D$p2 ϴ$|$$D$o鷿 ϴ$|$$D$o< ϴ$|$$D$o ϴ$|$$D$oF ϴ$|$$D$io˽ ϴ$|$$D$GoP ϴ$|$$D$%oռ ϴ$|$$D$oZ ϴ$|$$D$n߻ ϴ$|$$D$nd ϴ$|$$D$n ϴ$|$$D${nn ϴ$|$$D$Yn $|$$HD$7nA ϴ$|$$\D$nƸ $|$$HD$m. ϴ$|$$D$m鳷 ϴ$|$$D$m8 ϴ$|$$D$m齶 ϴ$|$$D$kmB ϴ$|$$D$Imǵ ϴ$|$$D$'mL ϴ$|$$D$mѴ ϴ$|$$D$lV ϴ$|$$D$l۳ ϴ$|$$D$l` ϴ$|$$D$}l ϴ$|$$D$[lj ϴ$|$$D$9l ϴ$|$$D$lt ϴ$|$$D$k ϴ$|$$D$k~ $|$$HD$k̯ ϴ$|$$D$kQ $|$$HD$mk鹮 ϴ$|$$(D$Kk> ϴ$|$$(D$)kí ϴ$|$$(D$kH ϴ$|$$(D$jͬ ϴ$|$$(D$jR ϴ$|$$(D$j׫ ϴ$|$$(D$j\ ϴ$|$$(D$]j ϴ$|$$(D$;jf ϴ$|$$(D$j ϴ$|$$(D$ip $|$$HD$i龨 ϴ$|$$lD$iC ϴ$|$$lD$iȧ ϴ$|$$lD$oiM ϴ$|$$lD$MiҦ ϴ$|$$lD$+iW ϴ$|$$lD$ iܥ ϴ$|$$lD$ha ϴ$|$$lD$h ϴ$|$$lD$hk ϴ$|$$lD$h $|$$HD$_h> ϴ$|$$D$=hâ ϴ$|$$D$hH ϴ$|$$D$g͡ ϴ$|$$D$gR ϴ$|$$D$gנ $|$$HD$g? ϴ$|$$D$qgğ $|$$HD$Og, ϴ$|$$8D$-g鱞 ϴ$|$$8D$ g6 ϴ$|$$8D$f黝 ϴ$|$$8D$f@ ϴ$|$$8D$fŜ ϴ$|$$8D$fJ ϴ$|$$8D$afϛ ϴ$|$$8D$?fT ϴ$|$$8D$fٚ ϴ$|$$8D$e^ ϴ$|$$8D$e ϴ$|$$8D$eh ϴ$|$$8D$e ϴ$|$$8D$ser ϴ$|$$8D$Qe ϴ$|$$8D$/e| ϴ$|$$8D$ e $|$$HD$dO ϴ$|$$|D$dԕ ϴ$|$$|D$dY ϴ$|$$|D$dޔ ϴ$|$$|D$cdc $|$$HD$Ad˓ ϴ$|$$D$dP ϴ$|$$D$cՒ ϴ$|$$D$cZ ϴ$|$$D$cߑ ϴ$|$$D$cd ϴ$|$$D$uc ϴ$|$$D$Scn ϴ$|$$D$1c ϴ$|$$D$cx`ώ $|$$HD$bn ϴ$|$$ D$b ϴ$|$$ D$bx ϴ$|$$ D$}b ϴ$|$$ D$[b邌 ϴ$|$$ D$9b ϴ$|$$ D$b錋 ϴ$|$$ D$a ϴ$|$$ D$a閊 ϴ$|$$ D$a ϴ$|$$ D$a頉 ϴ$|$$ D$ma% $|$$HD$Kas ϴ$|$$H D$)a ϴ$|$$H D$a} ϴ$|$$H D$` ϴ$|$$H D$`釆 ϴ$|$$H D$`  ϴ$|$$H D$`鑅 ϴ$|$$H D$]` ϴ$|$$H D$;`雄 ϴ$|$$H D$`  ϴ$|$$H D$_饃 ϴ$|$$H D$_* ϴ$|$$H D$_鯂 $|$$HD$_ ϴ$|$$ D$o_邁 ϴ$|$$ D$M_ ϴ$|$$ D$+_錀 ϴ$|$$ D$ _ ϴ$|$$ D$^ ϴ$|$$ D$^ ϴ$|$$ D$^~ ϴ$|$$ D$^%~ ϴ$|$$ D$_^} ϴ$|$$ D$=^/} ϴ$|$$ D$^| ϴ$|$$ D$]9| $|$$HD$]{ ϴ$|$$ D$] { ϴ$|$$ D$]z ϴ$|$$ D$q]z ϴ$|$$ D$O]y ϴ$|$$ D$-] y ϴ$|$$ D$ ]x ϴ$|$$ D$\*x ϴ$|$$ D$\w ϴ$|$$ D$\4w ϴ$|$$ D$\v ϴ$|$$ D$a\>v ϴ$|$$ D$?\u $|$$HD$\u ϴ$|$$X D$[t ϴ$|$$X D$[t ϴ$|$$X D$[s ϴ$|$$X D$[%s ϴ$|$$X D$s[r ϴ$|$$X D$Q[/r ϴ$|$$X D$/[q ϴ$|$$X D$ [9q ϴ$|$$X D$Zp ϴ$|$$X D$ZCp ϴ$|$$X D$Zo ϴ$|$$X D$ZMo ϴ$|$$X D$cZn ϴ$|$$X D$AZWn ϴ$|$$X D$Zm $|$$HD$Y*m ϴ$|$$ D$Yl ϴ$|$$ D$Yl ϴ$|$$ D$Yk ϴ$|$$ D$uYj ϴ$|$$ D$SYcj ϴ$|$$ D$1Yi ϴ$|$$ D$Y=i ϴ$|$$ D$Xh ϴ$|$$ D$Xh ϴ$|$$ D$Xg ϴ$|$$ D$X!g ϴ$|$$ D$eXf ϴ$|$$ D$CX+f ϴ$|$$ D$!Xe ϴ$|$$ D$W5e ϴ$|$$ D$Wd ϴ$|$$ D$W?d ϴ$|$$ D$Wc ϴ$|$$ D$wWIc ϴ$|$$ D$UWb ϴ$|$$ D$3WSb $|$$HD$Wa ϴ$|$$ D$V&a ϴ$|$$ D$V` ϴ$|$$ D$V0` ϴ$|$$ D$V_ ϴ$|$$ D$gV:_ ϴ$|$$ D$EV^ ϴ$|$$ D$#V^ ϴ$|$$ D$V] ϴ$|$$ D$U] ϴ$|$$ D$U\ ϴ$|$$ D$U(\ ϴ$|$$ D$yU[ ϴ$|$$ D$WU2[ ϴ$|$$ D$5UZ ϴ$|$$ D$U ϴ$|$$ D$M3> ϴ$|$$ D$M= ϴ$|$$ D$M== ϴ$|$$ D$_M< ϴ$|$$ D$=MG< ϴ$|$$ D$M; ϴ$|$$ D$LQ; ϴ$|$$ D$L: ϴ$|$$ D$L[: ϴ$|$$ D$L9 ϴ$|$$ D$qLe9 ϴ$|$$ D$OL8 $|$$HD$-L 8 ϴ$|$$4 D$ L7 ϴ$|$$4 D$K*7 ϴ$|$$4 D$K6 ϴ$|$$4 D$K46 ϴ$|$$4 D$K5 ϴ$|$$4 D$aK>5 ϴ$|$$4 D$?K4 ϴ$|$$4 D$KH4 ϴ$|$$4 D$J3 ϴ$|$$4 D$JR3 $|$$HD$J2 ϴ$|$$x D$J%2`$|$D$tJ}1 $|$$HD$RJ0 ϴ$|$$ D$0JH0 ϴ$|$$ D$J/ ϴ$|$$ D$IR/ ϴ$|$$ D$I. ϴ$|$$ D$I\. ϴ$|$$ D$I- ϴ$|$$ D$dIf- ϴ$|$$ D$BI, ϴ$|$$ D$ Ip, ϴ$|$$ D$H+ ϴ$|$$ D$Hz+ ϴ$|$$ D$H* ϴ$|$$ D$H* ϴ$|$$ D$vH * ϴ$|$$ D$TH) ϴ$|$$ D$2H) ϴ$|$$ D$H( $|$$HD$G' ϴ$|$$D$Gk' ϴ$|$$D$G& ϴ$|$$D$Gu& ϴ$|$$D$fG% ϴ$|$$D$DG% ϴ$|$$D$"G% ϴ$|$$D$G$ ϴ$|$$D$F$ ϴ$|$$D$F# $|$$HD$F" ϴ$|$$PD$xFf" ϴ$|$$PD$VF! ϴ$|$$PD$4Fp! ϴ$|$$PD$F  ϴ$|$$PD$Ez  ϴ$|$$PD$E $|$$HD$Eg ϴ$|$$D$EB`B $|$$HD$RE7 ϴ$|$$|D$0E $|$$HD$E ϴ$|$$$D$DV $|$$HD$Dk ϴ$|$$$D$D ϴ$|$$$D$Du ϴ$|$$$D$dD ϴ$|$$$D$BD ϴ$|$$$D$ D ϴ$|$$$D$C ϴ$|$$$D$C ϴ$|$$$D$C ϴ$|$$$D$C ϴ$|$$$D$vC ϴ$|$$$D$TC" ϴ$|$$$D$2C ϴ$|$$$D$C, ϴ$|$$$D$B ϴ$|$$$D$B6 ϴ$|$$$D$B $|$$HD$B  ϴ$|$$,D$fB ϴ$|$$,D$DB ϴ$|$$,D$"B ϴ$|$$,D$B ϴ$|$$,D$A ϴ$|$$,D$A' ϴ$|$$,D$A ϴ$|$$,D$xA1 ϴ$|$$,D$VA  ϴ$|$$,D$4A;  ϴ$|$$,D$A  ϴ$|$$,D$@E  ϴ$|$$,D$@ `$|$D$@  $|$$HD$@q  ϴ$|$$2D$i@  ϴ$|$$2D$G@{  ϴ$|$$2D$%@  ϴ$|$$2D$@ ϴ$|$$2D$?  ϴ$|$$2D$? ϴ$|$$2D$? ϴ$|$$2D${? ϴ$|$$2D$Y? ϴ$|$$2D$7? ϴ$|$$2D$?( ϴ$|$$2D$> ϴ$|$$2D$>2 ϴ$|$$2D$> ϴ$|$$2D$>< ϴ$|$$2D$k> ϴ$|$$2D$I>F`$|$pD$(> $|$$HD$> ϴ$|$$`5D$= ϴ$|$$`5D$=' ϴ$|$$`5D$= ϴ$|$$`5D$~=1 ϴ$|$$`5D$\= ϴ$|$$`5D$:=; ϴ$|$$`5D$= ϴ$|$$`5D$ (%= d %d©e ;avD$D$D$ e ;av'D$D$D$8D$<D$@A e ;av'D$D$D$0D$4D$8wBb e ;av'D$D$D$D$D$':" e ;av'D$D$D$D$D$ S e ;av'D$D$D$D$D$ S e ;av'D$D$D$D$D$GTb e ;av'D$D$D$D$D$T" e ;av'D$D$D$D$D$WW e ;av'D$D$D$D$D$X e ;av'D$D$D$D$D$ Ub e ;av'D$D$D$D$D$ U" e ;av'D$D$D$D$D$9 e ;av'D$D$D$D$D$; e ;av'D$D$D$D$D$Ob e ;avD$D$D$D$/9* e ;av'D$D$D$D$D$9 e ;av'D$D$D$D$D$K e ;av'D$D$D$D$D$Mb e ;av'D$D$D$D$D$:" e ;av'D$D$D$D$D$Je ;av$D$D$D$D$ D$z$e ;avD$D$ze ;avD$D$D$:%Ee ;avD$D$D$*$e ;avD$D$D$j$e ;avD$D$D$e ;av'D$D$D$ D$$D$(-re ;av'D$D$D$D$D$ /2e ;av'D$D$D$ D$$D$(.e ;avD$D$D$D$?%e ;avD$D$D$D$#ze ;avD$D$D$D$%:e ;av'D$D$D$D$D$7Se ;avD$D$D$D$ e ;av'D$D$D$D$ D$re ;av"YuD$ $xD$D$7ō|$ 9;uى#e ;a@YD$D$D$HD$D$LD$D$PD$ D$TD$D$XD$D$\D$D$`D$D$dD$ D$hD$$D$lD$(D$pD$,D$tD$08D$4L$8T$$|$X&$QI$L$T$$L$ $L$$L$$L$$L$$L$ $L$$cat$(|$Xl L$LL$TT$P|$|t$XS $t$|C L$T$$Ġp $9;#e ;avEYuBD$t,H@$D$L$t`D$ L$D$L$ kp d뢍|$9;u#e ;av=Yu:D$t$H@$D$L$TaD$ D$p 몍|$9;u#e ;av=Yu:D$t$H@$D$L$bD$ D$o 몍|$9;u#e ;avYD$$L$L$7.D$L$Q$D$ .D$L$ $D$D$uD$ D$e ;aD$HT$Z*09tV1ɄtLH Z jp9t1Ʉt@J9D$1,$t$\$~*L$ D$T$1‰,$t$\$[*L$ D$T$GRe ;av9Yu6t$ t s aD$L$L$$D$(m 뮍|$ 9;u‰#e ;av9Yu6t$ t  aD$L$L$$D$(m 뮍|$ 9;u‰#e D$;AY$1$|$X$$L$$L$$L$$L$ $L$$`t$(|$XL$LL$TT$P|$|t$X$t$|L$T$$Ġl $9;!#e ;av1Yu.t$taD$D$ l 붍|$9;uʉ#e ;avBD$$L$L$*D$L$ $D$D$8rD$ D$e ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$H'L$ D$T$4e ;av=Yu:D$t$H@$D$L$$dD$ D$j 몍|$9;u#e ;avEYuBD$t,H@$D$L$`D$ L$D$L$ kj d뢍|$9;u#e ;av=Yu:D$t$H@$D$L$aD$ D$j 몍|$9;u#e D$;AY$1$|$P$QI$L$T$$L$ $L$$L$$L$$L$_t$ |$PbL$DL$LT$H|$tt$PI$t$t9L$L$$Ęh $9;#e ;avYD$$L$L$'D$L$Q$D$p'D$L$ $D$D$nD$ D$Pe ;aD$HT$Z*09tV1ɄtLH Z jp9t1Ʉt@J9D$1,$t$\$#L$ D$T$1‰,$t$\$#L$ D$T$Re ;av9Yu6t$ t aD$L$L$$D$(Gg @뮍|$ 9;u‰#e D$;AY$1n$|$PV$/$L$$L$$L$at$ |$PL$DL$LT$H|$tt$P$t$tL$L$$ĘWf P$9;7#0e ;av9Yu6t$ t c`D$L$L$$D$(e 뮍|$ 9;u‰#e ;av/ Yu,D$@I$ыD$L$D$L$ 븍|$9;ủ#e ;av94Yu6t$8t gcD$0L$,L$Yu;D$t%@ $D$D$L$ D$L$G ĕ멍|$9;u#e ;avNYuKD$t5@ $D$D$L$T$ \$\$ T$$D$(L$,F {ĕ뙍|$9;u#e ;av?Yu|$$>15%$|$$D$鶑<볕᳕$|$$D$诶豳{觳O$|$$D$uw=m$|$$D$;D$(=ߡ$|$`D$ $|$$D$굑+Q鲕ݲvϲ7Ų $|$$D$蓵|Q蒲膲xnT$|$$D$Bߡ$|$PD$ $|$$D$봑n㱕$|$$D$豴0賱話$|$$D$wyooC$|$$D$=Q<&0&lj$|$$D$䳑D$P氕xߡ$|$@D$赳1$|$$D$蓳虰%lj苰$|$$D$WdyZljL@llj2:$|$$D$,ljꯕ$|$$D$踲/D$d躯ߡ$|$ D$色e$|$$D$gyjNlj\PljB$|$$D$ljn$|$$D$ұyծ]ljǮ*軮lj譮$|$$D$y.y|ljnyD$x^:ߡ$|$D$-$|$$D$ flj$|$$D$ϰ խljǭl$|$$D$蓰虭[lj苭&$|$$D$WyZljL@lj2l$|$$D$$T$|$.D$̯R-e ;a)0D$ D$$D$(D$,D$4H @QT D$<9}b$T|$Ge u2^D$DD$HD$LpD$P|$T0Í^ɋL$8L$DD$HD$@D$LD$PD$T0ËT$<9L$1 T$ÉЉD$\$H hpT$ l$$t$(L$,L$8ً*Rt$ 4$l$T$D$ L$u9D$@L$9|D$8D$DD$ B $*D$ D$ L$D$4L$8D$<D$@$1$G|$Ge u*QD$4D$8pD$<|$@$ÍQ ѸT$\$D$ B $*D$gD$L$ L$4D$8D$<D$@$û e ;aD$L$Y-09SvqAI 9uOA 9}/1 ;L$  _ ȉD$$D$(D$,É$L$D$xĐD$ 뼉$l$'D$ $ $l$'D$l  .e ;aD$D$H@ӟ9I1W B X9}Ћ+[5B9t@B$*^D$D$L$ L$$D$(D$,D$0É,$t$'D$ $T$'D$y  ;e ;aD$vwD$@B9uL$.D$B$D$D$ L$D$$L$(D$,D$0É $T$'D$ c 茄We ;a(D$0L$,YA I-09rs;-@ӟ9hD$$L$ST$\$ 1E9}p4>v9ul$<$t$D$͐D$ uD$$L$T$\$ l$b ;L$8 _ ȉD$t$P\$HT$tD$XPT$dD$8$$$$KD$T$ D$0L$,T$(\$$B9u*L$Xf.v L$dT$8TL$tT$HC$f-|$Ge u9DŽ$DŽ$p$$Í譄WcDŽ$DŽ$$$É$$DŽ$DŽ$Í09_ R\$xkƋD$TH؉D$|\$LK\$T1l$P}։݋\$T‹D$|9x|$Pt$Dl$pL$lT$@ QT$` L$4$$$$L$4L$T$ D$(L$$T$,\$009@uVD$D$H$<$@DŽ$DDŽ$HË$$$ 09a@$$T$D$L$ $8D$D$ L$T$\$$<$@$D$Hú$D$$,$($111$ʉÉ$$l$X$t$\$P$T$P$ $$$TfP$4L$$8L$ D$(L$$T$0\$,2T$XZl$\9$ߍ։ Le $@$9$$$ 09$X$D$\$t$ |$l$L$虤D$(L$$T$ \$$<$@$D$HÉI\$l$'$$L$T$l$ \$Ct$D$l$X$l$T$XDŽ$<DŽ$@$D$H11 b$($,N$$$4L$$8L$ D$,L$(T$$@ӟ9Y)$,$(\$P$r0$N$D$111$Eˉ։‰l$P9.$$$$$ȋ$R$X$,$$$M\$T$ D$,L$0T$(\$$$T$D$t$$$8$,$( q$M$$$L$$XL$ ZD$0L$,T$$\$($i؋$96$ߍΉLe u F艔$$|'$$T$L$\$ l$jt$D$\$h$|$$u$$$rDŽ$<DŽ$@$D$HDŽ$<DŽ$@$D$HÉ$$$@ӟ$$D$CǐD$ L$$<$@DŽ$DDŽ$HÉ$PT$|$L$詥D$th$$$$KD$|D$$PD$ D$,L$(T$$\$0$<$@$D$HDŽ$<DŽ$@DŽ$DDŽ$Hû8DŽ$<DŽ$@DŽ$DDŽ$HÃt$($, 3J$$$4L$$8L$ zD$,L$(T$$@ӟ9Y)$\$L$TD$$T$L111!$_$l$L͉ƉЋT$L9$<ًO$?@ӟ9QI$| $9 9 9 $$)$ۇ!,0l$L$$l$ -',$\$L$T$;H$$$$$$ ' $D$l$t$ |$D$t$$$$$$$|$|$4<$$D$虢D$$Q$9E$|,ȋt$4u| e u$щ‰'$A'$$|l$L$\$ T$D$L$\$Q$녋L$4d  d e $d $$$oQӃ uʀT$D$($ 11t$41)$X$($ T$DNj$(l$`$|$d$ $D$T$D$ $9$ $$(T$\$D\$L$ 貃D$L$T$$L$D$D$`HT$\$ l$d97$ύ Ɖ e \u"߉?@$x$'$$\$D$l$ L$t$D$l$HD$`$x$wD$`$$$9$|C9;93$$x)ˉ!ˍLL$D$t$ ' $$\$D$D$dD$D$x$$"'$$|l$L$\$ T$\$l$D$`$$9111=d $>R$F111l$$$@ӟ$$D$D$ L$$<$@DŽ$DDŽ$HÉ$HT$p$L$hD$tU$$D$pD$$HD$- D$L$ T$\$$<$@$D$HDŽ$<DŽ$@DŽ$DDŽ$HýuDŽ$<DŽ$@DŽ$DDŽ$Hà  @ӟ$49$8H$ $$-`&9}9}}3DŽ$<DŽ$@DŽ$DDŽ$HÍËH$<$@DŽ$DDŽ$HÅ d td e d $$$mQӃ uʀӃue$$$ 5`&9v$$$$$ $D$\$D$ $9}}3DŽ$<DŽ$@DŽ$DDŽ$HË$$$$D$$D$L$ z~D$L$T$$L$D$΁D$L$ $<$@DŽ$DDŽ$HÉ$ $D$\$$D$ $$$$$111=d :[111$8u $,$(P@$$$4D$$8D$ D$0L$,T$(\$$$<$@$D$Ho h a $L$'D$詷 B ; 4 - &     $l$'D$R 띒 ,$t$'D$3 $l$'D$ 贞 譞 覝 蟝 蘝 葝 $\$'D$ٶ $l$'D$ $T$'D$詶 B ; 4 ]!e ;ahD$`D$dL$xd t d e LD$|d L$`D$dL$`#QӃ uʀT$ D$XL$T\$p$l$tl$ɅD$L$ L$$$ND$L$$T$t9L$, $D$,D$L$ L$D$D$4$D$tL$$)ȉ!D$pȉD$ T$1&D$L$T$ Ӄj4D$\L$(D$T$D$XD$\$rD$L$T$ $L$D$D$\D$ D$(D$:wD$L$T$t@$L$D$}D$L$ $$DŽ$DŽ$hDŽ$DŽ$DŽ$DŽ$hÀtLT$X*Ç݃DŽ$DŽ$DŽ$DŽ$hËT$X벉T$0^$ސ|$Ge u ͻͻ6DŽ$DŽ$DŽ$DŽ$hËT$T$T$XT$\$D$ L$uD$L$T$t@$D$L$|D$L$ $$DŽ$DŽ$hDŽ$DŽ$DŽ$DŽ$h111=d D$| 5D$|111D$0G E$|$ 7 ` e ;a_|$\5$1d  d e $d L$dD$hL$dQӃ uʀT$$D$HL$D$ܐD$111 l$,MՉډL$,T$4\$0D$Tl$D,$t$Ht$|$$|$~D$ L$,9D$D$T$HT$\$$\$L$ vD$L$T$$L$D$zD$ D$ L$L$@D$lL$pT$lrCP$ЋD$tL$0Q\$499D$T,ȋt$ u-e |u L$@ D$@3'$l$Tl$L$\$ T$D$L$\$QL$0딋L$ d  d e D$@d L$\D$`L$\\QӃ uʀT$8D$PL$L1ۋl$4t$0|$TD$(XD$PL$LT$8NjD$Pl$4t$0|$T\$( $D$T$@|D$ L$(9D$L$T$PT$\$8\$L$ uD$L$T$$D$L$TxD$0HT$ \$l$494t$Tύ Ɖ e Tu@׉1,T$<\$X'$\$T\$D$l$ L$Ot$D$l$HD$0T$<\$X뉋\$4T$0D$T111=d D$@1qD$@h11111D$TD$tD$0D$xD$4D$|@ӟ$D$tD$WD$ L$$$DŽ$DŽ$Ā111J=d $w0 $111e ;aD$lD$p$d  d e s$d L$lT$pL$lGY݃ uˀ$$؍J9UL$\^.|$D101@9}"Lt|H|D ىt$@T$`111ۍl$,|$,GT$`Ét$@L$4\$0l$hD$,|$\<$T$t$0yD$ L$,9D$\$T$`T$\$@\$L$ qD$L$T$$L$D$DuD$ L$T$0Zl$494t$hߍ։e Tu B׉É..D$8L$d'$L$hL$T$l$ \$?t$D$l$XD$8L$dT$0뉋D$h$D$0D$D$4D$D$DD$ D$D$D$(D$hL$$L$!=&$,qd T$L$D$tD$,$T$0D$|$]D$L$$$DŽ$DŽ$0$$D$D$L$ $$$D$$D$D$ D$nD$L$L$4$1$$D$4$$hP$$ @H$$$$$$ $$$D$裠D$L$ $$tT$,$xT$0$|$$dË$hI$$1DŽ$$$L$,Q\$09$-e $B#$t$x$|DŽ$DŽ$dÉ$T$,\$0$|$$D$$T$,\$0둍$$D$L$\$ T$ٓD$L$\$QL$,8$h$L$D$&D$ D$$$X"D$,HT$09g$L$,<e u$""D$,$T$p$|$$D$T$p$$$l$D$T$ L$ؓ\$D$T$HD$,c$h$L$D$=D$ D$,$$g!D$,HT$09g$L$,-e T$X$$$l$D$T$ L$ ӓ\$D$T$HD$,c$$tD$,$xD$0$|$$dÍ$<1$h $N$<$yL$L$@T$$$<ZL$@D$,HT$09g$L$,<e u$ًD$,$T$T$|$$D$T$T$$$l$D$T$ L$ѓ\$D$T$HD$,c$$tD$,$xD$0$|$$dÍ$P1q$h $ $P$2L$L$D$L$$QT$D$D$ L$דD$L$$$1D$ 8$Yi q9,4$ $p$$p$t$Q $x$|$,$$$p$$$$51f  $$L$ kL$T$ $<$@Í$hJ$ $׍$  #1$h$L$4$T$8$$h$$$$$<$@Ã$T$X$$$111$17$$$T$Xދ$$$$$$\FM ]U9$ $\$$\$$,$D$$$L$$$T$ $$|$H1$Q Yi9)T4$HH$$H5$$Q$9p$$e I|u$m$$@$|$$D$1$$-@$$l$L$\$ T$荢l$D$\$P1$U$$D$yD$ L$u1L$d$$50L$d$<$@Í$$50$<$$@É,$D$D$L$ t5$$$51$<$$@Í$p1DŽ$pL$X$t$$x$$|$$$$$$$p DŽ$<DŽ$@Í$ DŽ$  $W|$$ e $ $$DŽ$DŽ$$P1 ޥ $ (qd L$D$@L$ L$$ $3$P$(L$ L$xT$$$$$P$X1DŽ$X ߡ $g|$$ e $e $yuc$$$dDŽ$hDŽ$l$$$X_D$x$<$$@Í@$|$$D$>늍@$|$$D$H@$|$$ D$6  $ $iY ׋Q9u $T$ $$ $L$T$HL$T &$ k$ $$ $#L$ $T$$H$ t.$$5P1$<$$@Í$1$ $$$ $$H('t$4$|L$L$T$P$$Z$$$G$$<$@Ã$$D$GD$ L$$$D$ D$L$ $1 ޥ $ (qd L$D$蒷L$ L$$ $0$$zL$$$T$ $H$X$(1hDŽ$( ߡ $赇|$$ e $ e $yu`$H$$4DŽ$8DŽ$<$$$(DŽ$<DŽ$@Í@$|$$HD$덍@$|$$ D$pK$$51=$<$$@É$$$51$<$$@ÉL$t$$5p1L$t$<$@à B$ޔ ޥ $ (qd L$D$ tL$ L$$ $[$$\L$$$T$ T$l$0$6$1NޔDŽ$ ߡ $蛅 e |$$$ e $yuc$0$$DŽ$DŽ$$$$D$l$<$$@Í@$|$$0D$rߐ늍@$|$$ D$SߐH qU$.ݔ ޥ $ (qd L$D$ԳL$ L$$ $$$L$$$T$ T$\$`$$1ܔDŽ$ ߡ $|$$ e $ Je $yuc$`*$$DŽ$DŽ$$$$D$\$<$$@Í@$|$$`D$ݐ늍@$|$$ D$ݐH$8۔ ޥ $ (qd L$l$VL$ L$$ $=$8$>L$ L$`T$$$x$8L$`0$@1+۔DŽ$@ `- $$L$=ZL$ T$$D$H ߡ $I|$$ e $ ߔe $yu`$xxߔ$$LDŽ$PDŽ$T$$$@AߔDŽ$<DŽ$@Í@$|$$xD$#ܐ덍@$|$$ D$ܐK$$501ޔD$`$<$@Í$ٔ ޥ $ (qd L$D$ xL$ L$$ $_$$`ޔL$ L$hT$$$$$:ޔ$1RٔDŽ$ ߡ $蟀|$$ e $ ݔe $yuc$ݔ$$DŽ$DŽ$$$$ݔD$h$<$$@Í@$|$$D$vڐ늍@$|$$ D$WڐH; ; ; ; ; 躿e $;AU$1הL$$$ \$l$$9!$הDŽ$$ה$ה$QY i9\4$Gܔ$$4ܔ$"$4הDŽ$11҉L$XT$|$ הDŽ$  ߡ $^~|$$ e $۔e $yu`$۔$$,DŽ$0DŽ$4$$ V۔D$X$D$|$ĀÍ@$|$$D$8ؐ덍@$|$$D$ؐK$֔ ޥ $ (qd L$D$踬L$ L$$ $?%$$ڔT$$L$ L$X$$ڔ1L$Xwz2$)D$L$$UqT$D$L$ D$“D$D$TL$L$t$$ڔ$@$ڔ$1Ք$ՔD$t$D$T$$H$$$L$$$ٔ$X$ٔ$53hٔ$$XD$ VD$L$ $$ĀÍ$LԔDŽ$  ${ e |$$5P2ؔ$$DŽ$DŽ$ $01Ӕ ޥ $ (qd L$D$胪L$ L$$ $ #$0$kؔL$ L$dT$$$$0LؔL$d$1XӔDŽ$ ߡ $z e |$$$הe $yu`$ה$$DŽ$DŽ$$$הDŽ$DŽ$ĀÍ@$|$$D$Ԑ덍@$|$$D$`ԐK$5p2-הD$d$$ĀÍ$|$P2D$Ԑ $x Ҕ$ $ߍ502֔$x$֔L$8$T$4$$x֔$$֔$$$ĀÉ$D'$,`є$Q iY9z T$,֔$$,֔$ $є$ $$$ՔL$L$`$$ՔL$`t/$52ՔDŽ$DŽ$ĀÍ$1Д$ $$52?Ք$$,Քt$4$ՔL$LL$pT$P$$Ԕ$$ԔL$p$$ĀÃ$ϔ$Q iYύK9 L$Ԕ$$qԔ$tr$uϔ$ $$4ԔL$L$pT$ $$Ԕ$$ԔL$p$$ĀËJJ$Δ ޥ $ (qd L$D$蠥L$ L$$ $'$$ӔL$ L$hT$$$$iӔL$h$1uΔDŽ$ ߡ $u e |$$5 Ҕe $yu`$Ҕ$$DŽ$DŽ$$$ҔDŽ$DŽ$ĀÍ@$|$$D$ϐ덍 ߡ$|$ D$ϐL$52LҔD$h$$ĀË$$hA͔$ $D$$h$єL$ L$lT$$$X$hєL$l$$D$D$L$ t5$$5p3є$$$ĀÍ$$X[єDŽ$DŽ$ĀÍ$5P3,єD$l$$Āà t$8̔DŽ$8 0 $$L$LL$ T$$<$@$$8ДDŽ$DŽ$ĀÍ$H˔$ $ $H$aДL$ $T$$`$H?Д$$`,Д$$$ĀÃJt$P ˔DŽ$P 0 $$L$JL$ T$$T$X$$PϔDŽ$DŽ$ĀÍ'$qD$$$$$T$L$軺D$L$T$ $L$D$@D$ $D$:D$L$t/L$\$51ΔL$\$$ĀË$Q L$p$1ɔDŽ$ L$p$$DŽ$DŽ$ĀÍ$ɔDŽ$ 0 $$L$IL$ T$$$$1Nɔ$Q Yi9vT4$Δ$D$͔$D$0$͔$T$0͔$Ȕ$Ȕ ($DŽ$ .$Q $$$($`$,$$R͔$|$?͔$52#͔  $$|L$IL$T$ $$ĀÍ$$̔DŽ$DŽ$ĀÃe$ǔ ޥ $ (qd L$D$kL$ L$$ $R$$S̔L$$L$xT$ $($4̔$1DǔDŽ$  $n|$$ e u`$(˔$$DŽ$DŽ$$$˔DŽ$DŽ$ĀÍ@$|$$(D$Ȑ덍$53_˔$D$x$ĀÍ$524˔DŽ$DŽ$ĀÃ$$ʔ$h$ʔ$Ŕ$Ŕ 1$DŽ$$Q $$$t$$$~ʔ$l$kʔ$53Oʔ  $$lL$FL$T$ $$ĀÍ$p3Ŕ ޥ $ (qd L$D$ٛL$ L$$ $$p$ɔL$$$T$ $@$pɔ$1ĔDŽ$  $k e |$$u`$@Oɔ$$DŽ$DŽ$$$ɔDŽ$DŽ$ĀÍ@$|$$@D$Ő덍$503Ȕ$$$Ā%' ' ' ' 9e D$;A$1|ÔL$L$D1111T$(\$8l$,T$(\$@l$,$FÔ$ $D$$t$DǔL$ L$0T$$|$p$ǔL$0L$(Q\$,9D$@D$8T$(\$, I<ȋ e St$pǔ|$H1”$iQ Y9T|$Hfǔ|$\t$HYǔL$\tV$$D$kD$L$ L$<$53 ǔ$D$<$ĠË$$D$D$ L$t/L$4$54ƔL$4$$ĠÍ$1DŽ$L$8$L$($L$,$DŽ$DŽ$ĠÍ@$|$D$pD$IÐD$8T$(\$,@$l$@l$L$\$ T$}D$L$\$QL$(($53ŔD$0$$Ġ.$ W"e $;A l$t1L$L$P111 L$Pډl$D\$0|$pq$pi׋Q Y9|$8t$Lt|$p Ŕ$t$pŔ$p$D$+D$($D$($L$<$p$D$D$ L$$T1辿$p $D$m$Tt$PqĔL$$L$@T$ $$$TRĔ5L$$D$ D$t/$t54w”DŽ$DŽ$lÍ$t1rDŽ$t L$D$L$0$L$4$DŽ$DŽ$lË$p$D$(D$u1$p\$4l$0k$t54DŽ$DŽ$lÍ@$|$$<D$螾D$DT$0\$4@$l$Ll$L$\$ T$kxD$L$\$QL$0@$|$$$D$6P$t5p4$D$@$lÉL$,$t5P4L$,$$lË$p$D$D$$1豻$襻$pQ Yi9T4$]$n ܽ$DŽ$1$pQ $$$$ $$$$뿔$t504Ͽ  $$L$r|$dD$d$ڶDŽ$  $'^|$|$4 e $ye L$4yt$d[e L$4y0uZt$|AD$4$DŽ$DŽ$$$ DŽ$DŽ$Í@$|$D$|D$듍@$|$D$dD$ַZ@$|$$D$贷$譵 ޥ $ (qd L$D$SL$ L$$ $$t$8>L$$L$0T$ |$d$"u1W$55$D$0$ÉL$($54ֹL$($$Í$54諹D$,$$  2e $,;AT$`1i|$ta$XQY i9D4|$t$t$t $D$(|$85hL$8 $D$D$D$ $D$L$L$HT$( |$`1蹳|$L谳$XQY i9\4|$Lk$| d$DŽ$($XQ $$L$X$|$`$$t$`$`5/淔  $$L$4L$T$ $x$|TË$X$D$ D$ L$t/L$,$`5.wL$,$x$|TÍ$1v$X $$t$H1L$ L$DT$$$$`$$xL$D$|TË$X$D$ D$ L$t/L$0$`505譶L$0$x$|TÍ$1謱$X $$t$HgL$ L$DT$$ $H$`$ 5$xL$D$|TÍ$$14$X $$\L$t$$$䵔L$ L$4T$$$<$$ŵ$`$<貵L$4$x$|T  2 e $@;A@$L1i|$`a$DQY i9lD4|$`$t$` $D$, ޥ $ (qd L$D$džD$ L$L$4T$,H|$L1|$8踯$DQ Yi9T4|$8s|$t臯 ոL$tD$x$DQ L$|$L$D$|$Lt$t)$t$L$L5p/  $$L$0L$ T$$d$h@Ë$D$D$D$ L$t/L$($L5P/莳L$($d$h@Í$1荮$D $$HL$$t$4=L$$L$0T$ $$$L$ $dL$0$h@Í$1 $D $$HL$趲$t$4躲L$$L$0T$ $$蛲$L$舲$dL$0$h@Í$1臭$D $$HL$3$t$47L$$L$0T$ $($$L$($dL$0$h@Í$L50/ڱDŽ$dDŽ$h@4 - V1e ;av(D$L$T$1C9} ,9uD$D$e ;a$D$(sU ^ X D9=)Љ!ЉD$,L$0$D$D$ `- $D$+D$L$ D$L$ 7$D$ D$D$D$ D$yD$L$L$,D$0$  e ;a$D$D$ L$(Q3bq9D$,utD$0$1;9D$,d t d e Zd L$D$ L$5QӃ uʀӃu! $D$\$yD$ D$0$ÃjwxtM $D$\$oD$L$T$ $L$D$D$L$ $D$D$D$0$ÀtƒtD$0$ÉT$^$ Q|$Ge u ͻ ͻ耨D$0$ÃuD$0$111=d E111T$0$ËD$,EɋD$,B p/ud@ӟ9uOD$,Xt9\u*09uPtD$0$úD$0$ËD$,뭋D$,D$0$ËD$G E$|$ Ꮤe ;av4D$$D$D$D$ D$D$$D$ "D$D$(腏e ;aHD$P$L$XL$L$\L$L$`L$ D$ L$T$\$3\BPD$$D$4JL$($ND$L$(T$$\$Pl$Lt$411|$01 \$$t$P|$L֋|$,l$0T$$l$L99_lUml$Dl$091\$,1|e u\$D땉ËD$Dե놉|$@t$8T$< ' $D$|$l$ \$bD$L$l$YL$(T$t$(t(頔D$,D$xD$ L$L$0D$4$o h릍|$(9;u#e ;av9 Yu6t$$t yD$L$L$(D$,  뮍|$$9;u‰#e ;av7 Yu4D$t$D$L$L$D$  袂밍|$9;uĉ#e ;avaD$$L$L$D$ D$ L$Q$D$8ÏD$L$ $D$D$ D$ D$e ;avqD$T$9uZJZhp9t+1Ʉt!H Z 9u@J9D$11$t$L$蠿L$ D$T$1舁se ;av9Yu6t$ t 賞sD$L$L$$D$(7 0뮍|$ 9;u‰#e ;avYD$$L$L$D$L$Q$D$D$L$ $D$D$A D$ D$谀e ;aD$HT$Z*09tV1ɄtLH Z jp9t1Ʉt@J9D$1,$t$\$.L$ D$T$1‰,$t$\$ L$ D$T$Re ;av9Yu6t$ t #PqD$L$L$$D$( 뮍|$ 9;u‰#e ;av9Yu6t$ t ÜPqD$L$L$$D$(G @뮍|$ 9;u‰#e ;av+D$$D$D$D$D$ D$~e ;av&D$T$9uJ@8D$ 1~e ;av81L$ D$ T$‰$L$\L$D$ @|ۉL$Q~e ;avkD$L$1\$S\$l$؉};Ѝ,ы3[}m9uT$4$l$\$޻D$ uD$ D$ }ye ;av81L$ D$ T$‰$L$lL$D$ @|ۉL$a}e ;avkD$L$1\$S\$l$؉};Ѝ,ы3[}m9uT$4$l$\$D$ uD$ D$ |ye ;av81L$ D$ T$‰$L$\L$D$ @|ۉL$q|e ;avBD$L$1B}*Ћ,ыm9u\lm8ÕtD$ D$ |e ;a`@D$0D$4D$DD$8L$HL$ $FD$D$D$ mD$<$l $D$~D$ uD$<$l,$d$$hD$$D$赞D$ L$DŽ$DŽ$$$$$D$D$D$ $D$D$D$CH$$ L$D$ z$d$$hL$$T$D$ L$L$t1$ ‰؉$T$hH$$hl$x54$D$$|$p|$ECD$L$ $$L$D$Vy$$$L$T$xT$DęD$L$ $$L$D$D$ D$ED$L$L$D$$$x$d$$hL$$T$$\$ $\$\$x\$D$ L$T$$L$D$D$pD$ $D$R$d$$hL$$T$D$ HL$h9AL$t9]$D$$D$A$$5D$D$VD$D$IDD$ L$L$D$$$w$$ ȝL$D$wL$hOD$xG E$|$2ȑ K t=?e ;a BJL$Ql$(9txt D$, ËD$$$l$CD$D$L$ L$T$R$T$CD$ L$T$9uD$$L$T$zD$ tD$, ÈD$T$$D$$D$zD$ uD$L$l$(UD$, ;e ;a *e v u萻 *e R=aӶcXD?l͖$D$4Oe L$u od *e  Í=od HS;Le ;aD|$T1TL$LL$(T$PT$,\$H$-0l$t$(t$, L$T$\$ T$\$D$LD$ D$PD$$0$D$ D$ӏD$ L$L$D$D$H$D$D$ L$L$ |$01]SD$ `9u;|$0t$%X|$Tt$0XD$hDÍ|$T5XD$hDÉ$L$'D$Ϗ |:e ;avmP|$<1RL$T $L$XL$L$\L$t$ |$Q|$t$,1QߖD$(D$\@3e ;a D$$HP Xj9?JH R<Ëe u t$(P Í@]$|$D$(D$M@]$\$T$L$ l$D$L$T$\$$Se uCʉʼn؉v{qJ25e ;a\D$`H @~vL$$11 l$(ʉÉD$(T$ \$|$DO|$,t$DOt$,O^D$tD$L$ AT$$9|D$d\ËL$A1:2Ue ;acH|$P1JD$LH p$|$0EOt$0:OD$D$LHPX iۇK\$$9wo9L$ T$,T$\$L$ @]$l$\$t$,ND$$L$LA D$ Ae u D$,A8yD$,H't$ l$(@]$T$D$L$ \$yL$T$D$L\$$l$(t$ J|$Pt$03ND$hHÍ|$P5p*ND$hH艭 0}e ;aHtD$x$0$L$L$SD$ D$D$xD0$L$L$zD$D$ L$L$T$ T$81l$4]D$ L$T$8l$$9\$4D$< ؋T$@IL$,-`,$t$xt$T$L$ 8D$t`$L$xL$T$@T$T$,T$ 8D$tBP\$4l$9s~t$8lUe <ޅu?‰$F/11뽉$L$D$D$ D$)D$L$D$|$t11  =.e ;av<D$$D$ D$D$$D$`D$L$ T$L$(D$,T$0-e ;av3D$$D$D$D$ D$D$$D$ D$(D$b-e ;av# D$$D$D$D$D$l F-e ;avD$ $D$D$m-e ;av/ BJ$D$D$D$D$HD$ *,e ;avC2e vuګ 2e w͛rH Re胄2e V,e ;av2Yu/t$ tyID$D$$ ,뵍|$ 9;uɉ#e ;a D$$L$L$lD$L$Q$D$lD$L$Q$D$lD$L$Q$D$nlD$L$Q $D$WlD$L$Q($D$@lD$L$Q0$D$)lD$L$8 $D$lD$D$ +e ;aD$H\$k391ɄH Pks 91Ʉ{HPks9E1Ʉ4HSkp91ɄH$S$k p 91ɄH,S,k(p(9tt1ɄtjH4S4k0p09t;1Ʉt1H8S<[8@<9t 1D$É$L$T$gD$ 1݉,$t$T$gL$ D$\$1뤉,$t$T$gL$ D$\$l1e,$t$T$gL$ D$\$)1",$t$T$egL$ D$\$1,$T$t$hÉ$@$D$L$ D$$l$l$ t$999$d$)Ɖ$@ۇ!ƍD5D$T$$D$ @$|$T$L$3?D$t$\$($$$$d$D$$$D$TD$t@$$`$$ @ $l$D$t$ \$_l$t$$$$$$`@$D$T$D$$l$l$ t$9n9f9^$h$)Ɖ$@ۇ!ƍD5D$T$$D$ @$|$T$L$=D$t$l\$($$$$h$D$L$D$hD$t$$\$$ @ $l$D$t$ \$l$t$$$$$$\@$D$T$D$$l$l$ t$999$l$)Ɖ$@ۇ!ƍD5D$T$$D$ @$|$T$L$G$$)ʼn$@ۇ!ō.D$T$$D$ @$L$T$|$Q.$l$$$$$$$0$ @ $t$D$l$ \$t$l$$$0$$$ʍ Í 輍 赍 讍 觍 蠍 虍 蒍 苍 脍 } v e ;aD$@H@H0@4H @$HP@TH`@dHp@tǀH@@Dǀǀǀǀ&e ;av D$@e ;av D$@D$]e ;a L$$QQZ)q9QZY RD e |\u/DD$(D Í/U&ߋD$(J&@$l$T$t$ \$D$L$T$|$$We u ʉʼng%@$D$D$KD$L$ T$|$$WGe u  %$e ;a  L$$QQZ)q9MZY RT$,Te |\uD$(DD$0D ËD$(%ߋD$0%@$l$T$t$ \$D$L$T$|$$We u ʉʼnk$@$D$D$D$ L$T$|$$WO e u q$ e ;a4L$8Yi9:u9]Y\mD-e ݒD$L$T$|$8We u ͉‰ `$oȏ|$D$@Ge  D$<D$DGD$8HQT$(h9t$$|$0F D$L$T$ @$\$L$l$$D$(|$8GD$$Ge u D$0D$0B\$,l$$L$ @$|$D$D$ T$ے|$t$D$8L$ T$(\$,l$$"D$<Oω‹D$D   .)e ;av# D$$D$D$D$D$ e ;ax,D$0L$81BX(9;NRtl9u݉T$ \$(,$D$4D$t$|DD$ uD$0L$8T$ 몋D$0HXl$ 9\$$t$())\$(!E9@$\$L$L$(L$ L$$)ك !΍ 2L$)|$\$"D$0HY9sn ID|\-e u+DDHI|-H\$ SL$811σ,9 2 + $ Mhe ;aD$ L$(11B(p94R|l9u݉T$t$\$<$D$$D$l$BD$ tHL$ Ql$9sUe t$|uD$,DȋL$(wD$,D$ L$(T$\$V\$02 + Te ;a D$,L$$11B)q94R|l9u݉T$t$\$,$D$(D$|$AD$ L$$Yl$9\$t$4t5e ύLL$ u!L$0 t$8tD$,UωËD$0|$D$8؋t$8ƋD$,L$$T$\$\$< ~ ~ e ;a< D$$$L$(L$T$,T$\$0\$ D$t ËL$$QQZ)q9KZY RT$,Te |\uD$(DD$0D멋D$(ߋD$0듍@$l$T$t$ \$֒D$L$T$|$$We u ʉʼnm@$D$D$ԒD$L$T$ |$$OGe u @e ;a4D$8$L$D$D$( 111׍=d 1=e ;a D$D$L$$t{d t d e uSd L$D$L$t5QӃ uʀ $D$T$=D$D$( 111׍=d M1=e ;avq z$m|$D$GD$Ge u9D$G GGD$$=D$|$ ËD$(se ;avj /$ݩ|$D$Ge u9D$GG GD$$pSD$|$# ËD$&ze ;avz L$(T$$e uND$,ID$D$D$ $ыD$L$T$$$ ÍD$,je ;avV D$$$D$ƀ$D$(D$D$,D$D$L$T$\$ \$0T$4L$8D$< e ;avW D$$$?D$$D$(D$D$,D$sD$L$T$\$ l$\$0T$4l$8L$D$tgD$D< $D$?D$DL $D$)D$Dut L$HT$Lc@ËD$D$HD$$D$Lc@D$HD$Lc@ÉD$ L$T$D$g>T$D$ D$ L$D$wD$D$HD$ D$Lac@Í$|$D$,D$c1gW\$HT$L$c@Ðc@ۓe ;a@L$DQ$ty$D$D$:e L$ u8D$D$ D$Dt H @$u@ËI$T$D뽍|$(1nL$DQlT$0$ksL$ T$T$(L$,L$DT$0$=sL$ T$T$0L$4L$DT$`&$1rL$ T$T$8L$< >u $D$)L$(L$D$ D$AL$T$T$ L$$ š $L$L$0$T$ T$rL$D$ T$ e u2BD$DH(X,IT$D$D$ $ыL$DEz51&ٓe ;a`D$ D$$D$\L$D$ $ DL$X e D$ǀ $D$wD$T $D$SD$ $D$=D$ $D$D$te$cD$L$T$\$ $T$D$D$ D$L$ D$$_D$ D$$_Í, $D$zD$$D$L$T$\$ $=T$D$D$ #D$L$ D$$_É$iD$L$\$T$ $[>T$D$ D$ D$D$ L$$^ËL$1 ~^%דe $;AP$ϖ$|$$e 󥋄$ $t$$)e $$|$L$|$$e u'$$$ĬÍ|$|$t${$$r*$|$$D$CT$|$t$(Փe ;a$D$(I $ L$D$ FD$ L$;D$0L$,T$(R$T$D$ L$ D$E$$D$L$D$ D$D$,D$D$0D$CےL$D$ ԓ/e ;a)0D$4HL$ $D$T$8T$:sD$L$ T$iD$ =QD$4 95L$8  $D$L$8L$rD$L$ T$D$4@L$8 $ЋD$L$t67t D$<0É $ L$D$D$ tD$<0ÉD$L$, $VD$D$ uԋD$L$,띋A$D$D$<0ÉL$( $LD$L$ $D$D$D$ D$t D$<0ËD$(H@$L$\D$D$<0ùD$4L$T$$A$ЋD$L$t1D$@L$$ $ЋD$L$$L$D$D$<0É$%tD$D$ tD$<0D$<0|ғe ;aD$ HHPDt}L$T$$L$D$ uËD$ HI$L$D$tۋD$$D$D$DD$L$ T$ JH e uBD멍zDN럋XSKuѓDe ;aD$$L$ L$D$:D$ D$D$$L$ L$D$]D$ tzL$ 9}41Ʉt&HT$ЉD$$L$(ÉD$D$D$$ 0L$D$L$ D$롋D$|,L$ 9w$L$L$$D$(ËD$D$$D$ D$(hM aM ZM Гe ;aD$$L$ L$D$:D$ D$D$$L$ L$T$D$ D$t,L$ 9)!ȋL$ȉD$$T$(ËD$$L$ L$:T$D$ \D$u*D$@L$ 9wE)!ȋL$ȉD$$T$(D$$D$(D$$D$(L L >ϓe ;aD$ D$$D$D$՛D$ L$uqhttpu]T$ uN\$+f80u D$$Ãu)=httpu Asuuf=44u C3tD$$Ë\$ËT$ \$빋T$ \$D$$aΓ,e ;aD$$D$L$ T$\$t+T$ e u ÍnL$] e ugU$$褍D$ @u e u*L$He uA(Íy(xD$‰ȉǍ}$]͓e ;aD$ HHPɄtju 1D$$ÍHL$ @ӟ $fD$D$L$ L$T$ T$@ӟ$eD$$D$D$^D$뜅D$$D$$̓@e ;avD$H$@ D$L$ f̓e ;avD$H,@(D$L$ 6̓e ;a(D$,$D$D$, ы$L$\$uD$ L$,QRZ\$T$$1Il$ Y L$\$$T$t$|$ xD$hD$L$ T$,\$$ȉщڋ\$9}#4~6YI9r A$D$L$t)T$,B e u J$D$0(Íz$L$,QYAY Qe uoAD$ $D$L$T$ \$,KS e u6CL$ S( e u C,D$0(Í{,{Íy늋T$,Z e u J$D$0(Íz$D$0(F .ʓe ;aHD$LIQ$I $趉D$LIT$Y\$8I L$D1111l$,l$4EΉ߉T$,‹D$LL$D\$89"|$0l$4T$@D$'Z<$t$T$\$ lqD$L$uL$,Q\$099D$@,E| e uL$'\1|'$l$@l$L$\$ T$FD$L$\$QL$,딋H=ZZZ!-@91"IL$,Q\$098D$@45e |uL$'1ߓ'$l$@l$L$\$ T$胜D$L$\$QL$,-@돋L$,Yt$097|$@,ωUe Luډ6ߓT$(D$<'$T$@T$L$t$ \$|$D$t$XD$t$$t(胮D$L$T$T$(D$,L$0  릍|$$9;u#e ;av D$$L$L$юD$L$Q$D$юD$L$Q$D$yюD$L$Q$D$bюD$L$ $D$KюD$D$ Jee ;a=D$H\$k391ɄH Pks 91ɄHPks9tt1ɄtjHSkp9t;1Ʉt1H$S$[ @ 9t 1D$É$D$T$͎D$ 1݉,$t$T$t͎L$ D$\$1뤉,$T$t$Q͎L$ D$\$l1e,$T$t$(͎L$ D$\$)1"4$T$l$̎L$ D$\$莓e ;avBD$$L$L$D$L$( $D$D$D$ D$臎e ;av? D$$L$L$D$tD$@(L$I(9D$ 1*e ;avD$D$e ;avD$D$D$D$ 躍e ;avD$D$D$D$ ze ;avD$D$D$D$ o:e ;avD$D$D$D$ e ;avD$D$D$D$ 躌e ;avD$D$芌e ;av: D$$L$L$wD$L$( $D$`ΎD$D$ /e ;avJ D$$L$L$D$t&D$@(D$H(f.!L$ 1迋e ;avD$D$O芋e ;avD$D$D$D$ Je ;avD$D$D$D$  e ;avD$D$D$D$ ʊe ;avD$D$D$D$ 芊e ;avD$D$D$D$ OJe ;avD$D$e ;av# D$$D$D$D$D$ ։e ;av$ D$$D$D$gD$D$ 蕉e ;avD$D$/je ;avD$D$D$D$ *e ;avD$D$D$D$ ꈓe ;avD$D$D$D$ 誈e ;avD$D$D$D$ oje ;avD$D$D$D$ /*e ;avD$D$e ;avBD$$L$L$ˎD$L$ $D$D$ (D$ D$藇e ;avxD$H\$k39t@1Ʉt6KP9u(H S 9tK@8D$111$L$l$юL$ D$\$le ;av.Yu+D$ |I$ыD$D$諆빍|$ 9;u͉#e ;av/Yu,$@$ $ЋD$$<J븍|$ 9;ủ#e ;av>Yu;D$|IT$T$$ыD$ L$L$D$ ۅ멍|$9;u#e ;avEYuB$@$$DT$ $ЋD$ L$$H$Ld뢍|$9;u#e ;av7 Yu4D$|IT$T$$D$D$ 밍|$9;uĉ#e ;av; Yu8$@$$@T$ $D$$D 螄묍|$9;u#e ;av7 Yu4D$t$D$L$L$D$ I B밍|$9;uĉ#e ;av7 Yu4D$t$D$L$L$D$  ⃓밍|$9;uĉ#e ;avYD$$L$L$D$ D$ L$Q$D$xĎD$L$ $D$QȎD$D$`e ;aD$T$9uxJX9ujH Xj r9t;1Ʉt1JRX@9t 1D$É$L$\$̎D$ 1݉4$\$l$L$ D$T$11覂Qe ;avIHYuFt$Lt0yD$PD$8D$TD$<@D$DL$@L$XD$\HG @랍|$L9;u#e ;aFHD$Tj*D$L$D$PD$D$L$ T$T$ \$\$,$D$L$艊D$ L$T$\$,l$ T$(D$0L$$k$cAD$D$46Le $unD$4L$0 $L$$L$L$(L$ ԜL$ D$蹃D$L$tD$XD$\L$`HËD$4D$XD$\D$`HË|$4pD$Xl$\\$`HËod $D$LD$D$PD$:D$ L$T$l$\$$D$LD$D$PD$UD$ L$T$11D$@D$D ` $D$D$L$ D$@L$D!$D$2D$@D$D$ D$`D$L$D$8L$<0$D$8D$zD$L$ $L$  e D$;A $1 L$L$8$q$+rfc8ukf22u$+iso8ukf60uk1 +$YD$T$D$ $$$D$D$@ D$L$D$ t/L$0$50$D$0$Ĕ$ID$wL$ L$,c $ø間DŽ$$D$,$$DŽ$DŽ$ĔË$$|$D艖 ӻ $D$$L$$L$ ޕ|$Dt$83L$(L$4T$$|$Xt$D$t$X $L$4$ĔÍ|$l t $D$$L$$L$ Nޕ|$lt$8诚L$(L$4T$$$t$l蓚$$耚$L$4$ĔË$$ɼD$D$\$ T$ׂD$L$D$$ $$ L$$$L$L$\L$ L$HL$ȘL$T$\$$L$T$$(L$ $,L$$$L$T$cL$T$ $8$<À$ *Ç݃u$$ ]$$T$\$UD$ L$@( $ЋD$L$$L$qD$D$TL$ L$pT$T$l$$$ \$$$\$T$ L$D$xT$ll$p\$T$ 8T$T^$/|$Ge u ͻͻ$ $$$ƉȉD$tD$xD$t$,D$x $D$#D$tD$D$ D$יD$L$$8$<úhDŽ$8DŽ$<ËD$TG E$|$[ ne ;aDD$T @ӟ9uL$XY T$8\$$D$PD$0hs1l$(EL$PT$8\$$9D$(‹+l$,[\$4t$H4$|$L|$L$D$ YȘD$L$T$$L$D$D$,D$ D$4D$D$D$=D$L$ iD$dL$hDD$dD$hDD$L(Ç݃T$H$D$L$1D$ L$$L$D$$D$D$ D$L$T$\$H$l$Ll$t$Pt$T$ D$L$mL$PT$8\$$D$LfuD$L0Ç݃V^$g,|$Ge u ͻͻڃh%tD$<D$@D$d L$HD$LL$HtQӃ WʀL111A=d 蒀111)DŽ$DŽ$ĐÀ$)Ç݃$$L$\$D$ L$$L$D$L$ T$$$$l$$t$T$ L$D$ޘD$4B$eu$1Ç݃R^$'|$Ge u ͻͻ^itD$XD$\L$X$D$\$D$D$XD$D$ D$yϙD$L$$$ĐøDŽ$DŽ$ĐËD$,G E$|$ ge $`;A $W|$`C$0NHL$< .u\tyDŽ$DŽ$$$4$o$D$$D$D$ D$AΙD$L$$@$D Í0$%|$0$09$4Z*_e /9t6|$\$$$$(L$$,T$ØD$ eH~.8h-9&Q 9$8$$<D$D$D$ #D$L$u  D$0L$@$$D$D$X$ 1}D$\@L$D$ D$@$D$0D$!t$$ /e L$(L$DT$$|$X$  d   d e D$Xd L$xD$|L$xtbQӃ uʀ$$$$(\$$,\$L$ D$T$ژDŽ$@DŽ$D 111몍=d D$Xc{rD$X c$@D$D$D ÉT$4$D$XD$$ L$~T$4~.8C 95D$\HD$L$od $D$L$T$\$l$ $$$$$D$D$L$ d td e uq d $$$tJPӃ uʀ$$$$(\$$,\$D$ L$T$٘Z111=d ‰y111막$@$D Ë$$$$(L$$,T$D$D$TL$ L$8$$$$(T$$,T$D$L$ tIDŽ$DŽ$DŽ$DŽ$T$8$T$T$$$y]$D$$D$D$ D$OəD$L$$@$D Á~.8ZZ@9 d d e uuD$\d $$$tJQӃ uʀ$$$$(\$$,\$L$ D$T$&טj111=d D$\w넋D$\{U: k9 D$\@ $D$D$D$ L$T$ d  k d e uqd $$$tJQӃ uʀ$$$$(\$$,\$L$ D$T$+֘o111=d v눍 k뀉$@$D Év09d$411?B$D$ B$09,$4t ЋL$ώL$D$ T$0 e u/BD$ @IT$D$D$ $сĴÍzMʉ$L$D$T$ =D$L$D$DL$Hš$D$D$, 0 $L$DL$ΎD$L$ T$,e u-JD$ @IT$D$D$ $z3Mʍz)M5ze ;avW+e vu躴 +e en貜 ]ZnYI^+e "5e ;avOYuLD$ I@T$$T$T$(T$T$,T$ $ыD$L$T$D$0L$4T$84똍|$ 9;u#e ;av'Yu$D$ @I$ыD$D$b4|$ 9;uԉ#e ;av7Yu4D$@IT$T$$ыD$ L$L$D$ 4밍|$9;uĉ#e ;av0 Yu-D$@IT$T$$D$D$ 3뷍|$9;uˉ#e ;av)Yu&D$ @L$ $ЋD$$P3뾍|$ 9;u҉#e ;av?YuD$($L$L$T$D$ =D$($L$L$vT$D$ =D$e D$ܬc ($D$'D$D$ D$1=L$ \ʋ+[l$\$ ($D$B=D$D$HD$'| e uc 9e Í=c C=ܬc D$CX+,e ;avGYuDD$t.@ $D$D$D$D$ D$ {D$D$$ɭ +렍|$9;u#e ;av@Yu=D$t'$D$D$D$D$rD$ D$ ` Y+맍|$9;u#e ;avGYuDD$t.@ $D$D$D$D$ D$ KD$D$$鬎 *렍|$9;u#e D$;A|$|$G e i :G  e 1 ЫO|$0G e G$D$D$P `ȡ $D$ $Pe |$PGG e p`ȡ$D$ (,Pe /L$PAAe A Ae AA$e A D$0H$j$$$D$D$L$ $T$0T$@T$$T$ T$D$D$Hd D$H}$D$D$T 0 $}D$H|$|$,Q We |$X1@$QT$` $L$D`$L$\$D$ 8|$ e 0L$,L$DL$d$L$X e |$Tt$X6EL$TQ |$p1D@ ` $T$T$pT$f D$p$D$pt2L$t @u݋L$TY \$`$T$D$ ;뺍 $@D$ gy e (L$THD$@L$Ht$<9}r9ZRDe |tDDl$\$T$@$B D$CD$L$ 3CD$HKG e u( mL$@O$D$L$ĠÉm=D$@=ʉ1|=1s=&@$l$T$\$ t$>D$L$T$\$He uʉŋD$@|$<=`$`|$Ge %mD$@GD$Hjl$(#9t$$|$8F D$T$l$ @$\$T$L$AD$(L$HD$$e uD$8i|$D$,];Q;Y z$L$y 1+;T$0z;Qy1 ;y :lj::lj:VOύ:OωЫ:::۞ ԟ ͟ "!e ;avGD$$D$D$D$L$ L$$DD$L$T$T$ L$$D$("e ;a$D$($D$4D$D$L$ T$,L$ e |\$0$D$L$$t$|$|$e @>L$,D$Hx e L$0H|L$Qum e uRL$ $D$8D$D$L$D$HU $|$t$t;D$xD$r8&x|D$0]8$|$t$0;$ËD$0*8v0$D$; e ;av_(nd L$, $ L$D$D$0D$ D$4D$D$D$D$#D$$L$ L$8D$<(e ;agH|$1@8 ` $ߎL$PSye T$XQT$LQT$PQ e T$TQT$dQT$hQe D$`AL$L$ $D$T$\D$D$L$ $RD$t:D$t1D$@D$L$DL$T$$QD$L$9tSD$6byD$T-6.yD$X6yD$L6 $T$'D$襳 nye D$;A`|$ގ|$Ge  1]G  e  ЫOG e G|$0$j$ & $ݎD$D$L$ $T$0T$OT$$T$ T$D${D$Hd D$H}$ݎD$D$P 0 $ ݎD$H|$|$,IO e |$T1n5$QT$\ $L$D`$L$\$D$ v-|$ e 0L$,L$DL$`$L$T e |$Pt$T9L$PQ |$l14 ` $T$T$lT$ D$l$dD$lt2L$p @u݋L$PY \$`$T$D$ <0뺍 $ێD$ gy e (L$PHD$@L$Ht$<9}r9jRD-e $QT$\q̎ $L$D`$L$\$D$ F|$ e 0L$,L$DL$`$L$T e |$Pt$TL$PQ |$l1 ` $T$T$lT$܎ D$l$4ߎD$lt2L$p @u݋L$PY \$`$T$D$ 뺍 $D$ gy e (L$PHD$@L$Ht$<9}r9jRD-e  $D$D$ L$( $L$L$ `L$L$,L$ L$D$D$D$0D$ D$4$Í`$谋D$늍Oω6cOωЫ* ˒e ;avGD$$D$D$wD$L$ L$$D$L$T$T$ L$$D$(˒e ;a$D$($D$4D$D$L$ T$,L$ e |\$0$D$L$$qt$|$|$e L$,D$Hx e L$0H|L$Qum e uRL$ $D$8D$D$$z~D$OωՒQOωЫՒ4Ւ: ; ; 1|e ;avGD$$D$D$GD$L$ L$$D$L$T$T$ L$$D$(½e ;a$D$($D$4D$D$L$ T$,L$ e |\$0$D$L$$!}t$|$|$e pْL$,D$Hx e L$0H|L$Qum e uRL$ $D$8D$D$t$|$D$HL$$T$ \$4l$(m蓁Oω‹D$@聁xD$Pl}$D$PD$L$TL$7D$,9-Y $z)D$OωQOωЫ‒Ѐ   1i|e ;avGD$$D$D$GD$L$ L$$賊D$L$T$T$ L$$D$(he ;a$D$($D$4D$D$L$ T$,L$ e |\$0$D$L$$!(t$|$|$e pL$,D$Hx e L$0H|L$Qum e uRL$ $D$8D$D$ 1L$x<$D$ D$D$L$$ $T$D$ 1L$x_A$D$D$D$ L$$ $`T$D$ 1L$x $TD$D$CY LÑwe ;av=;$D$L$|$  e u |$sڑ‘e ;av`0$蝂D$L$H e u+L$L$ e u AL$ÍyّNjD$ّi‘e ;avG '$D$L$L$HL$ e u AL$Íyّ‘e ;avG '$轁D$L$L$HL$ e u A L$Íy )ّe ;av*L$e u D$AL$ ÍyD$ؑ_e ;avN |$t$$ޑڳ$D$D$WD$L$ $L$drD$L$ D$4L$8 e ;av't$(ޑkD$L$L$,D$0e ;av=;$]D$L$|$  e u |$בLe ;avG '$D$L$L$HL$ e u AL$Íyiב⿑e ;avG '$D$L$L$HL$ e u AL$Íy ב肿e ;avDB$=D$D$L$ e u A L$Íy ֑%e ;avN |$t$$fܑ ۳$D$D$UD$L$ $L$4pD$L$ D$4L$8 軾e ;av't$ۑkD$L$L$,D$0re ;aL|$1֑ #L$D$9L$PI t`|$$t$ۑD$0~7|$8t$kۑp$D$8D$XD$L$ D$TL$XLD$TD$XLÍ7.$D$ D$$ L$o虽$e ;av=;$M}D$L$|$  e u |$ԑ跥e ;av*L$e u D$A L$ Íy D$oe ;av*L$e u D$AL$ ÍyD$覼e ;avQD$D$D$ D$z$D$D$;D$ L$ $D$!VD$L$ D$$L$(訤e ;av+D$$D$D$gD$ L$L$D$ ^e ;av\0$ dD$L$H e u'L$|$  e u |$sNjD$fݣe ;avu$c|$|$ e u6t$L$e uD$ AL$,ÍyD$ 纑$|$D$D$軽Doe ;avYD$ D$D$$D$D$(D$&$D$D$9D$ L$ $D$9TD$L$ D$,L$0e ;av3D$$D$D$D$ D$OD$L$ L$$D$(fe ;av@B$bD$D$|$  e u |$萹 e ;avDB$aD$D$L$ e u AL$Íy,襡e ;avDB$]aD$D$L$ e u AL$Íy̸Ee ;ava D$$D$D$(D$D$,D$D$0D$`{$D$D$7D$ L$ $D$ARD$L$ D$4L$8 Ƞe ;av;D$$D$ D$D$$D$D$(D$ GD$L$L$,D$0ne ;aL|$1跸 [L$D$ L$PI t`|$$t$pD$0~7|$8t$[p$D$8D$9D$L$ D$TL$XLD$TD$XLÍ$D$D$$ L$o艟$e ;av2L$ |$OL$O e u D$|$ËD$辶7e ;av`0$^D$L$H e u+L$L$ e u A L$Íy ONjD$B蹞e ;avN(|$t$,⻑B$D$D$H5D$L$ $L$OD$L$ D$DL$H(Ke ;av' t$$tkD$L$L$$t$8mD$T$T$L$0L$|$@$JYIur|$ht$T!D$t~@|$|t$T p$D$|D$'D$L$ $$DŽ$DŽ$É $D$t$vD$,$1该L$,p9$tD$T$ L$D$|$@$K$D$t$t^D$($18L$(p9$D$T$ BL$D$ |$@$ԩ1$T$@B$D$ ID$T$ L$c1$E $D$ D$D$ L$T $`T$D$1$E $D$ D$T$ L$1$<$D$ D$D$ L$T $`T$D$1$$D$ AD$T$ L$[1$ $TD$D$  $TD$D$  $TD$D$  辊e ;av\0$mJD$L$H e u'L$|$  e u |$ӡNjD$ơ=e ;av6L$ T$JL$J e u D$BT$ÍzD$j㉑e ;av*L$e u D$AL$ ÍyD$&蟉e ;av*L$e u D$AL$ ÍyD$֠Oe ;ava D$$D$D$(D$D$,D$D$0D$@}$D$D$D$L$ $L$A:D$L$ D$4L$8 Ȉe ;av;D$$D$ D$D$$D$D$(D$ GD$L$D$,L$0ne ;aRL|$1跠 L$D$L$Pt @At`|$$t$TD$0~7|$8t$?p$D$8D$!D$L$ D$TL$XLD$TD$XLÍЇ$D$D$$ L$op$D$D$D$ L$ $`T$D$fL$P#p$D$D$$ L$1L$Pe ;av\0$FD$L$H e u'L$|$  e u |$NjD$me ;av6L$ T$JL$J e u D$BT$ÍzD$蚝e ;avID$D$ 7$D$D$D$ L$ $D$)7D$L$ D$L$ 谅e ;av# D$$oD$L$L$D$ fe ;av&|$ e u D$|$ ËD$誜#e ;avID$D$7$D$D$D$ L$ $D$96D$L$ D$L$ e ;av# D$$oD$L$L$D$ ve ;aL|$1ǜ L$D$L$P t`|$$t$聡D$0~7|$8t$lp$D$8D$D$L$ D$TL$XLD$TD$XLÍ$D$ D$$ L$o蚃%e ;av\0$MCD$L$H e u'L$|$  e u |$賚NjD$覚e ;avT`|$t$d趟`w$D$D$D$L$ $L$$4D$L$ $$`襂e ;av-Xt$\HkD$TL$P$$X\e $;A $1蚚 $DŽ$$ Q Q Yt * Q@Q@t RT$ T$hY)s\$L$1F9Y׋Ttt$ $D$L$u1$\$L$t$ |$h뵉D$`L$4DŽ$DŽ$DŽ$DŽ$0$ $`&$\$ \$D$L$ $$Ⱥ$D$$L$D$ D$D$L$L$|$t1L$4p9! $tt$`$$L$|L$T$|$h$t蚝GYil\$xl$L1F9U׋tt$$$ND$L$u1$\$xl$Lt$$|$h빉D$HL$XDŽ$DŽ$DŽ$DŽ$0$ $`&$\$$\$D$L$ $$Ⱥ$D$$L$D$ D$vD$L$L$P$`1腗L$Hp9$`t$XF$$T$L$PL$|$h$` Yi l\$tl$L1F9U׋tt$($jD$L$u1$\$tl$Lt$(|$h빉D$DL$dDŽ$DŽ$DŽ$DŽ$0$ $`&$\$(\$D$ L$$$Ⱥ$D$$L$D$ D$D$L$L$|$L1 L$Dp9$Lt$d̚$$L$|L$T$|$h$L覚SY,i(m\$Ll$p1F9V׋Ttt$,$cD$L$u1$\$Ll$pt$,|$h븉D$TL$8DŽ$DŽ$DŽ$DŽ$0$ $`&$\$,\$(D$ L$$$Ⱥ$D$$L$D$ D$D$L$L$|$81萔L$8p9X$8t$TQ$$L$|L$T$|$h$8+Y4YDIHe\$lL$L1E9N֋tl$0$D$L$u1L$L\$ll$0t$hD$$D$D$D$L$ $L$yD$L$ D$,L$0Re ;av3D$$D$D$D$ D$OD$ L$D$$L$(Qe ;av2L$ |$OL$O e u D$|$ËD$hWQe ;avID$D$>$D$D$D$ L$ $D$iD$L$ D$L$ Pe ;av# D$$oD$L$L$D$ Pe ;aL|$1h (L$D$L$Pt@|`|$$t$mD$0~7|$8t$mp$D$8D$&D$L$ D$TL$XLD$TD$XLÍp$D$D$PD$ L$ $`T$D$_p$D$藢D$$ L$豕L$PsOe ;av\0$D$L$H e u'L$|$  e u |$fNjD$vfNe ;avID$D$ ?$D$D$}D$ L$ $D$D$L$ D$L$ Ne ;av# D$$oD$L$L$D$ 6Ne ;av&|$ e u D$|$ ËD$zeMe ;avID$D$?$D$D$D$ L$ $D$ D$L$ D$L$ Me ;av# D$$oD$L$L$D$ FMe ;aL|$1e ͼL$D$ L$Pt@|`|$$t$?jD$0~7|$8t$*jp$D$8D$D$L$ D$TL$XLD$TD$XLÍp$D$D$D$ L$ $`T$D$肒_p$D$7D$$ L$QL$PLe ;av\0$ D$L$H e u'L$|$  e u |$#cNjD$cKe ;ava D$$D$D$(D$D$,D$D$0D$}$D$D$D$L$ $L$D$L$ D$4L$8 Ke ;av;D$$D$ D$D$$D$D$(D$ GD$L$D$,L$0Je ;av\0$] D$L$H e u'L$|$  e u |$aNjD$a-Je ;av6L$ T$JL$J e u D$BT$ÍzD$ZaIe ;av/$@e D$D$ L$L$D$Ie ;av$L$D$ L$NIe ;avN |$t$$f`ܳ$D$D$ߌD$L$ $L$TD$L$ D$4L$8 He ;av't$fkD$L$L$,D$0He ;avC '$MD$L$L$H|$  e u |$_6He ;avG '$D$L$L$HL$ e u AL$ÍyY_Ge ;avG '$D$L$L$HL$ e u AL$Íy^rGe ;avG '$-D$L$L$HL$ e u A L$Íy ^Ge ;avID$D$ @$D$D$݌D$ L$ $D$)D$L$ D$L$ Fe ;av# D$$oD$L$L$D$ fFe ;aL|$1^ =L$D$L$Pt@|`|$$t$_cD$0~7|$8t$Jcp$D$8D$ߌD$L$ D$TL$XLD$TD$XLÍX $D$ D$D$ L$ $`T$D$袋_X $D$ WD$$ L$qL$P3Ee ;av\0$D$L$H e u'L$|$  e u |$C\NjD$6\De ;avID$D$@$D$D$=یD$ L$ $D$D$L$ D$L$ @De ;av# D$$oD$L$L$D$ Ce ;av&|$ e u D$|$ ËD$:[Ce ;avID$D$ A$D$D$MڌD$ L$ $D$D$L$ D$L$ PCe ;av# D$$oD$L$L$D$ Ce ;aL|$1W[ L$D$L$Pt@|`|$$t$_D$0~7|$8t$_p$D$8D$܌D$L$ D$TL$XLD$TD$XLÍX $D$ D$谗D$ L$ $`T$D$B_X $D$ D$$ L$L$PAe ;av\0$}D$L$H e u'L$|$  e u |$XNjD$XMAe ;avID$D$A$D$D$׌D$ L$ $D$YD$L$ D$L$ @e ;av# D$$oD$L$L$D$ @e ;av&|$ e u D$|$ ËD$WS@e ;avQD$D$D$ D$~$D$D$֌D$ L$ $D$aD$L$ D$$L$(?e ;av+D$$D$D$gD$ L$L$D$ ?e ;av\0$MD$L$H e u'L$|$  e u |$VNjD$V?e ;avG '$D$L$L$HL$ e u AL$Íy9V>e ;avN(|$t$,[ݳ$D$D$HՌD$L$ $L$D$L$ D$DL$H(K>e ;av' t$$t[kD$L$L$e ;av2L$ |$OL$O e u D$|$ËD$>U=e ;av`0$mD$L$H e u+L$L$ e u A L$Íy TNjD$T9=e ;avA;$D$L$L$ e u AL$Íy_T$t$8 MD$T$T$L$0L$|$@$LvYIur|$ht$TLD$t~@|$|t$TLp$D$|D$HɌD$L$ $$DŽ$DŽ$É $JD$t$vD$,$1OGL$,p9$LD$T$ L$D$|$@$Ku$GD$t$t^D$($1FL$(p9$KD$T$ BL$D$ |$@$tK!u1$T$@B$D$ D$T$ L$t1$E $D$ D$'D$ L$T $`T$D$s1$E $D$ eD$T$ L$s1$<$D$ D$裂D$ L$T $`T$D$5s1$$D$ D$T$ L$r1$ $TD$D$Œ $TD$D$sŒ $TD$D$UŒ ^,e ;av\0$ D$L$H e u'L$|$  e u |$sCNjD$fC+e ;av6L$ T$JL$J e u D$BT$ÍzD$ C+e ;av*L$e u D$AL$ ÍyD$B?+e ;av*L$e u D$AL$ ÍyD$vB*e ;avN<|$t$@G $D$D$xD$L$ $L$D$L$ D$lL$p<{*e ;av'4t$8rGkD$0L$,L$dD$h42*e ;av=;$D$L$|$  e u |$cA)e ;av`0$D$L$H e u+L$L$ e u AL$Íy@NjD$@Y)e ;av`0$ D$L$H e u+L$L$ e u AL$Íyo@NjD$b@(e ;avG '$D$L$L$HL$ e u A L$Íy ?r(e ;av`0$-D$L$H e u+L$L$ e u AL$Íy?NjD$?'e ;avG '$D$L$L$HL$ e u AL$Íy?'e ;av6L$ T$JL$J e u D$BT$ÍzD$>C'e ;av*L$e u D$A$L$ Íy$D$>&e ;av*L$e u D$A(L$ Íy(D$6>&e ;avN(|$t$,C޳$D$D$8D$L$ $L$D$L$ D$DL$H(;&e ;av' t$$dCkD$L$L$D$0$ _ʺL$D$|$,t$l>h1L$,$ $TD$D$3 $TD$D$ $TD$D$ !Ke ;av&|$ e u D$|$ ËD$:8 e ;av*L$e u D$AL$ ÍyD$7o e ;av*L$e u D$AL$ ÍyD$7 e ;ava D$$D$D$(D$D$,D$D$0D$$D$D$蕶D$L$ $L$D$L$ D$4L$8 e ;av;D$$D$ D$D$$D$D$(D$ GD$L$D$,L$0>e ;av\0$ތD$L$H e u'L$|$  e u |$S6NjD$F6e ;av6L$ T$JL$J e u D$BT$ÍzD$5ce ;avN,|$t$0;ش$D$D$D$L$ $L$tD$L$ D$LL$P,e ;av'$t$(;kD$ L$L$DD$H$e ;avq$m݌|$|$ e u2t$:|$ e uD$ |$,ËD$ 4$|$D$D$7(se ;av`0$܌D$L$H e u+L$L$ e u AL$Íy?4NjD$24e ;av`0$]܌D$L$H e u+L$L$ e u AL$Íy3NjD$3)e ;av`0$یD$L$H e u+L$L$ e u A L$Íy ?3NjD$23e ;av6L$ T$JL$J e u D$BT$ÍzD$2Se ;avYD$ D$D$$D$D$(D$($D$D$ݱD$ L$ $D$YD$L$ D$,L$0e ;av3D$$D$D$D$ D$OD$L$ L$$D$(e ;a0t|$$12 @L$$D$(-L$xt RTQt%R҇Ç݃!݅ Iuf|$8t$$H7D$D~:|$Lt$$37p$D$LD$ϳD$L$ D$|$tD$|DŽ$tÉ $St$D$tD$ |$`11L$ p9|$`6D$$$ ?ܽL$D$1|$ t$`68`,2$D$D$lD$L$$ $T$D$_1L$x$D$ D$8nD$ L$$ $`T$D$^1L$xe$D$ ykD$$$ L$^1L$x $TD$D$, 5e ;av\0$׌D$L$H e u'L$|$  e u |$S/NjD$F/e ;av*L$e u D$AL$ ÍyD$.oe ;avG '$׌D$L$L$HL$ e u AL$Íy.e ;ava D$$D$D$(D$D$,D$D$0D$`$D$D$腭D$L$ $L$D$L$ D$4L$8 e ;av;D$$D$ D$D$$D$D$(D$ GD$L$D$,L$0.e ;av&|$ e u D$|$ ËD$j-e ;av6L$ T$JL$J e u D$BT$ÍzD$-e ;avID$D$ B$D$D$-D$ L$ $D$D$L$ D$L$ 0e ;av# D$$oD$L$L$D$ e ;av&|$ e u D$|$ ËD$*,e ;avQD$D$D$ D$$D$D$5D$ L$ $D$D$L$ D$$L$(8e ;av+D$$D$D$gD$ L$L$D$ e ;aRL|$17, `L$D$L$Pt @At`|$$t$0D$0~7|$8t$0p$D$8D$[D$L$ D$TL$XLD$TD$XLÍ($D$ fD$$ L$'YoK$D$ D$ThD$ L$ $`T$D$XL$P#K$D$ eD$$ L$XL$Pse ;av\0$ҌD$L$H e u'L$|$  e u |$)NjD$v)e ;av`0$ьD$L$H e u+L$L$ e u AL$Íy(NjD$(ie ;avN4|$t$8t.@ٴ$D$D$D$L$ $L$tD$L$ D$\L$`4e ;av',t$0.kD$(L$$L$TD$X,e ;akL|$1) L$D$L$PYt AAIt|`|$$t$-D$0~7|$8t$-p$D$8D$"D$L$ D$TL$XLD$TD$XLÍ<$D$D$LeD$ L$ $`T$D$U_<$D$bD$$ L$UL$P)p$D$D$dD$ L$ $`T$D$hUL$P*ue ;av2L$ |$OL$O e u D$|$ËD$^&e ;avA;$ΌD$L$L$ e u A L$Íy %xe ;av*L$e u D$AL$ ÍyD$%/e ;av6L$ T$JL$J e u D$BT$ÍzD$Z% e ;av`0$͌D$L$H e u+L$L$ e u A L$Íy $NjD$$Y e ;avN(|$t$,*@D$D$D$裌D$L$ $L$dD$L$ D$DL$H( e ;av' t$$*kD$L$L$D$P$T$L$,L$|$<$;Iur|$dt$PD$p~@|$xt$Pp$D$xD$脎D$L$ $$ĴDŽ$DŽ$ĴÉ $R D$t$vD$($1 L$(p9$PD$P$ BL$D$ |$<$':B$D$ FD$P$ L$91$nE $D$ D$HD$ L$P $`T$D$y91$E $D$ %FD$P$ L$?91$$D$ D$cHD$ L$P $`T$D$81$w$D$ ED$P$ L$81$+ $TD$D$Q $TD$D$3 L$PD$T$1QYt Qt%R҇Ç݃!݅ XT$ T$L$D$7|$<$̐ $D$#D$gD$L$P $T$D$y1$X]v$D$)D$D$ L$P $`T$D$/1$$D$ D$P$ L$1$ $TD$D$D $TD$D$mD ve ;av\0$-nD$L$H e u'L$|$  e u |$ŐNjD$Őe ;av6L$ T$JL$J e u D$BT$ÍzD$*Ő裭e ;av*L$e u D$AL$ ÍyD$Đ_e ;avG '$ mD$L$L$HL$ e u AL$ÍyyĐe ;avQD$D$D$ D$$D$D$CD$ L$ $D$^D$L$ D$$L$(般e ;av+D$$D$D$gD$ L$L$D$ >e D$;A|$,1Đ nOL$,D$0 L$ L$($Rur|$@t$,$ɐD$L~@|$|t$,ɐp$D$|D$ED$L$ $$ĐDŽ$DŽ$ĐÉ$KD$t$vD$$|$T1ÐL$$p9|$T}ȐD$,$ ʺL$D$|$(t$TWȐ$w&D$t$tQD$ |$h1GÐL$ p9ud|$hȐD$,$ _ʺL$D$|$(t$hǐ1L$($ $TD$D$L@ $TD$D$.@ 7e ;av&|$ e u D$|$ ËD$ze ;av*L$e u D$AL$ ÍyD$6诩e ;avN |$t$$Ɛ $D$D$8@D$L$ $L$ZD$L$ D$4L$8 ;e ;av't$xƐkD$L$L$,D$0e ;avq$h|$|$ e u2t$Ɛ|$ e uD$ |$,ËD$ $|$D$D$Œhse ;avA;$hD$L$L$ e u AL$Íy菿e ;av`0$gD$L$H e u+L$L$ e u AL$ÍyNjD$艧e ;av`0$=gD$L$H e u+L$L$ e u A L$Íy 蟾NjD$蒾 e ;avQD$D$D$ D$@$D$D$=D$ L$ $D$XD$L$ D$$L$(蘦e ;av+D$$D$D$gD$ L$L$D$ Ne ;aL|$1藾 >aL$D$L$PGt @%AAt@|`|$$t$!ÐD$0~7|$8t$ Ðp$D$8D$?D$L$ D$TL$XLD$TD$XLÍu$D$D$D$ L$ $`T$D$d_u$D$D$$ L$3L$P $D$ D$%\D$ L$ $`T$D$L$P $D$ D$$ L$L$P{6e ;av\0$-dD$L$H e u'L$|$  e u |$蓻NjD$膻e ;av`0$cD$L$H e u+L$L$ e u AL$ÍyNjD$ye ;avID$D$D$D$D$ :D$ L$ $D$TD$L$ D$L$ e ;av# D$$oD$L$L$D$ Ƣe ;av&|$ e u D$|$ ËD$ 胢e ;avN |$t$$ƿ$D$D$9D$L$ $L$SD$L$ D$4L$8 e ;av't$XkD$L$L$,D$0ҡe ;aL|$1' L$D$L$PQHAt @AAt@|`|$$t$课D$0~7|$8t$蚾p$D$8D$6;D$L$ D$TL$XLD$TD$XLÍu$D$D$`D$ L$ $`T$D$_u$D$D$$ L$L$Pt$D$D$D$ L$ $`T$D$|L$Pt$D$-D$$ L$GL$P 4e ;avq$_|$|$ e u2t$ |$ e uD$ |$,ËD$ $|$D$D$﹌xse ;av`0$-_D$L$H e u+L$L$ e u AL$Íy菶NjD$肶e ;av`0$^D$L$H e u+L$L$ e u AL$ÍyNjD$ye ;avA;$-^D$L$L$ e u A L$Íy 蟵e ;avID$D$ E$D$D$4D$ L$ $D$)OD$L$ D$L$ 谝e ;av# D$$oD$L$L$D$ fe ;av&|$ e u D$|$ ËD$誴#e ;avYD$ D$D$$D$D$(D$-$D$D$3D$ L$ $D$)ND$L$ D$,L$0谜e ;av3D$$D$D$D$ D$OD$L$ L$$D$(Ve ;av\0$ \D$L$H e u'L$|$  e u |$sNjD$fݛe ;av`0$[D$L$H e u+L$L$ e u AL$ÍyﲐNjD$ⲐYe ;av`0$ [D$L$H e u+L$L$ e u AL$ÍyoNjD$bٚe ;avYD$ D$D$$D$D$(D$-$D$D$]1D$ L$ $D$KD$L$ D$,L$0`e ;av3D$$D$D$D$ D$OD$L$ L$$D$(e ;av=;$YD$L$|$  e u |$3謙e ;av`0$]YD$L$H e u+L$L$ e u AL$Íy述NjD$貰)e ;av`0$XD$L$H e u+L$L$ e u AL$Íy?NjD$2詘e ;avTX|$t$\Z̷$D$D$8/D$L$ $L$ID$L$ $$X5e ;av-Pt$T촐kD$LL$H$$P에e D$;A|$T10 L$TD$X $Qt Q$t RQ(t%ZۇÇ݃! ڄ+Q@Q@t RQDt%ZۇÇ݃! ڄ I4L$8$Z ` $L$8L$$L$urL$ L$4$$tL$4$3$Xt̉\$ D$,$D$L$tD$0L$$D$,D$/D$L$ $$DŽ$DŽ$ÍP$D$ D$D$L$T $T$D$1$X $D$ D$D$ L$T $`T$D$1$-X $D$ DD$T$ L$^1$ʹ$D$D$D$L$T $T$D$1$$D$ D$2D$ L$T $`T$D$1$)p$D$D$D$ L$T $`T$D$z1$ $TD$D$) 4e ;av2L$ |$OL$O e u D$|$ËD$Nǒe ;av`0$}RD$L$H e u+L$L$ e u A L$Íy ߩNjD$ҩIe ;avA;$QD$L$L$ e u AL$Íyo葐e ;av*L$e u D$AL$ ÍyD$&蟑e ;av*L$e u D$AL$ ÍyD$֨Oe ;av*L$e u D$AL$ ÍyD$膨e ;av`0$PD$L$H e u+L$L$ e u A L$Íy NjD$ye ;av`0$-PD$L$H e u+L$L$ e u A$L$Íy$菧NjD$肧e ;avG '$OD$L$L$HL$ e u A(L$Íy(蒏e ;av`0$MOD$L$H e u+L$L$ e u A,L$Íy,详NjD$袦e ;av`0$ND$L$H e u+L$L$ e u A0L$Íy0/NjD$"虎e ;av*L$e u D$A4L$ Íy4D$֥Oe ;avG '$MD$L$L$HL$ e u A8L$Íy8i⍐e ;av`0$MD$L$H e u+L$L$ e u AD$L$H e u+L$L$ e u A0L$Íy0迕NjD$貕)~e ;av`0$=D$L$H e u+L$L$ e u A4L$Íy4?NjD$2}e ;av6L$ T$J$D$D$fD$ L$t $`T$D$1$e$D$(D$薎D$L$t $T$D$言1$p$D$D$̏D$ L$t $`T$D$^1$p$D$ D$t$ L$$1$@$D$-D$HD$ L$t $`T$D$1$s $TD$D$pϋ $TD$D$Rϋ $TD$D$4ϋ =9e ;av\0$D$L$H e u'L$|$  e u |$SPNjD$FP8e ;av6L$ T$JL$J e u D$BT$ÍzD$Oc8e ;av`0$D$L$H e u+L$L$ e u AL$ÍyONjD$rO7e ;av*L$e u D$AL$ ÍyD$&O7e ;avG '$MD$L$L$HL$ e u AL$ÍyN27e ;av6L$ T$J L$J$ e u D$BT$ÍzD$jN6e ;ava D$$D$D$(D$D$,D$D$0D$`$D$D$e͋D$L$ $L$D$L$ D$4L$8 h6e ;av;D$$D$ D$D$$D$D$(D$ GD$L$D$,L$06e ;av\0$D$L$H e u'L$|$  e u |$#MNjD$M5e ;av6L$ T$JL$J e u D$BT$ÍzD$L35e ;avN@|$t$D&R`E$D$D$ˋD$L$ $L$DD$L$ D$tL$x@4e ;av'8t$D$$$ bL$D$|$ t$`|>)h,b$D$sD$$$ L$g1L$xX $D$ D$?vD$ L$$ $`T$D$f1L$xX $D$ sD$$$ L$f1L$xS $TD$D$3 < e ;av\0$ߋD$L$H e u'L$|$  e u |$S7NjD$F7e ;av*L$e u D$AL$ ÍyD$6oe ;avID$D$G$D$D$D$ L$ $D$yD$L$ D$L$ e ;av# D$$oD$L$L$D$ e ;av&|$ e u D$|$ ËD$5se ;avQD$D$D$ D$$D$D$D$ L$ $D$D$L$ D$$L$(e ;av+D$$D$D$gD$ L$L$D$ e ;av&|$ e u D$|$ ËD$4se ;av*L$e u D$AL$ ÍyD$4/e ;av^D$ *D$،$D$$D$L$ D$$iЉD$(e ;av* e u Dpd Í=pd D3_e ;a_0D$@T$<!م ˄.11ɍ3$D$D$D$ L$D$D$$L$L$(T$T$  $ۋ|$|$,D$ GD$$Ge D$(`$D$4D$L$8L$ܸD$ L$D$L$D$,$@VD$L$uLD$4@L$8 $ЋD$L$tD$DD$HL$L0ËD$,D$DD$HD$L0D$DD$HL$L0ËD$(k2LЋL$@e ;av@D$@$ pD$D$D$ D$ye ;a_@D$D8H@t  "I $ /L$D$ ЊD$ L$$L$D$ D$ 褨D$L$D$ D$DQ$Y i,I(L$l$ $T$VD$L$yH Ph9D$0L$,T$(\$4l$$z$AًD$(L$,)ȋ|$GD$$)ȉG!D$4ȋ e G GGD$8D$<D$8|$<X$D$8D$D$L$ T$DC e K$D$0HX(@ 9)! $)É\$T$D$ L$ 9u@Í;$G؋D$ e L$D@$؋|$Ge  PG  e  rOGG e uZG$D$|$ D$L$ T$D e u  /Oω1.뙍Oωr._P.1L$D.{$.l.@Ã@Ã@Ã@Ã@ԓ ͓ e ;av` D$$$D$(D$D$,D$D$0D$ D$4D$D$8D$%D$pd uD$< ÉD$$ ыD$ye ;avW$nd L$( $ L$D$D$,D$ D$D$D$D$ L$L$0D$4$e D$;A{$ՋD$D$L$D$lD$|$P5 2D$pޡ$qՋ|$|$He 5`2 0T$HJe HZJ( e PB,T$XD$\D$`$QpItT$dL$h  $ԋD$ 0by e $H$H$H e $P$e u}|$Lt$P1D$L$$L$$L$$L$ kt$LW1$D$8$D$<mD$DL$@$$ĈÍ$D$LD$L$PL$m.mx‹$g+Ћ$0x$H+y$9+z,P$+mzH+@ޡ$|$`D$-fae ;avW$nd L$( $ L$D$D$,D$ D$D$D$D$ L$L$0D$4$e D$;AN$ҋD$D$L$D$iD$|$P5`/D$p$aҋ|$|$He 5*/ 0T$HJ e XBT$XD$\D$`$QtIpL$dT$h  $ыD$ dy e $H$H$H e $P$e u}|$Lt$P.D$L$$L$$L$$L$ ht$La.$D$8$D$<"jD$DL$@$$ĈÍ$D$LD$L$PL$w+mx‹$q(Ћ$0x$R(y$C(zX.(m$|$*D$*(e ;aP4T$0BJL$(Z \$j1$l$YD$L$ e qT$($D$ L$$ϋt$|$|$e ,L$D$Hx e L$(H|L$Qub e uGL$ D$0PX@\$D$T$ $D$ D$8D$<D$@4ËL$ &벍 $ϋD$p|$|$e u+L$D$H` $|$t$M)D$xD$K&1x|D$(6&$|$t$ )$‹D$(&l$$D$, z$F΋|$e L$$IuOD$, %W׉É%ڍ0$`D$輘 u e ;aP4T$0BJL$(Z \$j1$l$艑D$L$ e qT$($D$ L$$O͋t$|$|$e )L$D$Hx e L$(H|L$Qub e uGL$ D$0PX@\$D$T$ $^D$ D$8D$<D$@4ËL$ C$벍 $̋D$p|$|$e u)L$D$H` $|$t$&D$xD$#1x|D$(#$|$t$&$‹D$(#l$$D$,$ˋ|$e L$$IuOD$, H#W׉É8#ڍ0$hD$L  e ;aR8T$0BJL$(Z \$j1$l$蹭D$L$ e qT$($D$ L$$ʋt$|$|$e .'L$D$Hx e L$(H|L$Qub e uGL$ D$0PX@D$\$T$ $D$ D$Yu;D$t%@ $D$K$D$ L$L$D$} 멍|$9;u#e ;av>Yu;D$t%@ $D$k#D$ L$L$D$| 멍|$9;u#e ;av9XYu6t$\t &D$TL$PL$`D$dX7| 0뮍|$\9;u‰#e ;av9XYu6t$\t %D$TL$PL$`D$dX{ 뮍|$\9;u‰#e ;av+D$$D$D$D$D$ D$~e ;av$D$T$9uJ@9D$ 15e ;av>Yu;D$t%@ $D$)D$ L$L$D$z 멍|$9;u#e ;av>Yu;D$t%@ $D$(D$ L$L$D$rz k멍|$9;u#e ;av+D$$D$D$D$蟀D$ D$e ;av$ D$D$D$$>D$D$ e ;av9Yu6t$t 6D$L$L$ D$$wy p뮍|$9;u‰#e ;av9Yu6t$t 5D$L$L$ D$$y 뮍|$9;u‰#e ;av+D$$D$D$D$OD$ D$e ;av$D$T$9uJ@9D$ 1ue ;av>Yu;D$t%@ $D$(D$ L$L$D$"x 멍|$9;u#e ;av>Yu;D$t%@ $D$'D$ L$L$D$w 멍|$9;u#e ;av+D$$D$D$D$}D$ D$Ne ;av$ D$D$D$$<D$D$ e ;av9Yu6t$t = 6D$L$L$ D$$v 뮍|$9;u‰#e ;av9Yu6t$t P5D$L$L$ D$$Wv P뮍|$9;u‰#e ;av+D$$D$D$D$|D$ D$e ;av$D$T$9uJ@9D$ 1e ;av>Yu;D$t%@ $D$['D$ L$L$D$bu [멍|$9;u#e ;av>Yu;D$t%@ $D${&D$ L$L$D$t 멍|$9;u#e ;av9$Yu6t$(t )D$ L$L$,D$0$t 뮍|$(9;u‰#e ;av9$Yu6t$(t  )D$ L$L$,D$0$'t 뮍|$(9;u‰#e ;av+D$$D$D$D$_zD$ D$e ;av,D$D$D$$D$/D$ D$}e ;av9Yu6t$ t 0+D$L$L$$D$('s 뮍|$ 9;u‰#e ;av9Yu6t$ t C`*D$L$L$$D$(r 뮍|$ 9;u‰#e ;av+D$$D$D$D$xD$ D$ne ;av,D$D$D$$D$/.D$ D$e ;av9$Yu6t$(t / 5D$ L$L$,D$0$q 뮍|$(9;u‰#e ;av9$Yu6t$(t 5D$ L$L$,D$0$gq `뮍|$(9;u‰#e ;av+D$$D$D$D$wD$ D$e ;av$D$T$9uJ@9D$ 1e ;av>Yu;D$t%@ $D$[D$ L$L$D$rp k멍|$9;u#e ;av>Yu;D$t%@ $D${D$ L$L$D$p 멍|$9;u#e ;av+D$$D$D$D$/vD$ D$e ;av$D$T$9uJ@9D$ 1Ue ;av>Yu;D$t%@ $D${D$ L$L$D$o 멍|$9;u#e ;av>Yu;D$t%@ $D$D$ L$L$D$n 멍|$9;u#e ;av94Yu6t$8t g bD$0L$,L$Yu;D$t%@ $D$dD$ L$L$D$h 멍|$9;u#e ;av>Yu;D$t%@ $D$;cD$ L$L$D$bh [멍|$9;u#e ;av+D$$D$D$D$nD$ D$e ;av$D$T$9uJ@9D$ 1e ;av>Yu;D$t%@ $D$tD$ L$L$D$bg [멍|$9;u#e ;av>Yu;D$t%@ $D$sD$ L$L$D$f 멍|$9;u#e ;av9,Yu6t$0t _D$(L$$L$4D$8,f 뮍|$09;u‰#e ;av9,Yu6t$0t {^D$(L$$L$4D$8,'f 뮍|$09;u‰#e ;av+D$$D$D$D$ _lD$ D$e ;av,D$D$D$$D$ !D$ D$}e ;avEYuBD$t,P@ $T$D$'D$L$ L$D$ e 뢍|$9;u#e ;avEYuBD$t,P@ $T$D$&D$L$ L$D$ d 뢍|$9;u#e ;av+D$$D$D$D$(jD$ D$Ne ;av,D$D$D$$D$( D$ D$e ;av90Yu6t$4t ,D$,L$(L$8D$<0c 뮍|$49;u‰#e ;av90Yu6t$4t P+D$,L$(L$8D$<0Gc @뮍|$49;u‰#e ;av9,Yu6t$0t ;D$(L$$L$4D$8,b 뮍|$09;u‰#e ;av9,Yu6t$0t @D$(L$$L$4D$8,b 뮍|$09;u‰#e ;av>Yu;D$t%@ $D$k0D$ L$L$D$"b 멍|$9;u#e ;av>Yu;D$t%@ $D$/D$ L$L$D$a ߏ멍|$9;u#e ;av+D$$D$D$D$ gD$ D$Nߏe ;av,D$D$D$$D$ D$ D$ޏe ;avEYuBD$t,P@ $T$D$Yu;D$t%@ $D$KD$ L$L$D$2\ +ڏ멍|$9;u#e ;av>Yu;D$t%@ $D$kD$ L$L$D$[ ُ멍|$9;u#e ;avEYuBD$t,P@ $T$D$/D$L$ L$D$ K[ Dُ뢍|$9;u#e ;avEYuBD$t,P@ $T$D$.D$L$ L$D$ Z ؏뢍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ D$L$D$ L$$dZ ]؏뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ D$L$D$ L$$Y ׏뛍|$9;u#e ;av9Yu6t$ t P1D$L$L$$D$(wY p׏뮍|$ 9;u‰#e ;av9Yu6t$ t 0D$L$L$$D$(Y ׏뮍|$ 9;u‰#e ;av+D$$D$D$D$O_D$ D$֏e ;av$D$T$9uJ@9D$ 1u֏e ;av>Yu;D$t%@ $D$1D$ L$L$D$"X ֏멍|$9;u#e ;av>Yu;D$t%@ $D$0D$ L$L$D$W Տ멍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ 4D$L$D$ L$$4W -Տ뛍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ 3D$L$D$ L$$V ԏ뛍|$9;u#e ;av9 Yu6t$$t 6D$L$L$(D$, GV @ԏ뮍|$$9;u‰#e ;av9 Yu6t$$t YP5D$L$L$(D$, U ӏ뮍|$$9;u‰#e ;av+D$$D$D$D$ \D$ D$ӏe ;av,D$D$D$$D$ OD$ D$=ӏe ;avEYuBD$t,P@ $T$D$DD$L$ L$D$ T ҏ뢍|$9;u#e ;avEYuBD$t,P@ $T$D$TD$L$ L$D$ kT dҏ뢍|$9;u#e ;av+D$$D$D$D$ZD$ D$ҏe ;av$D$T$9uJ@9D$ 1яe ;av>Yu;D$t%@ $D$k;D$ L$L$D$rS kя멍|$9;u#e ;av>Yu;D$t%@ $D$:D$ L$L$D$S Џ멍|$9;u#e ;av+D$$D$D$D$/YD$ D$Џe ;av$D$T$9uJ@9D$ 1UЏe ;av>Yu;D$t%@ $D$;D$ L$L$D$R Ϗ멍|$9;u#e ;av>Yu;D$t%@ $D$:D$ L$L$D$Q Ϗ멍|$9;u#e ;av+D$$D$D$D$WD$ D$.Ϗe ;avD$L$ 9D$ Ώe ;av7 Yu4D$t$=D$L$L$D$ P Ώ밍|$9;uĉ#e ;av7 Yu4D$t$Yu;D$t%@ $D$ID$ L$L$D$D 멍|$9;u#e ;av>Yu;D$t%@ $D$HD$ L$L$D$bD [멍|$9;u#e ;av9XYu6t$\t ޏp?D$TL$PL$`D$dXC 뮍|$\9;u‰#e ;av9XYu6t$\t }ޏ>D$TL$PL$`D$dXC 뮍|$\9;u‰#e ;av+D$$D$D$D$ID$ D$>e ;av,D$D$D$$D$D$ D$e ;av9Yu6t$ t ޏD$L$L$$D$(B 뮍|$ 9;u‰#e ;av9Yu6t$ t ݏD$L$L$$D$(7B 0뮍|$ 9;u‰#e ;av94Yu6t$8t ݏ耕D$0L$,L$ 蠼뮍|$t9;u‰#e ;av+D$$D$D$D$DD$ D$Ne ;avD$L$ 9D$ e ;av7 Yu4D$t$HD$L$L$D$ = »밍|$9;uĉ#e ;av7 Yu4D$t$GD$L$L$D$ i= b밍|$9;uĉ#e ;av9 Yu6t$$t y؏HD$L$L$(D$, = 뮍|$$9;u‰#e ;av9 Yu6t$$t ؏HD$L$L$(D$, < 蠺뮍|$$9;u‰#e ;av+D$$D$D$D$BD$ D$Ne ;avD$L$ 9D$ e ;av7 Yu4D$t$BLD$L$L$D$ ; ¹밍|$9;uĉ#e ;av7 Yu4D$t$rKD$L$L$D$ i; b밍|$9;uĉ#e ;av+D$$D$D$D$AD$ D$e ;avD$L$ 9D$ Ӹe ;av7 Yu4D$t$rMD$L$L$D$ : 肸밍|$9;uĉ#e ;av7 Yu4D$t$LD$L$L$D$ ): "밍|$9;uĉ#e ;av+D$$D$D$D$_@D$ D$ηe ;avD$L$ 9D$ 蓷e ;av7 Yu4D$t$"MD$L$L$D$ I9 B밍|$9;uĉ#e ;av7 Yu4D$t$RLD$L$L$D$ 8 ⶏ밍|$9;uĉ#e ;av9 Yu6t$$t ӏ`xD$L$L$(D$, 8 耶뮍|$$9;u‰#e ;av9 Yu6t$$t ӏwD$L$L$(D$, '8 뮍|$$9;u‰#e ;av90Yu6t$4t ӏND$,L$(L$8D$<07 뮍|$49;u‰#e ;av90Yu6t$4t ҏ@MD$,L$(L$8D$<0g7 `뮍|$49;u‰#e ;avEYuBD$t,P@ $T$D$SD$L$ L$D$ 6 뢍|$9;u#e ;avEYuBD$t,P@ $T$D$RD$L$ L$D$ 6 脴뢍|$9;u#e ;av+D$$D$D$D$Yu;D$t%@ $D$iD$ L$L$D$+ 軩멍|$9;u#e ;av>Yu;D$t%@ $D$iD$ L$L$D$R+ K멍|$9;u#e ;avEYuBD$t,H@$L$D$WD$ L$D$L$ * Ԩ뢍|$9;u#e ;avEYuBD$t,H@$L$D$VD$ L$D$L$ k* d뢍|$9;u#e ;av+D$$D$D$D$0D$ D$e ;avD$L$ 9D$ ӧe ;av7 Yu4D$t$VD$L$L$D$ ) 肧밍|$9;uĉ#e ;av7 Yu4D$t$UD$L$L$D$ )) "밍|$9;uĉ#e ;av+D$$D$D$D$_/D$ D$Φe ;avD$L$ 9D$ 蓦e ;av7 Yu4D$t$WD$L$L$D$ I( B밍|$9;uĉ#e ;av7 Yu4D$t$"WD$L$L$D$ ' ⥏밍|$9;uĉ#e ;av+D$$D$D$D$.D$ D$莥e ;avD$L$ 9D$ Se ;av7 Yu4D$t$WD$L$L$D$ ' 밍|$9;uĉ#e ;av7 Yu4D$t$VD$L$L$D$ & 袤밍|$9;uĉ#e ;av+D$$D$D$D$,D$ D$Ne ;av,D$D$D$$D$D$ D$e ;av9 Yu6t$$t D$L$L$(D$, % 蠣뮍|$$9;u‰#e ;av9 Yu6t$$t 0D$L$L$(D$, G% @뮍|$$9;u‰#e ;av90Yu6t$4t 1D$,L$(L$8D$<0$ ࢏뮍|$49;u‰#e ;av90Yu6t$4t ѿD$,L$(L$8D$<0$ 耢뮍|$49;u‰#e ;avLYuID$t3PX@ $\$T$D$ -WD$L$D$ L$$$ 뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ -VD$L$D$ L$$# 荡뛍|$9;u#e ;av D$D$ Pe ;avD$ #e ;av1Yu.D$ twWD$ $L$D$" ؠ붍|$ 9;uʉ#e ;av1Yu.D$ tVD$ $L$D$" x붍|$ 9;uʉ#e ;av+D$$D$D$D$(D$ D$e ;av$ D$D$D$$D$D$ ՟e ;av9Yu6t$t VD$L$L$ D$$! 耟뮍|$9;u‰#e ;av9Yu6t$t 譼VD$L$L$ D$$'! 뮍|$9;u‰#e ;av+D$$D$D$D$_'D$ D$Ξe ;avD$L$ 9D$ 蓞e ;av7 Yu4D$t$WD$L$L$D$ I  B밍|$9;uĉ#e ;av7 Yu4D$t$VD$L$L$D$  ❏밍|$9;uĉ#e ;av+D$$D$D$D$&D$ D$莝e ;avD$L$ 9D$ Se ;av7 Yu4D$t$XD$L$L$D$  밍|$9;uĉ#e ;av7 Yu4D$t$"XD$L$L$D$  袜밍|$9;uĉ#e ;av+D$$D$D$D$$D$ D$Ne ;avD$L$ 9D$ e ;av7 Yu4D$t$XD$L$L$D$  ›밍|$9;uĉ#e ;av7 Yu4D$t$WD$L$L$D$ i b밍|$9;uĉ#e ;av+D$$D$D$D$#D$ D$e ;avD$L$ 9D$ Ӛe ;av7 Yu4D$t$YD$L$L$D$  肚밍|$9;uĉ#e ;av7 Yu4D$t$YD$L$L$D$ ) "밍|$9;uĉ#e ;avD$D$Mꙏe ;av)Yu&D$ @I$ыD$D$蠙뾍|$ 9;u҉#e ;avD$D$D$Kbe ;av9Yu6D$@IT$T$$ыD$ L$L$D$ 뮍|$9;u‰#e ;av2 Yu/D$@IT$T$$D$D$ 跘뵍|$9;uɉ#e ;av9,Yu6t$0t 諵 `D$(L$$L$4D$8,W P뮍|$09;u‰#e ;av9,Yu6t$0t KP_D$(L$$L$4D$8, 뮍|$09;u‰#e ;av>Yu;D$t%@ $D$dD$ L$L$D$ 苗멍|$9;u#e ;av>Yu;D$t%@ $D$cD$ L$L$D$" 멍|$9;u#e ;av+D$$D$D$D$OD$ D$辖e ;av,D$D$D$$D$ԊD$ D$me ;av9 Yu6t$$t 艳PD$L$L$(D$,  뮍|$$9;u‰#e ;av9 Yu6t$$t )耈D$L$L$(D$,  谕뮍|$$9;u‰#e ;avLYuID$t3HX@ $L$\$D$ D$L$D$ L$$D =뛍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ D$L$D$ L$$ 轔뛍|$9;u#e ;av+D$$D$D$D$ D$ D$^e ;av,D$D$D$$D$ ҊD$ D$ e ;avEYuBD$t,P@ $T$D$4D$L$ L$D$  褓뢍|$9;u#e ;avEYuBD$t,P@ $T$D$DD$L$ L$D$ ; 4뢍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ MsD$L$D$ L$$ 轒뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ MrD$L$D$ L$$D =뛍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ D$L$D$ L$$ 轑뛍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ D$L$D$ L$$D =뛍|$9;u#e ;av+D$$D$D$D$oD$ D$ސe ;av$D$T$9uJ@9D$ 1蕐e ;av>Yu;D$t%@ $D$ D$ L$L$D$B ;멍|$9;u#e ;av>Yu;D$t%@ $D$+D$ L$L$D$ ˏ멍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ =D$L$D$ L$$T M뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ =D$L$D$ L$$ ͎뛍|$9;u#e ;av+D$$D$D$D$D$ D$ne ;av$D$T$9uJ@9D$ 1%e ;av>Yu;D$t%@ $D$[D$ L$L$D$ ˍ멍|$9;u#e ;av>Yu;D$t%@ $D${D$ L$L$D$b [멍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ }D$L$D$ L$$ ݌뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ }D$L$D$ L$$d ]뛍|$9;u#e ;av90Yu6t$4t A萲D$,L$(L$8D$<0  뮍|$49;u‰#e ;av90Yu6t$4t ᨏD$,L$(L$8D$<0  萋뮍|$49;u‰#e ;avEYuBD$t,P@ $T$D$DD$L$ L$D$ +  $뢍|$9;u#e ;avEYuBD$t,P@ $T$D$TD$L$ L$D$   贊뢍|$9;u#e ;av9TYu6t$Xt GD$PL$LL$\D$`TW  P뮍|$X9;u‰#e ;av9TYu6t$Xt 福0D$PL$LL$\D$`T  뮍|$X9;u‰#e ;av9$Yu6t$(t @D$ L$L$,D$0$  萉뮍|$(9;u‰#e ;av9$Yu6t$(t 蟦pD$ L$L$,D$0$7  0뮍|$(9;u‰#e ;av+D$$D$D$D$oD$ D$ވe ;av$D$T$9uJ@9D$ 1蕈e ;av>Yu;D$t%@ $D$D$ L$L$D$B  ;멍|$9;u#e ;av>Yu;D$t%@ $D$D$ L$L$D$  ˇ멍|$9;u#e ;av+D$$D$D$D$D$ D$ne ;avD$L$ 9D$ 3e ;av7 Yu4D$t$D$L$L$D$  ↏밍|$9;uĉ#e ;av7 Yu4D$t$2D$L$L$D$  肆밍|$9;uĉ#e ;av+D$$D$D$D$D$ D$.e ;av$ D$D$D$$̊D$D$ 兏e ;av9Yu6t$t D$L$L$ D$$ 萅뮍|$9;u‰#e ;av9Yu6t$t 轢D$L$L$ D$$7 0뮍|$9;u‰#e ;av+D$$D$D$D$o D$ D$ބe ;avD$L$ 9D$ 裄e ;av7 Yu4D$t$D$L$L$D$ Y R밍|$9;uĉ#e ;av7 Yu4D$t$D$L$L$D$  밍|$9;uĉ#e ;av9PYu6t$Tt 葠D$LL$HL$XD$\P 萃뮍|$T9;u‰#e ;av9PYu6t$Tt 1D$LL$HL$XD$\P7 0뮍|$T9;u‰#e ;av9$Yu6t$(t ?D$ L$L$,D$0$ Ђ뮍|$(9;u‰#e ;av9$Yu6t$(t ߟD$ L$L$,D$0$w p뮍|$(9;u‰#e ;avLYuID$t3PX@ $\$T$D$ - D$L$D$ L$$ 뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ - D$L$D$ L$$ }뛍|$9;u#e ;av D$D$ @e ;avD$ e ;av1Yu.D$ tD$ $L$D$ Ȁ붍|$ 9;uʉ#e ;av1Yu.D$ tD$ $L$D$o h붍|$ 9;uʉ#e ;av9Yu6t$t 荝DD$L$L$ D$$ 뮍|$9;u‰#e ;av9Yu6t$t -@CD$L$L$ D$$ 뮍|$9;u‰#e ;av+D$$D$D$D$D$ D$Ne ;avD$L$ 9D$ e ;av7 Yu4D$t$"D$L$L$D$  ~밍|$9;uĉ#e ;av7 Yu4D$t$RD$L$L$D$ i b~밍|$9;uĉ#e ;avLYuID$t3PX@ $\$T$D$ D$L$D$ L$$ }뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ D$L$D$ L$$t m}뛍|$9;u#e ;av7 Yu4D$t$hD$L$L$D$  }밍|$9;uĉ#e ;av7 Yu4D$t$2gD$L$L$D$  |밍|$9;uĉ#e ;av9 Yu6t$$t 蹙D$L$L$(D$, G @|뮍|$$9;u‰#e ;av9 Yu6t$$t YD$L$L$(D$,  {뮍|$$9;u‰#e ;av9 Yu6t$$t 耝D$L$L$(D$,  {뮍|$$9;u‰#e ;av9 Yu6t$$t 虘谜D$L$L$(D$, ' {뮍|$$9;u‰#e ;av9$Yu6t$(t /'D$ L$L$,D$0$ z뮍|$(9;u‰#e ;av9$Yu6t$(t ϗ&D$ L$L$,D$0$g `z뮍|$(9;u‰#e ;av+D$$D$D$D$D$ D$ze ;av$ D$D$D$$D$D$ ye ;av9Yu6t$t D$L$L$ D$$w py뮍|$9;u‰#e ;av9Yu6t$t 蝖PD$L$L$ D$$ y뮍|$9;u‰#e ;av9 Yu6t$$t )D$L$L$(D$,  x뮍|$$9;u‰#e ;av9 Yu6t$$t ɕD$L$L$(D$, W Px뮍|$$9;u‰#e ;avLYuID$t3HX@ $L$\$D$ D$L$D$ L$$ w뛍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ D$L$D$ L$$d ]w뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ - D$L$D$ L$$ v뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ -D$L$D$ L$$d ]v뛍|$9;u#e ;av D$D$ ve ;avD$ ue ;av1Yu.D$ t!D$ $L$D$ u붍|$ 9;uʉ#e ;av1Yu.D$ tG!D$ $L$D$O Hu붍|$ 9;uʉ#e ;av+D$$D$D$D$D$ D$te ;avD$L$ 9D$ te ;av7 Yu4D$t$BD$L$L$D$ i bt밍|$9;uĉ#e ;av7 Yu4D$t$rD$L$L$D$  t밍|$9;uĉ#e ;av+D$$D$D$D$?D$ D$se ;av$D$T$9uJ@9D$ 1ese ;av>Yu;D$t%@ $D$k%D$ L$L$D$ s멍|$9;u#e ;av>Yu;D$t%@ $D$$D$ L$L$D$ r멍|$9;u#e ;av+D$$D$D$D$D$ D$>re ;avD$L$ 9D$ re ;av7 Yu4D$t$'D$L$L$D$  q밍|$9;uĉ#e ;av7 Yu4D$t$&D$L$L$D$ Y Rq밍|$9;uĉ#e ;av+D$$D$D$D$D$ D$pe ;av$D$T$9uJ@9D$ 1pe ;av>Yu;D$t%@ $D$D$ L$L$D$b [p멍|$9;u#e ;av>Yu;D$t%@ $D$D$ L$L$D$ o멍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ *D$L$D$ L$$t mo뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ )D$L$D$ L$$ n뛍|$9;u#e ;av+D$$D$D$D$D$ D$ne ;avD$L$ 9D$ Sne ;av7 Yu4D$t$r-D$L$L$D$  n밍|$9;uĉ#e ;av7 Yu4D$t$,D$L$L$D$  m밍|$9;uĉ#e ;av+D$$D$D$D$ D$ D$Nme ;av,D$D$D$$D$ D$ D$le ;avEYuBD$t,P@ $T$D$QD$L$ L$D$  l뢍|$9;u#e ;avEYuBD$t,P@ $T$D$PD$L$ L$D$ + $l뢍|$9;u#e ;av+D$$D$D$D$ _D$ D$ke ;av,D$D$D$$D$ 菩D$ D$}ke ;avEYuBD$t,P@ $T$D$蔰D$L$ L$D$  k뢍|$9;u#e ;avEYuBD$t,P@ $T$D$褯D$L$ L$D$  j뢍|$9;u#e ;av9 Yu6t$$t 蹇谷D$L$L$(D$, G @j뮍|$$9;u‰#e ;av9 Yu6t$$t YD$L$L$(D$,  i뮍|$$9;u‰#e ;av90Yu6t$4t ц)D$,L$(L$8D$<0 i뮍|$49;u‰#e ;av90Yu6t$4t q)D$,L$(L$8D$<0' i뮍|$49;u‰#e ;avLYuID$t3PX@ $\$T$D$ m2D$L$D$ L$$ h뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ m1D$L$D$ L$$4 -h뛍|$9;u#e ;av98Yu6t$Yu;D$t%@ $D${D$ L$L$D$ e멍|$9;u#e ;av>Yu;D$t%@ $D$D$ L$L$D$" e멍|$9;u#e ;av+D$$D$D$D$ OD$ D$de ;av,D$D$D$$D$ D$ D$mde ;avEYuBD$t,P@ $T$D$$@D$L$ L$D$   d뢍|$9;u#e ;avEYuBD$t,P@ $T$D$4?D$L$ L$D$  c뢍|$9;u#e ;av94Yu6t$8t wp7D$0L$,L$D$L$L$D$  a밍|$9;uĉ#e ;av7 Yu4D$t$=D$L$L$D$  a밍|$9;uĉ#e ;av+D$$D$D$D$D$ D$>ae ;av$D$T$9uJ@9D$ 1`e ;av>Yu;D$t%@ $D$D$ L$L$D$ `멍|$9;u#e ;av>Yu;D$t%@ $D$D$ L$L$D$2 +`멍|$9;u#e ;av+D$$D$D$D$_D$ D$_e ;av$D$T$9uJ@9D$ 1_e ;av>Yu;D$t%@ $D$Yu;D$t%@ $D$;D$ L$L$D$ ^멍|$9;u#e ;av+D$$D$D$D$D$ D$^^e ;avD$L$ 9D$ #^e ;av7 Yu4D$t$?D$L$L$D$ ߊ ]밍|$9;uĉ#e ;av7 Yu4D$t$2>D$L$L$D$ yߊ r]밍|$9;uĉ#e ;avYuD$$/]͍|$9;u#e ;av'Yu$D$ @I$ыD$D$\|$ 9;uԉ#e ;avJYuGD$ $D$(D$D$,D$D$0D$ D$4D$D$8D$D$D$<o\띍|$ 9;u#e ;av7Yu4D$@IT$T$$ыD$ L$L$ D$$\밍|$9;uĉ#e ;av0 Yu-D$@IT$T$$D$D$ [뷍|$9;uˉ#e ;av$Yu!D$ $D$D$e[Í|$ 9;u׉#e ;av?Yuiot볍 պD$0G E$|$h͌ D$0G E$|$M͌ Be ;a>0D$<D$(PD$D$L$HL$T$D$ D$D$@@D$$D$D$ KD$HL$$D$,1FT$ \$4$l$8l$t$ 90$H@D$L$od $`D$L$T$\$ l$$$$$$D$ъD$L$ d td e uh d D$lL$pD$ltJPӃ uʀ$$$\$$\$D$ L$T$谮111=d ‰tO111막$$ļË$$$L$$T$讕D$ D$8L$L$P$$$T$$T$艾D$L$ tIDŽ$DŽ$DŽ$DŽ$T$8$T$P$$$y]$D$$D$D$ D$鞕D$L$$$ļÁ~.8ZZ@9$A d td e d $$$tbQӃ uʀ$$$\$$\$L$ D$T$踬DŽ$DŽ$ļ111몍=d hMm n9;$D$D$L$QT$,IL$<90111ۈ d   d e uhd L$\D$`L$\tJQӃ uʀ$$$\$$\$L$ D$T$荫111=d UL둍 뉉$$ļÃu1u11$u F  .$\|$G e uu L$,O e uFL$t$(l$L$4L$$T$8T$"$D$l$@t$&e ;a||$L#?$@,HP ~D$(T$$1l$0ËD$(L$0\$ |$dC|$Lt$dCL$LL$,T$PT$h(l$-",$L$T$ c3D$@T$L$4D$8D$<D$@D$DD$H0$L$4L$_D$ L$L$ˊD$D$ L$( $L$L$ @"L$L$,L$ L$D$D$D$0D$ D$4$Í $ʊD$늍Oωf"cOωЫK"*9" e ;avGD$$D$D$wD$L$ L$$3,D$L$T$T$ L$$D$(B e ;a$D$($D$4D$D$L$ T$,L$ e |\$0$D$L$$Ɋt$|$|$e %L$,D$Hx e L$0H|L$Qum e uRL$ $D$8D$D$D$L$ D$lL$p<댎e ;av'4t$8⩎kD$0L$,L$dD$h4袌e ;aL|$1 ûL$D$L$PIt`|$$t$谩D$0~7|$8t$蛩p$D$8D$7&D$L$ D$TL$XLD$TD$XLÍF$D$D$$ L$oɋ$e ;av2L$ |$OL$O e u D$|$ËD$we ;avG '$-KD$L$L$HL$ e u A L$Íy 虢e ;av6L$ T$JL$J e u D$BT$ÍzD$JÊe ;av`0$}JD$L$H e u+L$L$ e u AL$ÍyߡNjD$ҡIe ;av`0$ID$L$H e u+L$L$ e u A L$Íy _NjD$Rɉe ;avG '$}ID$L$L$HL$ e u A$L$Íy$頎be ;avG '$ID$L$L$HL$ e u A(L$Íy(艠e ;avYD$ D$D$$D$D$(D$N$D$D$D$L$ $L$ :D$L$ D$,L$0萈e ;av3D$$D$D$D$ D$OD$ L$D$$L$(6e ;av2L$ |$OL$O e u D$|$ËD$n燎e ;avQD$D$D$ D$$D$D$uD$ L$ $D$8D$L$ D$$L$(xe ;av+D$$D$D$gD$ L$L$D$ .e ;aL|$1w L$D$L$PAt`|$$t$&D$0~7|$8t$p$D$8D$ D$L$ D$TL$XLD$TD$XLÍF$D$_D$$ L$yo$D$.D$$ L$HL$P3 e ;av\0$ED$L$H e u'L$|$  e u |$#NjD$荅e ;av`0$=ED$L$H e u+L$L$ e u AL$Íy蟜NjD$蒜 e ;av/ࢯ$@e D$36D$ L$L$D$躄e ;av$L$D$ L$~e ;ava D$$D$D$(D$D$,D$D$0D$$D$D$D$ L$ $D$q5D$L$ D$4L$8 e ;av;D$$D$ D$D$$D$D$(D$ GD$L$L$,D$0螃e D$;A|$L1 }L$LD$P$Q IOT$8L$,\$ \$41E90ދtl$ $D$L$u1L$,T$8l$ t$4D$$L$0D$<D$@D$DD$H0D$< L$@`&$\$ \$4D$L$ D$DL$HȺ$D$L$Ie ;avD$L$ 9D$ Ie ;av7 Yu4D$t$rD$L$L$D$ ʉ H밍|$9;uĉ#e ;av7 Yu4D$t$袈D$L$L$D$ Yʉ RH밍|$9;uĉ#e ;av9 Yu6t$$t ieD$L$L$(D$, ɉ G뮍|$$9;u‰#e ;av9 Yu6t$$t e@D$L$L$(D$, ɉ G뮍|$$9;u‰#e ;av+D$$D$D$D$ ωD$ D$>Ge ;av,D$D$D$$D$ D$ D$Fe ;avEYuBD$t,P@ $T$D$脈D$L$ L$D$ ȉ F뢍|$9;u#e ;avEYuBD$t,P@ $T$D$蔇D$L$ L$D$ ȉ F뢍|$9;u#e ;av D$D$ Ee ;avD$ Ee ;av1Yu.D$ tNJD$ $L$D$olj hE붍|$ 9;uʉ#e ;av1Yu.D$ tD$ $L$D$lj E붍|$ 9;uʉ#e ;av>Yu;D$t%@ $D$諊D$ L$L$D$Ɖ D멍|$9;u#e ;av>Yu;D$t%@ $D$ˉD$ L$L$D$2Ɖ +D멍|$9;u#e ;av+D$$D$D$D$_̉D$ D$Ce ;avD$L$ 9D$ Ce ;av7 Yu4D$t$貋D$L$L$D$ Iʼn BC밍|$9;uĉ#e ;av7 Yu4D$t$D$L$L$D$ ĉ B밍|$9;uĉ#e ;av+D$$D$D$D$ˉD$ D$Be ;av$D$T$9uJ@9D$ 1EBe ;av>Yu;D$t%@ $D$[D$ L$L$D$É A멍|$9;u#e ;av>Yu;D$t%@ $D${D$ L$L$D$É {A멍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ 譊D$L$D$ L$$É @뛍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ 證D$L$D$ L$$‰ }@뛍|$9;u#e ;av+D$$D$D$D$ȉD$ D$@e ;avD$L$ 9D$ ?e ;av7 Yu4D$t$D$L$L$D$  ?밍|$9;uĉ#e ;av7 Yu4D$t$D$L$L$D$ 9 2?밍|$9;uĉ#e ;av9 Yu6t$$t I\D$L$L$(D$,  >뮍|$$9;u‰#e ;av9 Yu6t$$t [ D$L$L$(D$, w p>뮍|$$9;u‰#e ;av+D$$D$D$D$ƉD$ D$>e ;av$D$T$9uJ@9D$ 1=e ;av>Yu;D$t%@ $D$D$ L$L$D$肿 {=멍|$9;u#e ;av>Yu;D$t%@ $D$D$ L$L$D$ =멍|$9;u#e ;av D$D$ Yu;D$t%@ $D$D$ L$L$D$ 6멍|$9;u#e ;av>Yu;D$t%@ $D$D$ L$L$D$肸 {6멍|$9;u#e ;av+D$$D$D$D$课D$ D$6e ;avD$L$ 9D$ 5e ;av7 Yu4D$t$BD$L$L$D$ 虷 5밍|$9;uĉ#e ;av7 Yu4D$t$rD$L$L$D$ 9 25밍|$9;uĉ#e ;av+D$$D$D$D$oD$ D$4e ;avD$L$ 9D$ 4e ;av7 Yu4D$t$2D$L$L$D$ Y R4밍|$9;uĉ#e ;av7 Yu4D$t$bD$L$L$D$  3밍|$9;uĉ#e ;avEYuBD$t,H@$L$D$脖D$ L$D$L$ 苵 3뢍|$9;u#e ;avEYuBD$t,H@$L$D$蔕D$ L$D$L$  3뢍|$9;u#e ;av+D$$D$D$D$OD$ D$2e ;avD$L$ 9D$ 2e ;av7 Yu4D$t$BD$L$L$D$ 9 22밍|$9;uĉ#e ;av7 Yu4D$t$rD$L$L$D$ ٳ 1밍|$9;uĉ#e ;av7 Yu4D$t$蒗D$L$L$D$ y r1밍|$9;uĉ#e ;av7 Yu4D$t$–D$L$L$D$  1밍|$9;uĉ#e ;av+D$$D$D$D$OD$ D$0e ;avD$L$ 9D$ 0e ;av7 Yu4D$t$BD$L$L$D$ 9 20밍|$9;uĉ#e ;av7 Yu4D$t$rD$L$L$D$ ٱ /밍|$9;uĉ#e ;avEYuBD$t,H@$L$D$贗D$ L$D$L$ k d/뢍|$9;u#e ;avEYuBD$t,H@$L$D$ĖD$ L$D$L$  .뢍|$9;u#e ;av94Yu6t$8t K谛D$0L$,L$Yu;D$t%@ $D$;D$ L$L$D$蒪 (멍|$9;u#e ;av>Yu;D$t%@ $D$[D$ L$L$D$" (멍|$9;u#e ;av D$D$ 'e ;avD$ 'e ;av1Yu.D$ tעD$ $L$D$o h'붍|$ 9;uʉ#e ;av1Yu.D$ t'D$ $L$D$ '붍|$ 9;uʉ#e ;avD$D$_&e ;av)Yu&D$ @I$ыD$D$&뾍|$ 9;u҉#e ;avD$D$D$B&e ;av9Yu6D$@IT$T$$ыD$ L$L$D$ %뮍|$9;u‰#e ;av2 Yu/D$@IT$T$$D$D$ %뵍|$9;uɉ#e ;av9 Yu6t$$t BD$L$L$(D$, 7 0%뮍|$$9;u‰#e ;av9 Yu6t$$t IBD$L$L$(D$, צ $뮍|$$9;u‰#e ;av+D$$D$D$D$D$ D$~$e ;av$ D$D$D$$GkD$D$ 5$e ;av9Yu6t$t mAD$L$L$ D$$祉 #뮍|$9;u‰#e ;av9Yu6t$t AD$L$L$ D$$臥 #뮍|$9;u‰#e ;av9 Yu6t$$t @D$L$L$(D$, ' #뮍|$$9;u‰#e ;av9 Yu6t$$t 9@@D$L$L$(D$, Ǥ "뮍|$$9;u‰#e ;avLYuID$t3HX@ $L$\$D$ }D$L$D$ L$$T M"뛍|$9;u#e ;avLYuID$t3HX@ $L$\$D$ }D$L$D$ L$$ԣ !뛍|$9;u#e ;av+D$$D$D$D$D$ D$n!e ;av,D$D$D$$D$/_D$ D$!e ;av9Yu6t$ t C> D$L$L$$D$(Ǣ 뮍|$ 9;u‰#e ;av9Yu6t$ t =PD$L$L$$D$(g ` 뮍|$ 9;u‰#e ;av9 Yu6t$$t y=蠠D$L$L$(D$,  뮍|$$9;u‰#e ;av9 Yu6t$$t =ПD$L$L$(D$, 觡 뮍|$$9;u‰#e ;av>Yu;D$t%@ $D$D$ L$L$D$B ;멍|$9;u#e ;av>Yu;D$t%@ $D$ D$ L$L$D$Ҡ 멍|$9;u#e ;av D$D$ e ;avD$ ce ;av1Yu.D$ tGD$ $L$D$ 붍|$ 9;uʉ#e ;av1Yu.D$ t藴D$ $L$D$迟 붍|$ 9;uʉ#e ;av>Yu;D$t%@ $D$+D$ L$L$D$R K멍|$9;u#e ;av>Yu;D$t%@ $D$KD$ L$L$D$➉ 멍|$9;u#e ;av D$D$ e ;avD$ se ;av1Yu.D$ t藶D$ $L$D$/ (붍|$ 9;uʉ#e ;av1Yu.D$ tD$ $L$D$ϝ 붍|$ 9;uʉ#e ;avLYuID$t3PX@ $\$T$D$ }D$L$D$ L$$T M뛍|$9;u#e ;avLYuID$t3PX@ $\$T$D$ }D$L$D$ L$$Ԝ 뛍|$9;u#e ;av D$D$ e ;avD$ ce ;av1Yu.D$ tD$ $L$D$ 붍|$ 9;uʉ#e ;av1Yu.D$ t7D$ $L$D$进 붍|$ 9;uʉ#e ;avYuD$$o͍|$9;u#e ;av'Yu$D$ @I$ыD$D$"|$ 9;uԉ#e ;avJYuGD$ $D$$D$D$(D$D$,D$ D$0D$D$4D$@D$D$8띍|$ 9;u#e ;av7Yu4D$@IT$T$$ыD$ L$L$D$ R밍|$9;uĉ#e ;av0 Yu-D$@IT$T$$D$D$ 뷍|$9;uˉ#e ;a!D$ wCt+tD$D$ ÍCںD$D$ ÍѺD$D$ Àt+uJD$D$ ÍκD$D$ Í\D$D$ Àw+uD$D$ ÍD$D$ Àt+ u'?D$D$ ÍܲD$D$ Í;D$D$ Àws w+ u.ĺD$D$ Í-D$D$ À t+uںD$D$ ÍxD$D$ Í$D$D$ ÀwCt+uD$D$ Í\D$D$ Í{\D$D$ Àt4t>D$D$ ÍED$D$ ÍHoD$D$ e ;av8 Yu5D$t$D$L$L$D$ H A믍|$9;uÉ#e ;av!D$D$D$D$D$ D$D$D$ e D$;An$Ç݃ƒÃN?1111\$@ۉ!˄t!˄t|$`|$t1,J01|$@0|$80D$,|$@14T$PBl$4l$0T$Pt$XT$D$$D$D$ D$+mD$L$t@$L$ e ;a,` $ĉD$D$ Dwd @wd $L$D$D$ D$aD$L$uD$ D$0,t@D$$D$(D$$L$(~B$D$>D$$D$D$ D$@lD$L$t@$L$Վ e ;av[D$ L$08t D$@ËD$$$D$(D$D$,D$D$4D$ D$8D$D$D$D$ e ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$UBD$ 1݉4$T$l$6L$ D$\$vqe ;av=Yu:D$t$HP$L$T$D$ D$#z 몍|$9;u#e ;av9Yu6t$t GD$L$ L$D$ y 뮍|$9;u‰#e ;av2Yu/t$t`D$ D$^y W뵍|$9;uɉ#e ;avQ YuNt$$t8`D$L$T$\$l$ l$(T$,\$0L$4D$8 x 떍|$$9;u#e ;av9Yu6t$t D$L$ L$D$ wx p뮍|$9;u‰#e ;avBD$$L$L$'7D$L$ $D$D$ ~D$ D$e ;aviD$H\$+s9t11Ʉu 1D$ÍK $D$D$ 3D$ ׉,$T$t$3L$ D$\${e ;av?,YuD$,$t$|$X|$8t$XD$HD$0L$LL$($L$T$@\$DT$\$ 4D$|7L$(9w/{d e uD$0{d xÍ={d D$0Y )܍e ;at$0t(D$4D$ D$8D$$D$D$D$D$ D$$D$ D$(D$D$,D$D$0D$4ÅZ9R9J\$L$l$ T$$)!щL$()D$,\$0D$4Ël=Vщ<$¾CՋT$D$D$D$ D$$D$ D$(D$D$,D$D$0D$4D$D$D$ D$$D$ D$(L$,D$D$0D$4D$D$D$ D$$D$ D$(L$,D$D$0D$4Ë|$ |$wۇ,1x޻KB tōe ;a$,D$0$L$4L$T$8T$KD$L$T$ \$ l$t$L$$\$($l$t$D$ L$ T$\$l$t$t-D$(D$T$T$,D$0\$$\$4)É!ډT$8)L$Ƅ$DŽ$DŽ$DŽ$$$ĴÈ$$$$DŽ$DŽ$ĴÈ\$?$L$D$PD$D$ L$D$`D$dD$hD$`L$dD$?D$hP$D$`D$BD$L$ Ƅ$DŽ$DŽ$DŽ$$$ĴÉ$L$D$PD$ D$ L$T$\$$L$T$\$ &GD$L$T$$L$T$$H$ЉD$ $HD$L$[D$L$(T$,\$l$ t$$t>Ƅ$DŽ$DŽ$DŽ$$$ĴÈ$$$$DŽ$DŽ$ĴËD$X$D$LD$D$PD$D$ L$T$ \$l$t$$$$$$$ĴË$$$D$$D$l$ t$D$DD$|$lt$\%Í0$D$lD$?D$L$ Ƅ$DŽ$DŽ$DŽ$$$ĴË8d D$L$ $,$0DŽ$DŽ$DŽ$DŽ$0$$4L$ D$ L$$$0$$,D$d D$ L$$$$D$4$D$D$ D$ؓD$L$$$İDŽ$DŽ$İÈ$$D$$D$$D$ (D$L$L$0t$$耎L$$L$+|$T$gL$+$$D$0D$h6D$L$ $$$(t$T)eD$ L$$$ DŽ$DŽ$DŽ$DŽ$0$$$L$D$L$ $$0$$D$D$L$ $$ý$D$.$D$D$ D$1דD$L$$$İDŽ$DŽ$İÀ }$$D$$D$$D$ l*D$L$T$$L$4D$L$ $$DŽ$DŽ$0$$D$D$L$ $$m$D$$D$D$ D$֓D$L$$$İDŽ$DŽ$İÈ$$D$$D$$D$ L+D$L$T$ \$l$t$$$$$T$X$\DŽ$DŽ$DŽ$DŽ$0$$D$aD$L$ $$@$$TD$D$L$ $$7$D$$D$D$ D$ԓD$L$$$İDŽ$DŽ$İÈ$$D$$D$$D$ (&D$L$T$ $D$g2D$L$ $ $DŽ$DŽ$0$$ D$"D$L$ $$H$D$ $D$D$ D$ӓD$L$$$İDŽ$DŽ$İÀ$11ɄDŽ$DŽ$ & $D$^D$L$ $$ѻ$D$$D$D$ D$ғD$L$$$İDŽ$DŽ$İ11F$&$$D$$D$$D$ o+D$L$T$<L$4$D$D$ aD$ L$$$D$4$D$D$ `D$ L$$$DŽ$pDŽ$tDŽ$xDŽ$|0$$L$D$L$ $p$t0$$D$D$L$ $x$|$D$"$pD$D$ D$ГD$L$$$İDŽ$DŽ$İÈ$$D$$D$$D$ +D$L$T$DŽ$DŽ$ '$L$D$D$ L$$$l$D$$D$D$ D$ГD$L$$$İDŽ$DŽ$İÀtLt(w2Z$DŽ$ İÍ%Z$DŽ$ İÈ$$D$$D$$D$ ,D$ L$T$\$l$,$\$T$L$ RD$L$$$DŽ$DŽ$0$$D$&D$L$ $$F&$D$$D$D$ D$ΓD$L$$$İDŽ$DŽ$İge ;aHD$L2tN$D$PD$D$TD$D$XD$ [D$L$uN*D$\D$` HÉD$\L$`HÈ$D$PD$D$TD$D$XD$ MD$L$T$\$t$$L$T$XD$ L$D$\L$`HÍN*D$\D$` HÈ$D$PD$D$TD$D$XD$ D$L$T$t $D$a+D$L$ D$\L$`HÍN*D$\D$` HÀ6$D$PD$D$TD$D$XD$ e"D$L$T$\$l$ t$$D$0L$4$\$l$ZD$ L$D$(L$,D$8D$<D$@D$D0$L$0L$D$L$ D$8L$<0$D$(D$^D$L$ D$@L$D7$D$D$8D$D$ D$˓D$L$D$\L$`HD$\D$`HÈ$D$PD$D$TD$D$XD$ 8D$L$T$\$t)$L$T$D$ 1D$L$D$\L$`HÍN*D$\D$` Hce ;alD$pD$t$L$xL$T$|T$荒D$ D$ t $lËD$t$L$xL$T$|T$D$ L$T$9t$|$H肀@$D$HD$D$L$ $L$ D$<D$@D$D L$ge ;aHlD$pD$x}111ۄtp$$lËl$tMU U  U  U u u u 댋L$t $D$T$|T$L$ D$T$t$|$H+[@$D$HD$ԈD$ L$ $D${Ȋ D$<D$@D$D ۻL$D$xD$|dÉD$4T$,\$(D$8$D$,xnD$4T$,\$(D$8$D$]VnD$8tJH X@9w\$)ȉ!ЉD$)ˉ\$l$ (7D$L$D$xL$|dÍ귺D$xD$|d> g/e ;ae vu耮 e R_T2.V$TÕϔJ"%$D$ 菑D$ L$ Xd e  \d R$D$WD$L$ Pd e  Td $D$D$L$ @d e u Dd K$D$琍D$L$ 8d e + H X@$\$D$L$ t$|$.|$0t$|.( u|$,9;u#e ;a8YD$@D$DD$HD$A YI$\$L$D$ t$|$$)|$@t$$u)8  녍|$<9;u#e ;aTY|$\1<$L$Xtj|$,+$L$XQ iI$l$L$T$ ̻t$|$,(L$$L$+|$@t$,(|$\t$@(L$+L$pTJ C N|$X9;f#_e ;avMYuJD$t4H X@$\$D$L$ Yu;D$t%H$L$YD$L$ D$L$R K 멍|$9;u#e ;avBD$$L$L$ID$L$ $D$D$hD$ D$e ;avWD$HT$Z*09t1Ʉt@J8D$1,$t$\$vFL$ D$T$be ;avFYuCD$t-H@$D$L$CD$ L$D$L$   롍|$9;u#e ;avB0Yu?t$4t)$D$8D$$D$Yu;D$t%H$L$yD$L$ D$L$2 +멍|$9;u#e ;av=Yu:D$t$HP$L$T$D$ D$Æ 몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$TD$D$(B ;뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$$˅ 뢍|$9;u#e ;a D$,@,L$0 $ЋD$L$T$ \$uhD$\$D$$@0L$( $ЋD$L$T$ \$t T$4\$8 É$L$D$D$D$D$ D$L$D$4L$8 ÉT$4L$8 Ee ;a$D$(@0L$, $ЋD$L$ T$\$uhT$ \$$T$D$0D$D$4D$ D$8D$WD$L$t D$e ;a4 D$<D$@Ϩ$D$$D$L$(L$蹗D$L$T$ Xc $DD$L$9D$ Xc L$T$ D$$ WL$$x*L$QQ\AQBBB T$4Q T$8Qe usD$0AAA A$ $D$,D$sD$$$D$(D$ D$D$D$ D$L$D$\ gߌe ;a/4D$8$D$ L$D$ D$D$D$YD$ L$D$8HPX k9GSP [H P$X9ڇÇ9!9 PtM9}hPq9iHH P$H P$Xh?97D EL${ 獴$ՂD$=S獴$賂D$='1獴$ D$D$D$L$ $$`\$D$D$ L$D$yL$0\$,$L$D$ʚ;D$ 0D$L$$ȉD$$нʚ;l$,)ŋ\$΋L$(iʚ;)NjD$0Ѕ…!څ „tʚ;T$$1ΉщT$$뉄$$G $̌e ;a$D$($D$ uL$D$ D$D$D$ D$ L$*D$,$D$0D$D$4D$D$8D$ 蕶D$L$T$($cV\$D$ D$ L$D$D$(H PXi9nYX  ,HPX h$9 Qw X h$D$<D$@$ÍQwX h$փtύ3$T$L$\$ l$"D$L$T$\$(Se u C‰K{L$F gʌRe ;a8D$֌L$(T$$|$P3$l$L$t$ \$t$l$D$\L$(T$$\$,|$PPL$hD$lX-: &; Oje ;a(D$,$D$ uL$D$ D$D$D$9D$ L$ $}D$D$$L$,Q)T$ T$0$T$4T$D$"D$$BH P@9R$)ȉ!؉D$)ʉT$l$ ċD$L$T$,$\$D$D$ L$D$D$,H QXh9nQP  ,HPX h$9 Qw X h$D$8D$<(ÍQwX h$փtύ3$\$L$l$ T$D$L$T$\$,Se uC‰؉I{ӌ귺L$8D$<(8 8 "e ;ap$D$($D$ .L$D$ D$D$D$ D$ L$ D$($ uպL$D$ L$ D$D$$D$(HP Xj9nJH ,HPX h$9 Qw X h$D$,D$0$ÍQwX h$փtύ3$\$T$L$ l$DD$L$T$\$(Se uCʉʼn؉G{ҌL$,D$0$\6 腺pe ;ap$D$($D$ .L$D$ D$D$D$yD$ L$ D$($ պL$D$ L$ D$D$D$(HP Xj9nJH ,HPX h$9 Qw X h$D$,D$0$ÍQwX h$փtύ3$\$T$L$ l$贍D$L$T$\$(Se uCʉʼn؉G{ЌL$,D$0$4 pe ;a;`D$d$D$ L$D$ D$D$D$D$L$ D$4$ܲD$D$;D$dH L$0T$T$,\$(hp|$ 9C9l$$t$\$|$T$׌D$(L$dA T$$Qe yl$,t$0l.\$\Y9nPQ ,AQY i$9Pw Y i$D$hD$l`ÍPwY i$փtω|$X 3 $\$D$T$ l$躋D$L$T$\$dSe uCʉىÉC|$XΌËD$\Ό؋\$\|$T3$t$L$l$ \$Jt$l$D$dL$0T$,\$(|$TzD$hL$l`x2 q3 蚶e ;al$D$($D$ (QL$D$ D$D$D$D$L$ t$,ӌD$($ EL$D$D$D$(HPX k9nKH ,HPX h$9 Qw X h$D$8D$<$ÍQwX h$փtύ3$T$\$L$ l$ƉD$L$T$\$(Se uC‰؉I{̌D$8L$<$0 te ;a~/ gbe ;axDD$H$D$ /L$D$ D$D$D$YD$ L$ $qD$D$8L$HQ)T$ T$L$T$PT$D$D$8H P@9l$Hu t$0)ʉT$$<|$,Um)! 9H9T$(l$@L5 $D$D$$D$ЌD$,L$HA T$(Qe yl$$t$0l.\$@Y9nPQ ,AQY i$9Pw Y i$D$TD$XDÍPwY i$փtω|$< 3 $\$D$T$ l$섋D$L$T$\$HSe uCʉىÉC|$<njËD$@nj؋\$@D$43$l$t$T$ |$|T$l$D$4t$0|$,}L$TD$XD+ , , ͯhe ;a(D$,$D$ /L$D$ D$D$D$D$ L$ $+oD$D$$L$,Q)T$ T$0$T$4T$D$OD$$BH P@9R$)ȉ!؉D$)ʉT$l$ YD$L$T$,$ں\$D$D$ L$D$VD$,H QXh9nQP  ,HPX h$9 Qw X h$D$8D$<(ÍQwX h$փtύ3$\$L$l$ T$vD$L$T$\$,Se uC‰؉I{SŌ귺L$8D$<() y* 袭e ;atC뵄5^ <>u9}29D$8$)!ݍ)\$t$ӓD$ &  D$8$ L$D$ӓD$Pc Tc 9hD$D$8$דD$ Tc Pc 91D$D$8$דt$$nD$4L$0T$D$\L$`D$dD$h0$L$\L$&D$L$ D$dL$h$D$L$dL$D$ D$jD$L$\$$l$ t$D$lL$pD$tD$x0$L$lL$c&D$L$ D$tL$xݡ$D$L$tL$D$ D$D$L$T$(\$$l$ t$+D$DL$H$s L$D$ `dP|$5L$pL$L$tL$L$dQYi q$9+T$T$lT$ D$$D$(D$,A$Q Å҇Ç tYIuE9sA D$|$8t$V$D$8D$$D$ L$L$xD$|`   }ae ;av,D$HPX$@ u9s DD$t }e ;ae4D$8HPX h$C9;L Ovu11ɺT$Ƅ$DŽ$DŽ$DŽ$$$ĤƄ$$$$DŽ$DŽ$ĤË$Xp@wo9g9_)ы$, l$()!$9wG$)9!T$,t$H3$D$L$舔11ɋT$,\$(l$HL$8D$P3$$D$\$T$ l$6IT$t$D$PL$8$l$(sƄ$DŽ$DŽ$DŽ$$$ĤÅeT$<9Yl$@ӃA99݃ ‰l$@9Ń  Ӄl$@9 Ë$l$@11\m$!D$ L$T$ $L$<ыhp 99Ç!9 ߗ d d 111\$0T$ L$DxHP X$9 l$$l QwOx X$$$D$$$D$0$D$ $D$D$ĤÍQwx X$맃t렉PXp|tlT$<9`9X)ы$| |$$)ևۇ!ڋ$9wO$9t$L\$0D5$T$L$胑$\$0l$$t$L11L$8T$P3$$D$l$\$ |$*F\$t$$L$8T$P$|$$dƄ$$$$$$$$$ĤÍ $1D$ hlP|$T5F !aL$TD$X$QYi q$9*T$`D$dD$hD$lD$pA$Q Å҇Ç tYIuw9ssD$\|$|t$T覍$D$|D$t D$L$ Ƅ$DŽ$DŽ$DŽ$$$Ĥ       oe ;a&`D$dHPX h$9 $D$L$ T$L$d‹iŋA 9ŇÇ9!9 Ɩtnd d Yiq y$^9Vl5uwY y$T$hD$l`ÍuwY y$ރt׉i11듉T$hL$l`Í $.D$ ptP|$5 賋 @L$D$L$dQYi q$9*T$D$ D$$D$(D$,A Q$ÅÇ tYIuL9sHD$|$8t$$D$8D$D$ L$L$hD$l`  } v me ;aD$ $D$D$ L$ D$ D$L$uZD$ $D$L$tD$$D$(D$,L$0ÍPD$$D$ D$(D$,D$0D$$D$(D$,L$0l0e ;aJ0D$4$D$D$ jL$ D$ D$L$D$4L$,X݃p 99Ç!9 ח d d 1ۅ\$ L$,hx |$(9ËT$(9!9 ӄM d d 1ۅ\$L$,hx |$(9ËT$(9!9 ڄ d d 1ۅ$\$[-D$L$T$\$ l$T$(D$4Hpx$P 9 Qw9p x$l$8\$DŽ$DŽ$DŽ$DŽ$$$|ÉT$\$$$$L$L$_D$$$D$$ $$$DŽ$DŽ$|DŽ$DŽ$DŽ$DŽ$$$|ÉXH Pc\$ 9W11O $|$|$(5XB`|$,5_/-D$,D$0 $HPX h$9 L$8D$<L$(L$@D$DD$HH$P Å҇Ç ݕt&X@9D$4|$Tt$,?_$D$TD$ ܇D$ L$DŽ$DŽ$DŽ$DŽ$$$|肽 { t m f Ae ;a_pD$tHPX h$=95 L$X݃p 99Ç!9Ç  d d 1ۅbHXhp$x 9t$t= 9t=9 ʄukL=Qw>X L$H$Hd Ld D$xD$|$$pÍQwX L$H$븃t뱉$虿D$L$D$xD$|$$pÈ\$$D$L$ t"D$xD$|$$pËD$t$L$L$ D$xD$tD$|DŽ$DŽ$pD$xD$|$$pÉXH P(\$911H $D$ |$ 59\ L$ D$$ L$tQYi q$9+T$,D$0D$4D$8D$<A$Q Å҇Ç ݕtYIui9seD$(|$Ht$ [$D$HD$h؇D$L$ D$xD$|$$p  빉 义 ݹ >e ;a{(D$0L$,T$‹iq 99Ç!9Ç ޖufAYID$99)!ىL$4)‰T$8l$J2e ;a,D$0$y~D$L$@^9 0T$49\$8W\$ D$(ST$kl$ދ\$$HHj@x e uy5aOh P e uNX@ @$ 0 e uL$ H L$s3$T$\T$T$@T$L$ D$T$D$L$@땍3$\$|$L$ D$}L$\$D$@l$8t$T|$ T$H3$\$T$L$ |$>\$D$L$x$T$Hl$8t$Tr k d ] V O x&e ;a4D$8$L$D$LL$(DL$49yT$<\$0\$DC K e uMS$D$D$D$D$pED$PD$DD$TD$XD$\@Í{G6몍3$T$e ;a(D$,$D$D$ bL$ D$D$D$D$D$$L$ udD$,HPX$h u\9sXT Qw h X$D$0D$4(ÍQwh X$փtωL$0D$4({ ,e ;a`D$dHPX h$9 I$D$D$dHPX h$d9\ \$l\e |u*\$h\ L$pD$tD$xD$|`ÉD$hύ $'D$ P|$5`O \ٻL$D$L$dQYi q$9\T$D$ D$$D$(D$,A$Q Å҇Ç tYIu\9sXD$|$8t$$D$8D$D$L$ D$pD$tD$xL$|`y y y y *e ;aL(D$,HPX$h *9"L IXH PXi9YX  $D$L$L$,QYi q$9Tu>Qt5-09v)YAi jZe AQY i$H9@PY i$AQY$i 9DtD$0D$4(É $D$,HPX h$9 QwX h$먍QwX h$뒃t닍PwY i$J5<SYi qt$l$\$ $ҋD$L$uL$,A L$0D$4(ÉкL$0D$4(Í3$T$L$\$ l$!ϊD$L$T$\$,Se u C‰{D$ D$$HPX @$9D$@T$ꑇD$ L$L$ D$$$D$"D$ D$D$ D$aD$L$L$0D$4(u u u u u u e ;adD$hHPX h$9   $:D$ |$5k _L$D$L$hQYi q$(9 TT$ D$$D$(D$,D$0A$Q Å҇Ç t&YI9D$|$Yu;D$t%H$L$ D$L$ D$L$` ދ멍|$9;u#e ;av=Yu:D$t$HP$L$T$4HD$ D$#` ދ몍|$9;u#e ;avNYuKD$t5H@$L$D$D$ D$ D$$D$GD$D$(_ ݋뙍|$9;u#e ;avEYuBD$t,H@$L$D$D$D$ D$ D$G+_ $݋뢍|$9;u#e ;avJD$$L$L$D$_eD$ L$ $D$D$@eD$ D$܋e ;avAD$T$9u-JX8uHZ9R @ 9!ȈD$ 11H܋e ;avaD$$L$L$D$dD$ L$Q$D$D$L$ $D$D$YdD$ D$ۋe ;avqD$T$9uZJZhp9t+1Ʉt!H Z 9u@J9D$11$t$L$PL$ D$T$18ۋse ;a*x$$ 0 $D$D$߭D$L$T$ $\$8$l$L1D$4@\$8Ɖl$L9t$4D$$L$ T$HD@$ыD$ HT$\$l$$91t$HύL Ƌe u닉ωÉwT$D\$00$\$H\$D$l$ L$膮t$D$l$HD$ T$D\$0댋$\$@$l$81 FL$8͉ىD$$L$ T$H9Nt$4ߋY9ClE ʋ-e u -E)릉D$,ύED$,-E|$@녍-0,$T$L$D$ \$趭T$D$L$Xl$8t$4|$@ȋL$ y$zD$ HT$\$l$$9Et$HύL e ƅu-Et$4|$@߉@։T$D\$00$\$H\$D$l$ L$t$D$l$HD$ T$D\$0u$$0zD$L$$D$D$L$$$xË$$ $D$T$ ^D$ L$ $ЋD$L$֋e ;a*x$$ 0 $D$D$菩D$L$T$ $\$8$l$L1D$4@\$8Ɖl$L9t$4D$$L$ T$HD@$ыD$ HT$\$l$$91t$HύL Ƌe u닉ωÉwwT$D\$00$\$H\$D$l$ L$6t$D$l$HD$ T$D\$0댋$\$@$l$81 FL$8͉ىD$$L$ T$H9Nt$4ߋY9ClE ʋ-e u -E)릉D$,ύED$,-E|$@녍-0,$T$L$D$ \$fT$D$L$Xl$8t$4|$@ȋL$ y$vD$ HT$\$l$$9Et$HύL e ƅu-Et$4|$@߉։T$D\$00$\$H\$D$l$ L$貨t$D$l$HD$ T$D\$0u$$uD$L$$D$x$ыx$oыXx$[ыx$Gыrx$3ыx$ыx$ ыx$Ћx$Ћ3x$Ћx$ЋMx$Ћx$Ћgx$Ћ$nЋOϋ$]Ћx$IЋ!O :Ћ$)Ћx$ЋIx$Ћx$ϋUx$ϋx$ϋax$ϋx$ϋmx$ϋx$uϋyx$aϋx$ Mϋx$9ϋ x$%ϋx$ϋx$΋x$ ΋#x$$΋$"w|$G3e u I I΋t$|$A Ze ;aXD$lHhT$p$D$L$|tʁ`u |$,1΋ SL$,D$0 ǡ $Jv HT$ T$@D$DD$HL$tL$LL$xL$PL$|L$T P $L$,L$,PL$ T$$$XËD$l@L$p $ЋD$ D$ L$T$T$\$t$\$x\$\$|\$L$ =-D$$D$ $XËD$l@hL$p $D$D$$D$( 6L$$ _ ȉD$("$D$D$$D$D$ D$:D$L$$$X&e D$;A$Hh$$D$$@8$ $ЋD$ L$T$\$$́`C9uC$$$\$L$D$ T$/DŽ$DŽ$ĴD$,D$0 ' $D$T$KD$ L$D$,L$0p$D$D$,D$D$ D$D$L$$$ĴÃ؁ÀՃ҇Çށ! ӄuD$DD$H ' $D$l$;KD$L$ L$DD$H$D$D$DD$D$ D$D$L$$$ĴÍ|$\1:ˋ ^L$\D$`  $r|$|$(50ϋL$(L$pD$tD$x$L$|$$$$ P $L$\L$MLL$T$ $$ĴÃ؁Ճ҇Çށ! ӄuD$<D$@ ' $D$l$ID$L$ L$D$ L$D$\L$`$D$D$\D$D$ D$ D$L$$$ļD$$,D$L$f.u z /$qe|$GWe u# p$$ļÍ μ؉$$ļ2e ;a|$Hh$$D$T x$@8$ $ЋD$L$T$\$ 8$L$WpD$$ʁ`fу $t>$$$D$L$D$ hDŽ$DŽ$|ZZf.u{$c|$GOe u tp$$|Ít@ۃY|$$1 L$$D$( ` $jc 8<\$ S\$8D$<D$@$L$D$L$H$L$L P $L$$L$:=L$ T$$$|Í|$P1z L$PD$T ` $b $\$ S\$dD$hD$l$L$p$L$t$L$x P $L$PL$L$$D$( ǡ $t` ܅T$ T$8D$<D$@L$lL$DL$pL$HL$tL$L P $L$$L$V:L$ T$T$xL$|PËD$l$D$pD$\$T$ L$r D$xD$|PÉD$x\$|PËD$d@hL$h $D$D$D$ 6L$ _ ȉD$  $D$#D$D$D$ D$D$L$D$xL$|Pp+e ;aPL$tʁ`|$$1虷 CL$$D$( `ǡ $^L$d d e uYAL$,D$0D$4D$lD$DD$pD$HD$tD$LP$D$$D$8D$L$ D$xL$|PÍy렋D$l$L$pL$T$}%D$L$ d 9( $D$d D$D$ D$dHhT$h$D$ uhD$d@L$d d e u_AL$4D$8D$<D$tD$LD$xD$PD$|D$TP$D$,D$D$ L$$$XÍyѕ뚋D$t$L$xL$T$GD$L$ d 9" $D$d D$ȆD$ D$lHhT$p$D$ d  6 d e @e d L$D$ D$tlHʃ uɀ@e \$t$\$x\$\$|\$D$ T$L$D$l@@L$p $ЋD$L$$$X111릍=d @e 薔f@e 6UD$l@hL$p $D$D$$D$( 6L$$ _ ȉD$($D$D$$D$D$ D$D$L$$$Xx|Ce ;a pD$4D$8$Hh$$D$M$ʁ`|$D1u L$DD$H `ǡ $;L$@d Dd e uhAL$LD$PD$T$D$d$D$h$D$lP$D$DD$D$L$ $$pÍyԒ둋$$$L$T$DD$L$ @d 9 $D$Dd D$ņD$ $@($ $ЋD$ L$T$\$\$0l$l$t$T$ t$$D$(L$,R$D$ D$?D$L$ d td e u} d D$4L$8D$4t_PӃ uʀ$$$\$$\$D$ L$T$D$$D$0$p111뭍=d ‰hs111돋$@h$ $D$D$<D$@ 6L$< _ ȉD$@$D$,D$D$@BL$L$4|$H1wL$4i@Bхʚ;Ç!Յ Օ#L$T$ ́wL$0|$\)$$$L$0$w$ c $|$\$跊$t$\觊|$H$藊$t$H臊|$p蛅$$tS  ‰Ё€׉$׃ $$%?$DŽ$DŽ$|$p$$t$p手$$D$?D$ L$d t d e d L$8D$ d D$xL$|D$xtPӃ  ʀ111=d ‰(x111$$É$$ÉD$`t$<4$D$ Td L$D$ uD$`L$\T$8\$0l$Tt$<%DŽ$DŽ$É $D$dD$Td T$褪D$ u$$$$$L$$T$l$ D$$$é$+Ç݃$ $\$D$`D$L$ $D$lD$L$ T$$$$l$$t$T$ L$D$Ր$P$h^$|$Ge u ͻͻ*v$$À $@h$ $D$D$L$ $$L$$L$JD$ L$t@DŽ$DŽ$DŽ$DŽ$ 6$T$L_ ډ$$$cQ$D$$D$D$ D$őD$L$$$Ë$$$L$$T$nD$ L$$L$D$L$ T$$$$\$$\$T$ L$D$Ӑ$@H$ $ЋD$L$$$ÉD$PG E$|$j \.e D$;Ab$t |$|1t 0L$|DŽ$ ǡ $L$L$DŽ$DŽ$$$$$$$ P $L$|L$L$ T$$$ĨË$Hh$$D$$$$L$$T$}D$ L$@( $ЋD$L$Hd 9$$$D$$D$2D$L$ tID$tD$xL$tD$x"$D$D$tD$D$ D$‘D$L$$$ĨÉ $D$Ld D$JD$ F$$$L$$T$xD$ L$@( $ЋD$L$Hd 9BD$D` D$DD$D$ $$L$$L$$L$ $L$$L$$L$$\$$l$ 0֋D$(L$$\$0l$4D$ω>\$0D$lT$P 9$T$pT$l$L$ t$|$D$L$pD$lT$P\$0l$@b111B=d ‰=111!DŽ$DŽ$DŽ$$$ČDŽ$DŽ$DŽ$$$ČÉT$<\$\$\$Td D$9pD$ uD$XL$TT$<\$\l$4t$8D$p$D$@$D$D$DŽ$DŽ$ČDŽ$DŽ$DŽ$$$Č$Ue ;a@D$L@L$TL$L$XL$L$P $ЋD$ L$T$\$zT$\RD$(L$,T$8\$`\$e ;aHL$d|$1 L$D$  `ǡ $ņL$Dd @d e uYAL$$D$(D$,D$\D$uT$\quT$\\uT$\ BID$G E$|$\\ ъe ;a.@L$\|$1 &sL$D$ `ǡ $0L$d d e uYAL$D$ D$$D$TD$4D$XD$8D$\D$<$D$D$jD$L$ D$`L$d@ÍyS렋D$T$T$XT$L$WD$L$ d 9( $D$d D$=D$ D$L@LL$P $ЋD$L$L$`D$d@WЊe ;aHL$d|$1 L$D$  `ǡ $L$ԁd Ёd e uYAL$$D$(D$,D$\D$D$L$$́T$D$D$ L$D$L$D$$L$(׳e ;av.6e $u $rd Í=$rd ˊ苳e ;a>p"~$D$@~$D$<  $D$D$!D$D$$L$L$ T$ T$8$D$D$녉D$D$L$ L$4T$T$}$D$0}$D$,}$D$(|$D1)ˊD$@D$DD$|$e  $L$xOL$|O e Wp $G$$GD$$L$$\$8$1*t$`n$$$$$t$\9D l$`$H,l$$$э$$萚$u$$$$T$L$rD$ L$T$ 11ɉ$L$h$$$$l$\$D$ L$T$q 11ɉL$l$X1SL$`$`\$h$t$$x\$l$|$DŽ$DŽ$ DŽ$$DŽ$($Zj [$$g,$Ӎ$$詙L$HL$dT$L$$芙L$dq $$$$X$\$$d$$e$$f$$$@P $ЋD$$H)$$@L $ЋD$L$؁d 9u5 $D$܁d D$ŅD$ t$`$A2$$ $ЋD$L$$~T$D$L$ D$iD$D$$"D$ D$TL$$$:|$D$TGe u/$DŽ$p$$Ë$ё̋$$ $ЋD$L$$~T$D$L$ D$ZD$D$VD$ D$XL$$$9|$D$XGe u/$DŽ$p$$Ë$̃$$$L$$$\$T$ D$L$T$H@ $7L$|1$,؉ʉ$T$x$$,$$\$$$0$,D$l$ 텆D$u$<"ġ$c8D$L$`$@Z\$t$<9t$p$H $l$T$襗$$<D$t$@D$p$D$L$  $$,$0T$\$ 萈|$e $,Ҕ$HQX h9_QPk,| e u"$,蘔L$xAT$|9M4_$|$$,D$賑$č_$l$L$\$ T$KD$L$T$$S e u CʼnW$d_$|$$,D$5$T$p `& $D$D$D$ \$JD$t$L$`T$p\$t$ $A6D$L$`$4P$<DŽ$@DŽ$D*$$ $ЋD$L$$$DŽ$ DŽ$DŽ$DŽ$0$$L$GD$ L$$ $0$$,D$D$ L$$$$D$$ D$D$ D$AݐD$L$DŽ$$$DŽ$$$Ë$$ $ЋD$L$$$DŽ$DŽ$0$$D$+ D$ L$$$A+$D$:$D$D$ D$TܐD$L$DŽ$$$Ë$L$  $$\$X\$T$ ;D$7$L$  $$X$\T$\$ }|$e $X运$HQXh 9PQPe k,< u$X膐v_$|$$XD$貍$M_$\$L$l$ T$GD$L$T$$S e uCË$a$[_$|$$XD$,$$ $ЋD$L$$$DŽ$DŽ$DŽ$DŽ$0$$L$ D$L$ $$0$$XD$ D$L$ $$$D$$D$D$ D$ِD$L$DŽ$$$DŽ$$$ɉȉ‰ȉ5$$`ŋ$$$$$D$`$$D$NE|$ e uC$$$ŋ$$DŽ$DŽ$Ë$?븉׉$+$G$$DŽ$DŽ$3 \pe ;apDŽ$DŽ$DŽ$DŽ$D$PD$TD$XD$\t$xT$tЍt$4|$P3D$HL$DL$L|$`t$P$t$` L$L$$po2e ;avrϥ$=/D$D$ 3 $D$D$'BD$ L$T$|$OW e u`çD$ |$$~nre ;adDŽ$DŽ$DŽ$DŽ$D$hL$l$L$7uD$ D$ L$L$D$$$T$T$D$ ;-D$L$T$D$TD$XD$\D$`u -)$L$ D$D$ bD$D$,L$L$PT$D\$ 1ED$ \$ ʉ9΍ NjA wT‰ˉD$ }TuJ=inliu<Cf=neuD$_롃u=minsuCf=izuCeuD$]vӃΉl$$L$Ltyu=trunuC=cateu D$^@ 7$D$T$D$ tD$\L$Ll$$t$P|$,L$Ll$$t$P|$,T$(\$H$T$D$D$ ND$!D$ L$LT$(\$Hl$$t$P|$,D$ L$LT$(\$Hl$$t$P|$,D$0ЋT$0ډˉЋT$0D$8ЋT$8ډˉЋT$8zT$T\$X$t$TnDŽ$DŽ$dD$`$t$T?DŽ$DŽ$dÉL$T$@$$ $D$D$D$ 9TD$t L$T$@-$$~Uk`e ;av7BD$$D$D$D$ D$ TxD$D$$rje D$;Ae vu e 8+讆wĊ3Z5@n+;‹q7e $^ rd %5$ e 2d 5$ e d g$D$(̊D$L$ hd e  ld d9$D$%̊D$L$ xd e r |d q1$D$%\̊D$ L$ pd e *td E4$ e c e c  c x  $D$\8D$L$ d e  d |  $D$"8D$ L$ d e >d  @ $D$7D$ L$ d e d   $D$7D$ L$ d e d   $D$t7D$L$ d e ^ d   $D$:7D$L$ d e  d   $D$7D$L$ d e  d   $D$6D$L$ Ѐd e z Ԁd  @ $D$6D$L$ ؀d e . ܀d   $D$R6D$L$ d e  d   $D$6D$L$ Ȁd e  ̀d  Ü $D$5D$L$ d e J d  Ĝ $D$5D$L$ d e  d  @ $D$j5D$L$ d e  Ād c ; $ _ ȉD$'5D$L$ d e ] d `B$D$4D$L$ Xd e  \d B$D$4D$L$ `d e  dd `&$D$y4D$L$ hd e y ld c `' $ _ ȉD$64D$L$ d e $ d &$fcD$3D$L$ pd e  td &$D$3D$L$ xd e  |d  '$D$3D$L$ d e @ d 0$D$N3D$L$ ؁d e  ܁d $1y|  $$L$L$T$ $T$2L$D$ d e  d 2$D$2D$L$ d e ; d c 3 $_ ЉD$t2D$L$  d e  $d 2$hcD$:2D$L$ d e  d  3$D$2D$L$ d e N d `3$(D$1D$L$ d e  d ą @ $D$1D$L$ @( $ЋD$L$Pd e  Td $D$B1D$L$ d e Z d  c 3 $ _ ȉD$0D$L$ d e  d $1z  $$L$fL$T$ $T$0L$D$ d e  d @$0D$h0D$L$ d e L d ȅ X $D$.0D$L$ @( $ЋD$L$8d e  D$ L$L$DD$H$>e ;avY$BD$($D$,D$D$0D$D$4D$ D$8D$D$e ;avY$BD$($D$,D$D$0D$D$4D$ D$8D$D$D$ L$L$HD$L$趖 z|$(9;u#e ;avj$YujD$(tQD$,$D$0D$D$4D$D$8D$ D$Yu;D$t%@ $D$+MD$L$ D$L$҃ 멍|$9;u#e ;av>Yu;D$t%@ $D$+LD$L$ D$L$b [멍|$9;u#e ;av8 Yu5D$t$LD$L$D$L$  믍|$9;uÉ#e ;avBD$$L$L$AD$L$ $D$D$D$ D$e ;aviD$HT$Z*09t11Ʉu 1D$ÃD$B$D$+>D$ ׉,$t$\$>L$ D$T${e ;atYDŽ$DŽ$DŽ$DŽ$D$xD$TD$XD$\D$`D$x$|$t$|l t$8|$TD$LL$HL$P|$dt$T$t$dL$P$$t  |$x9;$#e ;av94Yu6t$8t 'D$0L$,L$111[L$D$0L$ T$$\$(l$,L$HT$L\$Pl$TD$X4He ;aF(D$LD$PD$TD$XD$\ϥ$Q|$D$8GD$D$D$  $ D$ L$ $ d d L$T$ pL$ D$c>Í$|$G3e u  7t$|$Uw Ie ;ax$|$L1 ûL$LD$P `ǡ $ d L$d e uhAL$TD$XD$\$D$l$D$p$D$t$D$LD$ㅅD$L$ $$xÍy1둋$$$T$L$rD$L$ d 9 $D$ d D$6D$ $$$D$$D$3ID$ D$ t$|$81D$ @9uk|$8c|$$t$8V$$$D$D$$D$D$(L$,T$0D$ L$T$}D$L$$$xÉ$L$'D$ e ;avhD$ D$$$ʁ`|$<1 ûL$D$dD$D$ D$+L$LH$d  d e $d L$\T$`L$\Y݃ uˀ݃D$X $T$l$$D$D$DL$L$TT$ T$P$L$D$X$T$ \$ $T$\$ 3D$ L$T$\$t$$xË@$Z*r Rl$\$T$ t$ T$T$XT$T$PT$T$TT$ T$DT$$ $ЋD$,L$($$xÉL$lT$pl$tD$dD$h 9$D$lD$gD$ L$L$dD$h@B$D$>D$dD$D$ D$8D$L$$$x111k=d ‹$Ћ$$1112xD$LxD$H|4d 0d $$xK ω_e ;avI,|$t$0D$L$T$ \$$$L$T$\$ IQD$L$L$DD$H,`ωe ;av6<$t$$u D$,Àtv1ωe ;avI,|$t$0<D$L$T$ \$$$L$T$\$ iSD$L$L$DD$H,Ήe ;avI,|$t$0D$L$T$ \$$$L$T$\$ IgD$L$L$DD$H,0Ήe ;avE,|$t$0\D$L$T$ \$$$L$T$\$ iD$D$D,͉e ;avN0|$t$4D$L$ T$$\$($L$T$\$ jD$D$D$HD$P0[͉e ;avI,|$t$0D$L$T$ \$$$L$T$\$ jD$L$L$DD$H,̉e ;avR0|$t$4D$L$ T$$\$($L$T$\$ kD$L$T$T$HD$LL$P0w̉e ;avQ0|$t$4D$L$ T$(\$$$L$\$T$ kD$L$T$T$HD$LL$P0̉e ;avZ4|$ t$8<D$ L$$T$,\$($L$\$T$ lD$L$T$\$\$LL$PD$TT$X4ˉe ;avQ0|$t$4D$L$ T$(\$$$L$\$T$ lD$L$T$T$HD$LL$P0ˉe ;avZ4|$ t$8LD$ L$$T$,\$($L$\$T$ mD$L$T$\$\$LL$PD$TT$X4ʉe ;avZ4|$ t$8D$ L$$T$(\$,$L$T$\$ mD$L$T$\$\$LL$PD$TT$X4ʉe ;ave8|$$t$ËD$bΉO ω‹D$(PΉ믍Oω‹D$0:Ήp=É $T$'D$K 茶e ;av'$=vD$ @߰L$ D$Be ;av'`$uD$ ߰L$ D$e D$;Are vĴu5 e h3v J/51+یve $ rd ze $ rd "%$D$ D$ L$ 8d e y <d 7$D$D$L$ Hd e / Ld _$D$}D$ L$ 0d e  4d d$D$ED$L$ @d e  Dd $1̉ @ $$L$KL$ T$$L$XD$ L$ d e 0  d I$D$D$ L$ d e  d 7 e L$ rd D$XD$\D$`D$d@e$D$XD$WJD$L$ $L$蓂D$L$ Xd e 7 \d c ; $ _ ȉD$PD$L$ `d e  dd D$HD$LD$PD$Te$D$HD$ID$L$ $L$䁎D$L$ hd e d ld |$x1ˉ R $L$xL$QIL$T$ $T$荁L$D$ xd e  |d D$ D$$D$(D$,R$D$ D$KD$L$ $L$!D$L$ d e  d $qD$D$t$$t(SpD$L$T$T$(D$,L$0  ȗ릍|$$9;u#e ;avJ$YuGt$(t1㴉pD$L$T$\$ T$,D$0L$4\$8$V O띍|$(9;u#e ;avJ$YuGt$(t1sD$L$ T$\$\$,T$0D$4L$8$ ߖ띍|$(9;u#e ;avU(YuRt$,t<D$L$ T$\$l$$\$0T$4D$8L$ 7륍|$$9;u#e ;av9Yu6t$ t S`D$L$L$$D$( Б뮍|$ 9;u‰#e ;avI$YuFt$(t0D$ L$T$\$T$,L$0\$4D$8$g `랍|$(9;u#e ;avR(YuOt$,t9胮D$ L$T$\$$l$T$0L$4l$8D$<\$@( 琉땍|$,9;u#e ;avA Yu>t$$t(0D$L$T$T$(D$,L$0  x릍|$$9;u#e ;avJ$YuGt$(t1蓭0D$L$T$\$ T$,D$0L$4\$8$ 띍|$(9;u#e ;av5Yu2t$ t#D$D$$ 褏벍|$ 9;uƉ#e ;av> Yu;t$$t%ìD$D$D$(D$0 B ;멍|$$9;u#e ;av?,Yu 7륍|$$9;u#e ;av2Yu/t$tS蠽D$D$  ׌뵍|$9;uɉ#e ;av9Yu6t$ t D$L$L$$D$(w p뮍|$ 9;u‰#e ;avB Yu?t$$t)蓩D$L$T$L$(D$,T$0  륍|$$9;u#e ;av[,YuXD$4D$8D$<t$0t* t$|$ |$4t$ ,  ~댍|$09;u#e ;avqu\9u\D$$D$=D$(D$D$ D$.ߏD$L$L$PD$T8D$ D$$L$u 9PXD11ɅL$DPnd|$T1y 9|$ht$DA|$Tt$h49t+$x5$D$D$\ËL$`AL$`$lL$T$pL$X$tL$\|$|t$Tȇ$x5`蘇$D$|D$XD$L$ $$\Í|$h蝂:J$x$CDŽ$DŽ$\ÉL$P$<1LL$P $\$T$$tQ$lT$ $prt$\$ t$$<轆L$t$L3$|$l$L$ \$6|$L$D$4T$<\$8l$@t$LT$33$$T$\$L$ l$}6|$D$L$hD$4T$3\$@t$H8Љʉ3$$l$D$T$ L$(6\$D$T$H$=h݆ a݆ Z݆ S݆ Lކ Eކ >ކ gae D$;A$$$$L$$T$D$ L$$$$D$$D$'D$L$T$ \$AL$,|$p1*yL$,q1 l$T ˉT$T\$@D$LJL$0jl$4$L$l$iD$ L$T$\$l$p,$D$L$T$ \$\D$L$$L$PPT$8X\$9$h@$\9L$XD$ D$T$X1&D$Dh$\L$XT$T$XЋ$\9}VXl$D4+$yL$Xt ty獴$fyQD$@uƄ$lTƄ$lTƄ$lTƄ$lTøD$L$14t$t$$p $$$\D$D$P$X1 l$TU ÉT$T\$H$x$$~x`#$$L$$$L$l$ kD$|$t1xs `: $T$LT$$$l$\$ ht$D$|$tx|$\t$txtxt$\w|$P$wD$0t@D$H@$\9$L$Lt 9PƄ$lT1Ƅ$lTƄ$lTø=$X$lTՆ Ye D$;A  $D$D$lL$L $ wdL$D$lbD$L$ T$\$l$L$D$T$ x$$1\$p ى‹$L$pT$($vv|$|$fv$t$|NvD$tD$xS$$L$D$L$ D$tL$x$L$lL$T$D$ \$t\$D$D$蕾D$(@$9#D$l$D$}D$ltWH X@9$)ȉ!ЉD$)ˉ\$l$ _D$L$$$Í귺ލD$,$ĝD$D$`D$L$T$ \$l$T$L$D$ Ԇ We ;avWe ;a4D$@$z?D$L$$T$D$T$8T$ T$u9HPD11ɅQndL$D|$P1Ei \$D9|$d n|$Pt$dm9t'$5m$$ĨËL$\AL$\$L$P$L$T$L$X|$xt$Pm$5fm$D$xD$&D$ L$$$ĨÍ|$dkh>‰L$$(mDŽ$DŽ$ĨÉL$H$1h$T$L$HL$$Q$T$ $rt$\$t$$lD$9$IL$8\$L$14[$p[$p$W $$L$8D$L1 \$H ‰؉D$HT$<$ _$$ _ `# $$\$$$\$l$ RD$$1Z `: $$T$$$l$\$ Ot$D$$_$$_t{獴$^|$P$^D$0t@D$<@L$89$$t 9*Ƅ$ļ1Ƅ$ļƄ$ļƄ$ļù-u$$ļ@e D$;Am $D$D$pL$L $ wdL$D$LID$L$ T$\$p$L$D$T$ Xy$1X `: $$L$$L$$1XL$l$$$t$|@]D$tD$x S $$T$քL$T$ L$tT$x  $T$pT$\$D$ l$tl$D$D$s$ $1$$$\$Q L$l|$|$t\T$(D$,$ĝD$D$GD$L$T$ \$p$T$L$D$ wT$(D$p$D$}(}D$ptSH X@9wQ$)ȉ!ЉD$)ˉ\$l$ ED$L$$$Í귺 D>oe ;av>e ;aD$ |` $D$ %L$ $ d d T$L$ L$ D$3D$D$ `  $mD$ P&L$ $ d d T$L$ L$ D$D$D$ `  $D$ &L$ $ ,d (d T$L$ L$ D$蓋D$D$ `  $D$ P'L$ $ d d T$L$ L$ D$CD$D$ `  $}D$ 'L$ $ d d T$L$ pL$ D$ӍD$D$ `  $-D$ `(L$ $ d d T$L$ pL$ D$胍D$D$ `  $D$ (L$ $ ,d (d T$L$ pL$ D$3D$D$ `  $D$ )L$ $ d d T$L$ pL$ D$Í$A|$G3e u  Rt$|$ņ ; e ;a`L$||$41US ZL$4D$8 `ǡ $L$d d e u_AL$D$8@L$49bD$0@L$@ $ЋD$L$$$ĬÉ$$ĬÉ$$ĬÉ$$ĬtL$ƒB$@L$ $ЋD$L$$$ĬË$벃u$ƒ뢍^$|$Ge u ͻ ͻ IPt볋D$d L$DD$HL$DtQӃ Gʀ<1111=d D111$$ĜÉ$$ĜÉD$8L$( $D$Ld T$wD$ uD$8L$(T$4\$$DŽ$DŽ$Ĝ$(Ç݃@ d d $D$D$D$ D$L$T$$$$l$$t$D$ T$L$ݢ$$ku$0Ç݃X^$|$Ge u ͻ5ͻLC(hPt볉$$ĜËD$0G E$|$9 +Me ;axTL$p|$(1C =L$(D$, `ǡ $L$d d e uYAL$0D$4D$8D$hD$HD$lD$LD$pD$P$D$(D$ĄD$ L$L$tD$xTÍy#B렋D$h$T$lT$L$虱D$ L$d 9($L$d D$ uD$ D$pD$$*Pt}D$h$D$lD$L$d d L$ D$zƎD$L$T$\$X$\$\\$\$`\$\$d\$ T$L$D$D$ L$L$tD$xTt:D$lƒeD$`@LL$d $ЋD$L$L$tD$xTËD$lăuD$lƒ뷍^$|$Ge u ͻ ͻ@Pt볋D$$G E$|$蔳 (he D$;Az|$pA$ʁ`$1@ &$DŽ$ `ǡ $3L$d d e A$DŽ$DŽ$$$$$$$P$$D$D$L$ $ $Íy+?v$$$L$T$蘮D$L$ d 9 $D$d D$ rD$ $D$HPk$$$T$L$D$ 袎$@,$ $ЋD$L$ T$\$?T$`\$D11ɍl$,T$`\$DD$@L$$ $$\$$\$$\$ l$l$Tl$T$t$T$xT$ J L$(T$$^$t$x*CS$$L$衼D$ L$d t d e d L$pD$tL$pQӃ uʀ\$09H$ R@D$L$$$$ҋD$ L$m$$@$$L$HD$D$ D$L$u$d$(:$d$$d$$t>09@$ R\L$D$$$$ҋD$ L$}$$@1($$L$HD$D$ L$D$u$$(S$V$$e9"HPX -9$ R +l$dst$([\$,D$L$$$$ҋD$ L$T$\$t ىu$$$T$D$L$ D$dD$D$(D$D$,D$D$L$ -uR$l$(U$l$ @8$mL$$$ $ЋD$L$ u]$|$($|$ @`$$}L$T$$$ $ЋD$ L$k獴$(蝚$ @0$|$$HD$8$$À  $@P$ $ЋD$L$T$ \$l$t$L$8$1$@L$8$D$H$L$0Ƅ$0 S $$@L$wL$ T$$@$D$$0'$ e u$0$|$$D$x$$Ë$@ $ $ЋD$L$L$$D$42$D$0&$D$,  $1|$e L$DL$@OL$ OL$$O e L$ 9DŽ$DŽ$DŽ$$$9| PX$$$ $$D$fD$ L$$$lÍ 7$@e $lÀ$|$p$|m $$@99 HX$$$$$D$5fD$ L$$$lƄ$DŽ$DŽ$DŽ$$$@e9 HXh $$$$$$D$XcD$ L$$$lÀ$L$pD$ D$$D$($Lu D$,D$0D$4$Mt$,9t4$D$D$ `|$ t$,E|$8t$ 8$D$8D$PeD$L$ $$lÍ`7$@e $lÀuX$$p$- $ ;$ _ ȉ$lÀ uN獴$pVZD$L$ '$D$L$bD$ L$$$lÍ 7$@e $lÀ  DŽ$DŽ$DŽ$DŽ$ $$ S9 HXh $$$$ $$D$`D$L$ $$lÍ$ 1T$$ R9q$ $$ D$n`D$L$ $$lÀ $ $p$  $4$ $D$HtH09IID$\L$`$D$\D$aD$L$ $$lÍ$5$5@$$6L$HD$D$ ЇD$L$0e$$p$$$$$tH09@L$TD$X$D$TD$`D$L$ $$lÍ$$@XOF$$L$HD$D$ χL$D$0eDŽ$DŽ$DŽ$DŽ$$$e9HXh $$$$$$D$]D$L$ $$lÀuZ$<$p$<$= & $D$G^D$L$ $$lÀue$T$p$T$Y$U@f$D$L$=^D$ L$$$lÉ獴$pVMjD$L$ '$D$L$]D$ L$$$lÀ$d$p$d$x$tR9HX hD$Dl$HL$L\$P$D$DD$^D$L$ $$lÀt*6$@e $lÍ6$@e $lÉ $T$'D$Y D$lD$pD$tD$lD$p$dD$t@i$D$lD$I[D$L$ $L$O D$xD$|Ƅ$ۻD$xD$|$T$@i$D$xD$ZD$L$ $L$N DŽ$DŽ$Ƅ$$DŽ$$<$@i$$D$pZD$L$ $L$u59u+B R $T$D$SD$ \$L$T$봋$($,$0띀un$$e׈$$$@9aHP$T$L$ 8\$ L$D$T$"$$ֈ$$$@e9gAQY  $(,$$,l$$0l$L$ D$T$\$T$D$ L$$\$/u$0$,$(\$/^$$3ֈDŽ$DŽ$DŽ$$*DŽ$DŽ$DŽ$ $$9t4$L$D$ ׈$$Ո$$$Ո$$$Ո$,H L$0$09wX$(y9q$T$\؉$$D$D$ S׈L$\D$0$\$/&3$$(\$D$T$ L$\$T$$,L$0r $L$Ԉ$LR$Mus$,Q$09$(D ىЉ\$/~3$$(D$L$\$ T$]l$D$\$PD$/$,멋$,Q$09$(D 닍3$$(D$L$\$ T$l$D$\$PD$/$,뷀 t$0$,$(\$/獴$ӈ4FD$$L$L$|$,Z  $ Nj$09$$($$l$|$D$DL$DDDD؉\$/$$ 3 $$(L$T$D$ \$衉D$L$T$Y$$$$$Ћ$,*$ K O$$҈$ @$$ S9 AQY $p,$L$D$8D$ D$T$\$D$D$ D$(L$$$,\$<$09wM$(9$l$T$L$D$yӈL$TD$<$\$/L$$3$$(D$T$l$ \$l$t$$$$,\$T$L$D$/$$Ȉ$$$e9Q Yi 59P$$BJ$L$D$ ED$L$T$ $($$,\$$0\$$\$ $\$T$L$D$L$(D$$T$ \$/0D$$Lj$$$,Z$095$( LDL؉\$/$3$$(D$T$l$ \$~t$D$l$XD$/$$,낀$$%Lj$$!$$$,k$09m$(U9 /Љ\$/$3$|$l$t$ T$}|$D$t$PD$/$$뤉$3$$(L$\$t$ l$m}|$D$t$hD$/$$$,@獴$ƈ MD$D$xL$$$,Z ȉ$  Nj$09$$($$t$x$LD$D$DDDD؉\$/V$$ 3 $$(L$T$D$ \$'|D$L$T$Y$$$$$Ћ$,*$$Ĉ$$$R9AQ Y $(,$$,l$$0l$L$ D$\$T$T$L$$D$ \$/Du$0$,$(\$/ $0$,$(\$/$L$)1 $\$'D$; DŽ$DŽ$Ƅ$$DŽ$$$@i$$D$$` dD$$8{DŽ$<DŽ$@ 6$< _ ȉ$@$D$$<D$D$ D$D$L$111t$p$tXÅu狄$d$$hD$$lD$\$ l$t$=t$$4胻0$$4D$D8D$ L$냋$d$$hL$$lT$D$ D$CL$L$pT$T$l\$$ l$t$ $L1E$T9Ƅ$T$%$U$U$V9t$t$l$켈$$T譺$$蚺$L$臺e u0$\$LjT$C11$ l$lt$pN0$$\D$$LD$E뽽B$T$X0$$TD$25D$L$ $d$h$d$$hL$$lT$RD$ D$ D$CL$$ T$T$l\$\$p$!$$8oe u0$\$RT$C11$ l$lt$p60$$\D$$D$-뽀0$D$D${nD$L$T$ $\$`$d$d$$hL$$lT$D$$D$CL$ L$pT$T$l\$$ l$t$|$ $\$$`D$|$t$ l$^D$$L$$,$\$`$d$1-$57뷈 e u5$\$ηT$C$,$ l$lt$p0$$\D$$D$褴$뱉$t$x$|$脲Ƅ$ @ $$tL$2L$T$ $$$$$$d$$hL$$lT$D$ D$BL$(L$CT$$T$p\$ \$ll$$ t$|$$L$$0$1贱Ƅ$DŽ$DŽ$DŽ$L$B$$0$$$$$PƄ$@e$$D$/D$ L$$$$$ൈe u0$\$õT$C11$ l$lt$p0$$\D$$D$螲뽋$d$$hL$$lT$D$$D$CL$ L$pT$T$l\$$ l$t$|$ <$t$l$ D$$,L$$T$\$ l$$$$$$T$3D$L$ $L$$$8褴e u:$\$致T$C$$,$ l$lt$pa0$$\D$$D$X변uw$ 1D$ 57 e u'$\$ ﳈ111110$$\D$$ D$ӰDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$h -$5ho1ɋ$l$dL$?\$TT$L$ $$7$$$$$$d1 $$Ƅ$$$%$9t $T$D$ մ$d$$薲e u0$\$dyT$?11$ l$Lt$T]0$$\D$$dD$TDŽ$DŽ$DŽ$$l $$d9t4$l$D$ $$걈$lY $d,$h΃ÉʉS@$h11틴$l$d$$\1v$ljƄ$ltƄ$m$\$l e u+$\$\1ɋ$1׉D$>$T$H0$$\D$$\D$ͭ$T$Hl$>롋$lpۇ$d|5uÇލB‹$h؉Ƌ$h $he111$d$lD$`Љ$$1%$Ƅ$ $$ $ $ $$$$$$$]$$J$$7 e u+$\$11Ջt$`ڋ$\$@T$D0$$\D$$D$T$D\$@뱋$d0h h h$  ߋ$ X XxH   ݋$lYÍJЉʉ|$`$\߻$1J$58 e u'$\$111110$$\D$$D$٪ƀ[  O$d$$hL$$lT$D$$D$pL$ L$lT$$ \$(\$Cl$t$ |$|$tD$$$$1T$$$$$L$t$$!Ƅ$  S$$D$V&D$ L$$$$$豬e u0$\$蔬T$C11$ l$lt$px0$$\D$$D$oDŽ$DŽ$DŽ$$d$$hL$$lT$D$D$xL$ $(t$$L$(L$pT$$T$l\$ $ l$,D$C$$ͫ$$身$1账$試$($L$x$$$t$$M$t]Ƅ$t  R$$D$$D$ L$$$$$te u0$\$ЪT$C11$ l$lt$p0$$\D$$D$諧뽀 $d$$hL$$lT$D$D$pL$L$lT$ \$ \$Cl$$ t$$|1B$6Ƅ$$"$$$9t$T$t$髈$$誩$D$藩$|$D脩e u0$\$|gT$C11$ l$lt$pK0$$\D$$|D$B뽾B$D$H0$$DD$/$D$ L$$$$d$$hL$$lT$?D$$D$lL$ $ T$\$l$t$,D$C|$(|$pD$$L$ $4,$\$T$D$$L$T$\$ l$$,$h$l$p  $$hL$'D$ L$L$h$D1L$htI$4$$$$$$,ԢƄ$, e $$L$ !L$ T$$<$@$D$,d e u:$\$DGT$C$$,$ l$lt$p!0$$\D$$DD$볋$d$$hL$$lT$D$D$pL$ L$CT$T$l\$$ l$t$ $t1$赡Ƅ$ $衡$$$9t$t$l$h$$)$\$$t$\e u0$\$t楈T$C11$ l$lt$p0$$\D$$tD$뽽B$L$P0$$LD$ D$ L$$$7$hЋ$d$l11D$=$13$<'Ƅ$<$=$>$?$@$$<蹤 e u%$\$蜤11T$=$T$Pl$X0$$\D$$D$sT$P$l$X몋$d0$lkۇōZЉډ3$huЋ$l$d111D$AЉ|$|$1히$ឈƄ$$4͞$ЋT$| $ ϗ$ ֖$$$$$$4$!$$4$$ e u'$\$ޢT$A1ɉމ1\$\$$0$$\D$$D$谟$\$\$뢋$dpxX$( ݉  $  X Xh  X ߋ$lk$ۇōZЉ$L$Aڋ$$$d$$hL$$lT$)D$$ L$ L$dT$\$ l$t$$,1衜$蕜Ƅ$$D$d$$,$@ e u)$\$,#1ɋ$ 1\$Cl$p$0$$\D$$,D$$\$Cl$p륀uw$1қ$5P8蚠 e u'$\$}11111j0$$\D$$D$aƀ$1R$508 e u'$\$111110$$\D$$D$ᜄƋ$d$$hL$$lT$D$ D$lL$$ T$\$ l$t$(D$C|$$D$$D$p$1y$$$$$$JƄ$R$$D$OD$ L$$ $$$ڞe u0$\$轞T$C11$ l$lt$p0$$\D$$D$蘛뽍$@|$Ge u#`p$p$tXÍ`U ǀe ;avD$uD$ ÈD$蕀e ;av@<$t$Ý$u u D$4ÀtvD$49e ;a,D$0D$1D$2D$L$1T$4\$3l$8l$t$7|$6l$5  ˉ ډT$T$    D$ ʼnl$D$D$H,D$ D$$D$(ğD$ D$$D$0D$(@i$D$ D$ D$L$ $L$  !e ;aD$tWD$,D$4ÍD$D$L$L$T$\$l$,$t$|$l$ ȉ É ډT$T$    $ ʼnl$ D$D$,D$4L~7e ;a<D$@|$$t$@`D$8L$4t09u`@L$XD$\<ÍD$%D$%@|5r0w+$L$&L$HD$D$ 'L$D$h $T$'D$ D$D$D$ fD$D$D$@D$ @i$D$D$D$ L$ $D$ }e ;a0D$4|$t$40D$,L$(t 09u~@L$LD$PD$T0ÍD$D$@|NrIwD$L$L$HD$D$ L$D$D$LD$PD$T0 $T$'D$b +|e D$;A$$9jr؍`:9D$0l$$t$($1 $T$$L$EWD$(L$0T$$$$YD$(L$,T$$$D$(L$0$|$L虘$IL$ |$4t$L||$d1蕓\$dL$ L$h|$lt$4XJ\$(9Nl$0l$,L$$\$(|e ut$dCS$|$D$dD$ $T$$S$l$0l$T$\$ L$Nl$D$\$H1T$$v$$$ĴÉ$$$ĴûC $\$'D$9 ze ;a.|$$`:9-9D$KL$1L$ Y `:ŋD$\$ l$|$\視|$QID$(T$,L$0D$4 D$(D$,D$0D$4 É$T$'D$+  toe ;aD$ uJD$0L$4@e9u AQY  L$8D$u 9u|D$HP@t D$T(ÉL$$T$D$@Ѩ$D$LD$D$PD$D$t)D$$$D$D$D$D$0D$D$T(D$T(ù|T$ @Ѩ$D$LD$D$PD$TD$L$T$ t!L$ $T$D$D$ D$T(D$T(úD$LD$T(@e ;a(e v(u e ¼ qHh#辮f$DjM`G@$D$ D$L$ d e  d \y$D$¢D$L$ d e  d $D$D$L$ d e  d  `: $D$D$L$  d e 6 $d @$D$D$L$ d e  d |$1W 0 $L$L$ՃL$T$ $T$-L$D$ (d e ,d $D$ D$L$ d e u> d j۔e L$u 0rd e (Í=0rd U=d U빍=,d Us= d U =$d U=d Ur=d U&=d U=*e ;avY$BD$($D$,D$D$0D$D$4D$ D$8D$D$t$(t(U0D$L$ T$T$,D$0L$4$_ X8릍|$(9;u#e ;avJ(YuGt$,t1iUD$L$ T$\$$T$0D$4L$8\$<(湃 7띍|$,9;u#e ;avJ(YuGt$,t1TD$ L$$T$\$\$0T$4D$8L$<(v o7띍|$,9;u#e ;avU,YuRt$0tt$(t(ND$L$ T$T$,D$0L$4$o h1릍|$(9;u#e ;avJ(YuGt$,t1yN@D$L$ T$\$$T$0D$4L$8\$<( 0띍|$,9;u#e ;av5 Yu2t$$t N耰D$D$( 蛲 0벍|$$9;uƉ#e ;av>$Yu;t$(t%M@D$D$ D$,D$4$2 +0멍|$(9;u#e ;av?4Yu 7,륍|$(9;u#e ;av1Yu.t$ tII萴D$D$$߭ +붍|$ 9;uʉ#e ;av: Yu7t$$t!HD$L$D$(L$, v o+뭍|$$9;u#e ;avt 7(뵍|$ 9;uɉ#e ;av[0YuXD$8D$<D$@t$4t*1EHt$|$$=E|$8t$$0E0赩 '댍|$49;u#e ;avq@YuqD$HD$LD$Pt$Dt@D踵t$|$(DD$$|$4t$(D|$Ht$4DD$T@ 's|$D9;u#e ;avI(YuFt$,t0)D萿D$$L$T$ \$\$0L$4T$8D$<(觨 &랍|$,9;u#e ;avT,YuQt$0t;CD$$L$T$ \$l$(\$4L$8T$0w p!뾍|$9;u҉#e ;av2Yu/t$ t>pD$D$$ !뵍|$ 9;uɉ#e ;av9 Yu6t$$t )>ND$L$L$(D$, 跢 뮍|$$9;u‰#e ;av: D$$L$L$gaD$L$ $D$D$D$ O e ;avaD$H\$+s9t)1Ʉu 1D$ÍK $D$D$߉,$T$t$]L$ D$\$e ;av?DYu/L$8$$|㓃 '$9;<#5e ;adY|$x1 *L$htx|$4)L$h $L$lL$L$pL$L$tL$ 誽t$|$4.L$(L$0T$,|$Lt$4.|$xt$L{.L$0$$d  @|$h9;X#Qe ;avOYuLD$t6$D$L$T$\$ l$l$ T$$\$(L$,D$0聒 z똍|$9;u#e ;avZYuWD$ tA$D$L$T$ \$l$t$D$$l$(T$,\$0L$4D$8 덍|$ 9;u#e ;av7 Yu4D$t$D$L$L$D$ 虑 밍|$9;uĉ#e ;av'Yu$D$t$"I B|$9;uԉ#e ;avVYuSD$ t=HP$T$L$D$$D$ D$(D$D$,D$lD$D$0ʐ 둍|$ 9;u#e ;avf$YucD$(tMHP$L$T$贌D$ L$T$\$l$t$ D$,L$0T$4\$8l$D$L$ $D$>D$D$ e ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$U;D$ 1݉4$T$l$:;L$ D$\$&qe ;av^ Yu[D$$tEHP$T$L$D$(D$ D$,D$D$0D$D$4D$D$D$8 ~ 뉍|$$9;u#e ;avVYuSD$ t=HP$T$L$D$$D$ D$(D$D$,D$|D$D$0*~ #둍|$ 9;u#e ;av0$D$ D$D$$D$D$(D$ D$D$,e ;a-$yD$L$H L$ ugD$1\$ SD$L$ 9}4T$ L$$+ՋD$L$tD$(L$,D$0ÉD$(D$,D$0ËԂd Ђd D$(L$,D$0ËL$ p"e ;avD$P@L$T$ D$e ;av D$@ D$|e ;avD$HP @T$L$ D$?e ;ae vuPy e r*f$D$(\D$L$ Ȃd e uT ̂d ҽ$D$0N\D$L$ Ђd e u Ԃd e Í=Ԃd =̂d Re ;avJ Ů$D$D$ 1L$\$$*ՋD$HD$ \$9|ۉD$ e ;av ND$e ;av3/$]D$ yL$ HL$HD$Ve D$;A $$ D$~ $H_ Z\u-091 i1qS`&9 ?$3$D$D$D$ D$ˆD$L$L$|T$Y9! 9 -R݈\ݍi9RDM9$(\(ވ\(\($kt[i9l$(M93|9t5Gވ(ލu9DN9~0k[ ÇޅۇÇ!Ç ÇޅۇÇ uJ܂d ؂d Ƅ$DŽ$DŽ$DŽ$$$Đ$D$D$D$ L$T$'D$ L$T$Ƅ$$$$DŽ$DŽ$ĐÉT$h$L$D$l$D$@BD$ ćD$D$4L$L$8T$DZl$h9$\$$ST$@9;9=6:<TS 9D3Z ȉD$xD$4 |$4 9M|$4L|$xDD|$8DDDDى)L$tT$D$Yu;D$t%H$L$+D$L$ D$L$Rd K멍|$9;u#e ;av>Yu;D$t%H$L$[D$L$ D$L$c 멍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$rc k멍|$9;u#e ;avD$ L$L$D$ (e ;av9e vuJ` e * e e ;avJD$$L$L$D$iD$ L$ $D$D$hD$ D$_e ;av4D$T$8uJX9u@J9D$ 11e ;avBD$$L$L$D$OhD$ L$ $D$ D$D$߇e ;avVD$T$9u?JX9u1H @Z R9t 1D$É$D$\$GD$ 113߇e ;av9 Yu6t$$t YD$L$L$(D$, ` އ뮍|$$9;u‰#e ;avBD$$L$L$D$gD$ L$ $D$h#D$D$wއe ;avJD$T$8u1JRX@9t 1D$É$L$\$'D$ 1އe ;avBD$$L$L$D$L$ $D$D$ 8fD$ D$݇e ;avwD$HT$Z*09t?1Ʉt5HZ9Z h 9!˄t@J8D$11,$t$\$&L$ D$T$݇me ;avBD$$L$L$D$OeD$ L$ $D$!D$D$܇e ;avZD$P\$k9‹+9!ʄt1K SX @9t 1D$É$L$\$%D$ 1/܇e ;aviD$ t@|D$$D$(Í!$D$8D$D$ D$CD$L$D$$L$(ۇ{e ;aviD$ t@|D$$D$(Í $D$6D$D$ D$)CD$L$D$$L$(ۇ{e $h;A}$1!$$$L$uL$ L$(T$T$4蠬|$L|$81L$LT$PtD  ȁ׉L$T׃ T$XD$L%?D$LD$PD$\|$8t$L{$$D$ L$L$0T$|$`5 $L$`$ \$dl$4$l$($$Dދ$H$@L$tl$x\$|$$L$t$8$$l$$$$$$$$ދ$$ $$$$$$$$$$L$0$$$$u$$$$$`D$($\L$,1\$$SD$(L$,9T$$ыX$\$$$$Yl$ t$9*Y$\+<ʋ e u7댉|냉l$ t$4-@,$T$L$D$ \$DT$L$D$$$l$ t$4댋$D$($L$,1\$$SD$(L$,9T$$ыX$\$'$$$Yl$ t$9*Y$\+<ʋ e u7댉냉l$ t$4-@,$T$L$D$ \$cT$L$D$$$l$ t$4댋$(D$($$L$,1\$$SD$(L$,9T$$ыX$\$F$$$Yl$ t$9*Y$\+<ʋ e u7댉냉l$ t$4-@,$T$L$D$ \$肪T$L$D$$$l$ t$4DŽ$$itNDŽ$"T$螕$L$$A$$t$`TË$tz$ht DŽ$$Xt DŽ$$tDŽ$ d$0tDŽ$HDŽ$8$$!isdb@=gridDŽ$kֺ$D$D$D$ D$J9ŏЈe 'e ;av7 Yu4D$t$rD$L$L$D$ * Ҩ밍|$9;uĉ#e ;av?YuYu;D$t%H$L$D$L$ D$L$* 멍|$9;u#e D$;AvAYu;$t"oÇ$$ļ) 脧뢍$9;u#e $P;A0Yu$@1芿$4tU‡$8$$<$$$x‡$@$x‡0( ̦W$49;r#ke ;av7 Yu4D$t$D$L$L$D$ i( b밍|$9;uĉ#e D$;Av6Yu0$:$$ļ뭍$9;uʼn#e $P;Avw0Yut$@1$4b$8$$<$-$$x.$@$x0Kf$49;u#ze D$;Av6Yu0獴$$$|ļߤ뭍$9;uʼn#e $P;Avw0Yut$1޼獴$4B$$$$ $$x$$x0+f$49;u#ze $4;ALY$\1&$P$ $P $TL$$XL$t$$D$$$$"$\$$$L0% )$P9;3#,e ;avt8YutD$<Ð4<ۆe ;a4D$<D$@D$8HL$0 $̈D$0D$$WD$D$8@11cD$,L$$T$(QY $\$T$I,$D$(D$D$$D$5D$D$kD$,@T$L$ uT$\$D$T$L$(둉D$$-3,$\$D$T$ L$*>\$D$T$HD$$ L$ -3,$\$L$T$ D$=\$D$T$L$ 3$l$@l$D$T$ L$=\$D$T$HD$D>)ie ;aveD$T$9u:H T$ 9uD$D$ÅuP c c L$D$Åu뾋c c D$L$he D$;A|$X$~D$l 3 $D$D$<;D$ L$L$TT$獴$u $ c c 0ce ;a<|$1t{ `1 $L$@L$L$ T$T$L$ & $T$PT$pL$T$ L$$T$( & $L$TL$JL$ T$T$,L$0 ҟ $L$XL$L$ T$T$4L$8 x $D$RL$L$D$ D$ɍL$T$L$tT$x<be ;avD$D$8ae ;av0$D$c ae $H;A8$X 0 $D$D$P4D$D$ L$L$T$ T$($T\$0$Xl$$1L$qL$$l$0D$ ىl$$94t$+[$1ky$_yƄ$|$xNy$ ݕ$ ϗ$ 눜$$$$$|$x$}$ t$x}$$ }L$\$9,I<-e u$\}0$|$$D$Vz1T$(\$$h$l|$H16x$*xƄ$|$`x$$$9t $\$l$~|$`$|$t$`||$H$|$1wL$($50:X|$|$|$,e 5 {D$,x e uit$H| e x(u0${$pDŽ$tDŽ$x8Í0$|$$D$xD$,빍0$|$D$HD$xD$,뀍$|$ D$xEL$fDŽ$DŽ$DŽ$fDŽ$$DŽ$p$$D$fD$ L$$$É$$˄ ˄ ˄ ˄ P^e ;a D$$H@vrA ~9uEHP@ $T$D$D$L$T$\$l$ l$(D$,L$0T$4\$8 É $@ԲD$D$I "˄ KOVe D$;A$H`$D$D$D$1bg$H@q A ~9$k|$l$k$L$|D$0T$T$@1ۋl$D11ŋD$< t$ ׉؉ʼnL$<\$,l$8t$ |$$QI$T$L$%D$ L$T$\$l$=D$HL$LT$P$L$HL$WD$L$ $L$|$Tt$@*kD$ HT$$9\$8L$ -e @<Åuft$TjD$,@L$09D$ L$tl$x$$$$$DŽ$DŽ$ĤÉ\$4T$(0$|$D$TD$gT$(\$4t0$l$8l$D$T$ L$d!\$D$T$HD$ DŽ$DŽ$DŽ$DŽ$DŽ$$$Ĥ1\$D1DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ĤÉ$@D$D$ DŽ Le ;avD$@D$Ke ;avD$Ke ;av D$ @D$Ke ;a$D$e ;acT|$1V `1 $L$XL$؂L$ T$T$L$ : $L$hL$ւL$ T$T$$L$( 0 $L$lL$ւL$ T$T$,L$0 & $T$tT$ՂL$ T$T$4L$8 & $L$xL$ՂL$ T$T$$DŽ$$$DJ9L$D<e $RDL$D$aL$t$e?fDŽ$$M? N5$DŽ$ $$CL$tQ9< e s$C$M$8>fDŽ$8$> :}$DŽ$$$8oCJ9L$8 e <a$,CL$8$ 7L$x$ ?>fDŽ$ $'> } $DŽ$ $$ BL$xQ9< e I$B$#$=fDŽ$$p= Sƻ$pDŽ$t$x$IBJ9L$@e <uB$p BD$@$H$L$PDŽ$TDŽ$XÉ$l$HS$|$$pD$>$l$H땉$S$\$T$l$ L$\$D$l$H$5R$T$1T$<$l$\S$\$L$l$ T$(\$D$l$P1L$x)B$l$dS$|$$D$=1$l$dq$S$\$T$l$ L$\$D$l$H1$ ,$T$,l$lS$|$$D$X=1T$,$l$lWS$\$L$l$ T$$\$D$l$P1L$t$l$`S$|$$D$<1$l$`G$S$\$T$l$ L$\$D$l$H1$$T$0l$LS$|$$D$T<1T$0$l$L-S$\$L$l$ T$ \$D$l$P1$$l$TS$|$$D$;1$l$TT$|S$\$T$l$ L$\$D$l$H1T$|8Y$T$4l$hS$|$$D$S;1T$4$l$hS$\$L$l$ T$\$D$l$P1$$l$XS$|$$0D$:1$l$X$S$\$T$l$ L$\$D$l$H1$͉щ19͉15 $\$T$ިD$ L$T$\$l$a$$$$$D$D$ L$ $D$谥t$$<$$<$P17 &$PDŽ$T $X$<$@Q$D9l$<| e u$P;Q9t <ˋ e  =j9\t<Ӌe -M9T e <w:$L$D$ĝD$ D$D$L$$0T$D$L$ D$D$L$$D$L$:D$ D$]D$L$D$4L$8,ɍw:Zl$ 0$\$l$D$ L$υ\$D$L$@l$ ʉcT$( 0 $\$T$D$ l$*υ\$D$L$hT$(ȋL$0d=0L$$-0,$\$L$D$ T$΅\$D$L$Pl$0ȋL$$0$L$ L$D$D$ D$|΅|$D$L$Ge u]hT$0ȉH]He ;av% he $D$'D$D$ te ;avD$D$D$ D$He ;aTD$==Et-=tЂD$D$ Í D$D$ ÍD$D$ =t4=t=u,D$D$ ÍD$D$ Í D$D$ =R=t8=t=YD$D$ ÍDsD$D$ Í D$D$ =t8=t=˺D$D$ ÍND$D$ Í5sD$D$ e ;ae vuv e A'訶sn sq"$D$ D$‚D$ D$ " $D$T$D$ |$Ge "$L$L$T$D$ |$Ge v"$L$L$T$D$ C|$Ge 0"$L$L$T$D$ |$Ge S"$L$L$T$D$ |$Ge k"$L$L$T$D$ h|$Ge  "$L$L$$T$D$ |$G e "$L$L$'9T$D$ |$G e `CG"$L$L$T$D$ |$G e "$D$D$ L$D$ D|$Ge D$Drd $D$7VD$ L$ @d e uRDd $D$VD$ L$ Hd e uLd e Í=Ld [ =Dd N 맍A =Drd D$2 T" CG  ?   S 40   )Se ;av7 Yu4D$t$D$L$L$D$ t 밍|$9;uĉ#e ;avl(YulD$,tSPX@ $T$\$D$ D$0D$D$4D$D$8D$5D$L$ T$$D$t$8t( zD$,L$0T$(T$t$Dt( D$8L$fokhu codeD$0L$XT$H\$,l$(t$l|$DT$HL$XL$PAT$49=L$XT$Hu  -eD$0L$X|$D$,16Ԇ$,L$X$0L$0$4L$`$DL$D$H$8$<$@ p $$,L$mUL$T$ $\$`LËD$\$D$†$ ڈ$ 鈌$ ӈ$$$$$|$d$Ɔ$t$dƆ|$L$Ɔ$ p$DŽ$ $ t$LMƆ$,Q$09$($,| e &$ņ$4IL|$||$|fD$|$ $DŽ$$t$|ņJ9l$,|e $]ņ$,$,|$4|$4wD$4$d v!$DŽ$ $t$4ņ$,Q9pe | u($Ć$8$<$@$Él$0T$$\$ S$|$$D$T$$\$ l$0뭍S$l$L$\$ T${l$D$\$P$,Wl$,\$$S$|$$D$X1\$$l$,S$l$T$\$ L$+{l$D$\$H1$,Yl$(\$ S$|$$D$1$,\$ l$(S$$(l$L$\$ T$zl$D$\$P1$,Ae ;a<$ e$OI111ҋ$CKSd$L$T$r.D$ L$T$\$D$4L$$T$(D$@$D$DD$D$HD$9D$ D$ 4D$L$T$\$$,l$0999D$8T$,)ʉ!L$\$t$ S $L$4L$\$L$(L$sD$8$D$0$D$,$<ÉL$DS$D$L$T$ l$xD$T$L$D\$$l$0BD$@$D$D$D$H$<ËD$@$D$D$D$H$<Ëks[\$ t$l$ $D$T$D$L$T$ 9Éȉ.$D$L$T$ D$@$D$D$D$H$<1$=  fQe D$;A$HLH0[  $D$L$T$\$l$ t$D$8D$<D$@D$8$D$\$l$ T$DD$L$$ I$Q I$IL$ |$P1躺|$h豺|$h診D$hL$ L$iT$m|$Pt$hd$| $DŽ$$t$P0L$~$$$111jt$|ӋD$`T$x|$D9D$lt$4\$H|$8l$$[D$DL,t,$L$t$ ,D$$9xT$$9L\$4kt$DȋL$x׋T$hTtL$89D$TD$lD$`D$TL$D[L$`Tt5e sT$hT$HB$9t$DL$dT$ ߋ\$,SL$09D$LD$pD$\D$LL$0[L$\lt-e 4l$d,\$ l$|9tAȉՋt$0D$pl$,t$0\$(  $PD$L$|T$x\$(111u$$D$0$DŽ$DŽ$tÉŋD$d"ht$Dl$@$l$pl$\$L$ T$dD$L$T$A\$,l$@t$D$D$\$Ӊʉً\$,׉ƋD$h覧||$DT$@t$<$T$lT$\$L$ l$_dD$L$T$i\$4t$<|$DD$`ы$T$@ȋ$t$8l$4L$lT$Hd d DŽ$DŽ$DŽ$$$tÉڋ$$  :Ee $4;A L$h 5ӺQ D$,L$LT$H\$($1A$5Ƅ$$!$p$ލ$$$l9t$T$L$ڭ$$蛫$$舫$$u࿡$M|$D$,Ge GD$L|$`e O ύ$%0$D$$TL$`D$L$T$ $Tl$l$\$P1l$Tu ϋL$ ЉډL$ T$Xt$T|$@D$$^.vl$xt$|$$l$xl$)D$ L$ $D$<$t$\`D$ HT$$9\$XL$ ,@<-e $%L$@A$T9;D$ D$8$1!$5P9ᩆ$,L$H$,L$($0$4$謩 S $T$`T$D$D$ D$`L$T$\$-e y ȋ$`΍L L$0$,,JL$@T$0999D$X\$4)ˉ!L$L$@)ʉT$|$ S $$\L$l$$dL$/D$X$tD$0$xD$4$|DŽ$DŽ$LÍ-S,$D$L$\$ T$_\$D$L$@T$0$`D$PT$@\$4S$|$$,D$>D$PT$@\$4$`\$lL$8L$pT$t$Ƅ$ @ $L$lL$#L$ T$$$$$觧1\$DT$<0$|$$D$藤T$<\$DI0$l$Xl$D$T$ L$h^\$D$T$HD$ Ӊ‰0$L$$D$(D$L*$lD$dL$h0$D$dD$"D$L$ $$u ۺTu к41111' e D$;A@n$$L$L$[|$$D$ L$T$1苬$]‰$$9>$$$$$ $$U$$$$$Z$97$ߍ։e Tu @׉ÉK,$$@n$$L$T$l$ \$\t$D$l$X$$$tDŽ$DŽ$DŽ$$$É$$$DŽ$DŽ$e $;A $H-QI $$|$ $l\$$h111퉬$1퉬$01퉬$$$($$d11W$C$l$0$$$($d$$$݋$$h$9f$$$ $H$$T$$\$$S$$$$(\$$$$$<$$$4$ 7$$$$$0$$tiH-tEA QA Q$($I$dHM$$($d3ϋ$$($dȋ$$0$$1誜 ̮$9$l$$Y$$F _$CD$$$h$z$4$$$$$I$$D$1$DQ\YX$5謠$$虠$$膠!$$ $$$$$$9{99$ $`)͉$ۇ!L$T$$L$ ή $D$T$|$8$`$$$$$ $$$$t H- $$$$tX$8$K̮$$8L$t$ l$$$$$$~$L$螆̮$$LD$AD$ L$$$$d$$($$$DŽ$DŽ$Ë$H $H$`$I̮$$`D$D$ L$$$$d$$($$$DŽ$DŽ$Ë$H$ $$\$ή$t$L$l$ \$Tl$t$$\$$$$$ $$<$t$<̮$$tD$D$ L$$$$d$$($$$$$$<$ÍqD$豜11$蹗+$1覗 ̮ $$T$t$ L$$$$$4ȋ$<$0$$10 $9$輛$$詛$l$薛 b$F>D$$$h$$4$$$$$>$$,$1v$,QtYp($5$$隆$@$֚K$$` $$$$$d$\9 9 9 $ $`)͉$ۇ!L$T$$L$ ή $D$T$|$ę$`$$$$$ $$h$$t Q-7$l$@Ӌ$p$D$lꉔ$p$t$Hڋ$x$L$t뉜$x$T$P$$$$1$X$Ή$Xϋ ͉$Sk $`[$$$ $|$T]$$$‹$9$ $TY$$\ T $T T e 9$`T N$$9$tx$$l: $$L$t$ l$$HX$؉ы$ˋ$$‹$$y$$l賗 $$D$HD$ L$$$$d$$($$$DŽ$DŽ$É׉Ë$`艑؉$$ $$TT$$ T$l$ L$6Nl$L$D$$$|$$ $$$$?$H $H$H$lo $$HD$D$ L$$$$d$$($$$DŽ$DŽ$Ë$$ $$P$ή$t$L$l$ \$Ml$t$$P$$$$$ $@$$t$lb $$tD$D$ L$$$$d$$($$$$$$@$ÍqD$ה11$$1  $$T$Dt$ L$$$$$4zȋ$$0$$0$1葏 ͮ$9$S$$@$$-`a$6D$$$h$a$4$$$$$船$$8$p1׎$8Q\YX$p5蓓$$$p耓$$$m!$$ $$$$$$9{99$ $`)Ή$ۇ!L$T$$L$ ή $D$T$|$$`$$$$$ $$$$t H- $$$$tX$$2ͮ$$L$ l$t$ $$$$$~$$ϑͮ$$D$( D$ L$$$$d$$($$$DŽ$DŽ$Ë$H $H$$0ͮ$$D$ D$ L$$$$d$$($$$DŽ$DŽ$Ë$H$ $$$Lή$l$L$t$ \$Gt$l$$L$ $$$$$$$0$$d$$($$$$$ÍqD$pڏ11>$⊆m$1ϊ ͮ $$T$ t$ L$$$$$4$t2Z-t*$$Z 닜$Z$$$0$$d$$($$$$$ÅtH-tH PH P$$$0$$d$$($$$DŽ$DŽ$11C11:    pe $`;A $1$툆fDŽ$ ࿡ $;0 e |$$!5@w e $z$g$1x$l $DŽ$$DŽ$DŽ$$$$ I8$$ $|$$(H9=$$$$$$$$ Í0$|$$D$蝉$࿡$|$@D$unFe $t;A$ $12$&$ $|$$$L$$$$aC$Q,Y0111t1$Qe uY$ Íy装扌$$$$$跉$$$$<$$ Ëi A$I(11ۉƉȉYme ;a@D$D$ $$L$$ L$ @qL$ H L$諳D$L$T$DBe zJt $@ËJ t|$|$ 1{J L$ J YIL$$\$( p $L$ L$L$D$ T$DJ e uB둋|$,É!rle ;av7D$HPtD$T$ L$Ë@ D$D$ D$Ble ;avD$H@D$L$ le $H;AI8$1Y$MfDŽ$ ࿡ $+ e |$$5`׈ e $z$Lj$1؃$̃ $DŽ$$ DŽ$DŽ$$<$ R8$$$$@T$$DT$|$ $H蒆$$$$gA$$$$苬$uz$$<$|$$H'$$$$$HPt1$ $$8Ë@ 11DŽ$ $$8Í0$|$$D$G$X࿡$|$`D$ie D$;A$$|$$$$$$t+DŽ$DŽ$$$É$$$躄K$$$$$$$$he D$;A0$$?D$L$$Q Y|$\1р|$tȀD$t|$D躀qT$uD$uTD$v9t$\$T$茇|$Dt$tS$t$DC|$\$3$HL$  $#D$ L$ $D$t$$$q'e |$|$85`e L$8yKt$\覄e L$8y( $腄$H QT$ Xh$|$89t$$|$4F@D$L$T$ S$\$L$l$rd$&e $Q0|$WQWe e A(GT$ W T$$We ukT$4We A,uGGe A4u'G $DŽ$DŽ$ļÍO j}̍WZ}묍W׉ËD$4D}농W4}T(}6_߉ʼn}L$,\$0l$(S$L$8L$D$D$ T$9t$|$$L$,T$ \$0l$(*0$|$$D$0$|$D$\D$f$|$D$E`\$$$$$$$$$"e ;a(|$1&;|$;fD$ ࿡ $n e |$|$ W5?e L$ yt$?`$!e L$,Q |$WQWe G Ge u{T$ We AuWG$tR|e Au$G$DŽ$DŽ$(ÍO9ύW8뜍W׉ËD$ 8s8J_߉ʼn80$|$D$D$;࿡$|$D$u; &e D$;A$159$)9$ $|$$V<$$$$k$Q,Y0to111t1$Q e uY$$Íy$7拔$Bje uJ$Íz}7A$i(I 11e ;avUD$H$P t!D$D$ D$T$L$ËHP@D$L$ T$D$D$te ;avD$H$@ D$L$ Fe D$;A$$|$$:1$$$$$D$$D$|$ $u:$$$$J$$$$$uj$KS-e uICk [$t0111҉$$$$$11ƉЉʍ{5DŽ$DŽ$DŽ$$$DŽ$DŽ$DŽ$$$Se D$;A$$|$$$ 9$$$t+DŽ$DŽ$$$É$$$8$$$$$$$$e $t;A $Q Y|$L14$4Ƅ$|$d4$$$9t $\$T$;|$d$O9$t$d?9|$L$/9$QY$1:4$.4Ƅ$|$|4+$$$9t$\$T$:|$|$8$t$|8$$8$ہe |$|$8u5 7D$8x e 2t$L:8 e x($8$QZ\$ i qp9|$$D$4O@L$T$\$ S $t$T$l$7`$ ځe $Q(|$WQWe T$ W T$$We u~T$4We A,uZG$tR|e A$u'G$DŽ$DŽ$ ÍO1̍W0뙍W׉ËD$40p0G_߉ʼn0l$,t$0T$( S $D$D$D$ \$w|$D$$T$(\$ l$,t$0?0$|$$D$63D$80$|$D$LD$3D$8$|$ D$2u\$L$ iL$$YL$`T$@|$0\$$'9QI9l$ O[ll$<,T99ϋL$D$ D$(|$`1f)=|$`59).࿡$Ёe |$|$85-e L$8yt$`-`$ZЁ$ e |$ulGG e uK G G e uD$8G$xĨÍOω‹D$8'܍y'밍Ok'뇍0$|$D$`D$=*@࿡$|$D$*\$HL$(L$LT$P|$x(D$x @ $L$HL$胨L$T$ $$|$`t$x,v\$4T$,0$|$$D$)T$,\$40$l$$5p_ p$$Íh>ĉ獴$t #D$L$T$$OGe u`$5P_ $$$ÉT$4$$D$ $$$$$$$$$$荪$$$$$$$1$H4P8tH$$5ʫ$$$谫$$ Íp $茫11Í$5pt$$ É$$5PF$$$ Ǎe D$;A$$|$$$9$$$t+DŽ$DŽ$$$É$$$ڨk7$$$$$$$$׌e D$;A$QY |$\1|$t D$t|$DT$uD$uD$v9t$\$T$ͫ|$Dt$t蔩$t$D脩|$\$t࿡$K|$|$8e 51e L$8yt$\'$H$QT$ X h(7t$89t$4|$$G D$L$T$ S$\$L$l$d$&Ke $|$WQAWe u{T$ W T$$We uKT$4We A,u'G $hDŽ$lDŽ$pĤÍO 4̍W׉ËD$4뀍_߉ʼnTL$,\$0l$(S$L$8L$D$D$ T$^|$t$$L$,T$ \$0l$(x0$|$D$\D$x0࿡$|$D$Ws\$D$$$ 11҉L$8$1$58ܛ$4$$$4$8$<$衛$$$j9VZ$e <u$4K ~T$PcS$|$$4D$O1ЍS$L$T$\$ l$-RL$T$D$$$1k$$L$8$$Ƅ$ @ $$T$fL$T$ $$$$聚1L$L111|$d ՉƉ؉ˉD$hT$d\$Hl$|$$L$$T$e u7$憅$$$@$$É$S$|$$D$ǃ$DŽ$DŽ$DŽ$Àt11$o$81}$qƄ$$] $DŽ$ 0 $$T$BL$T$ $$$$݅$$ʅ$8$跅$P1̀ t$PDŽ$T$X$8~ S $$T$D$D$ D$i<|$$L$$T$e u"$P $C$T$LS$|$$PD$T$LÀt$1$Ƅ$$0Ƅ$ $$9t $\$D$ 蟆$0$`$$0M$$:$1P t$DŽ$$$ S $$T$D$D$ D$:|$$L$$T$e u"$范$C$T$LS$|$$D$腀T$LÀZ$u$t$H1I~$(=~Ƅ$($)~ $DŽ$ 0 $$T$L$ T$$8$<$$(詂$$薂$H$胂$01} t$0DŽ$4$8$HJ S $$T$D$D$ D$59|$$L$$T$e u"$0Ձ$C$T$LS$|$$0D$~T$LËRpDŽ$DŽ$DŽ$À$1|$||Ƅ$$Ph|Ƅ$$$9t $\$D$8$P$$$P怅$$Ӏ$1{ t$DŽ$$$蚀 S $$T$D$D$ D$7|$$L$$T$e u"$%$C$-T$LS$|$$D$}T$LË$u$u(DŽ$DŽ$DŽ$Í$1z$pzƄ$p$xz $DŽ$ 0 $$L$L$T$ $$$x$p1$`$x$$` $1!z t$DŽ$$$~ S $$L$D$D$ D$5|$$L$$T$e u7$]~$$$@$$É$S$|$$D$>{$`+e D$;A$$$D$$D$D$ D$L$T$ D$$L$ T$($ D$D$0  $ D$|$0GG e $$$L$$T$ \$ |$)D$L$t?$$$$$$$$ļËD$0HPD$@T$DL$H$L$@L$D$L$ $L$\t$t$,|$d|D$(D$4D$ D$8D$$D$<$D$4D$]D$L$ $L$ |$Lt$,0||$|5{$t$d|$t$L|D$|$D$D$qD$L$ T$\$l$$$$$$ļuM$$$$$$DŽ$DŽ$ļ]He D$;AHd$D$<  $D$D$0D$L$L$8T$ |$T1vD$DŽ$lDŽ$p$t$xĜ[e $;A[$P$$TD$$XD$D$L$T$\$l$ $8=S\$4l$\봍W.\닍W׉Ë$\_ \/_߉ʼn[DŽ$$$à y L$8Ql$<9D$x$$D$xe $مuEύ$,a$\$t$Nj$$D$TЉŋD$TT$hl$dS$L$$D$^$T$h$l$d뎍S$$\$L$l$ T$D$L$l$QL$8\$t$$$D$T,$S@D$L$ D$ tD$T\$t$$D$T\$t$$L$l$,$D$L$誀D$ tD$T\$t$$XD$TL$l\$t$$$ 1113$1$ Ήى$t$t$D$TT$X]$}|$Pml$L5S4$l$l$D$D$DL$L$@T$ $S$T$L$D$ $l$l$Ll$l$Pl$Y^D$THT$X9b$,@ȋL$@LL$DL< e u'$ L$tA$9ى$Xэ$$l$D$T$ L$s\$D$T$HD$Th趼 @:e $t;A$ $1Y$Y$ $|$$$,\$$$$A$Q,Y0111t1$Qpe uYt$ ÍytW扌$$$$$[$$$$<$$ Ëi A$I(11ۉƉȉY?e ;avrD$ $ $$L$$L$ qL$ HDL$菅D$L$T$ Bpe uJt$Ízt~V>re ;avU|$1HWL$Qpt"|$5 [D$Hp@tL$4D$8ÍqD|$[D$4D$8>e ;avD$Ht@pD$L$ V>e $H;A?8$ 1V$<Q8Ay>QDŽ$dDŽ$hDŽ$l$p$tĐÍ$l1? $9>$H$1D$l$HD$$$l D 9u$4$\@$L$$L$$` $ЋD$ L$T$\$^p9B$ЋD$L$$$1>$$$`$|$xc |c O e hc lc O e uwG$DŽ$DŽ$p$$D$跿D$L$ DŽ$dDŽ$hDŽ$l$p$tĐÍO?x$D$聅D$ L$ 0d e  4d L$$D$ID$L$ 8d e  T$T$҃<GrT$T$ )9)9l$49i)!ً\$lN9Ft$t$D96l$())ۇ!t$<9~19t $|$l$`.D$ L$DL$(T$\$D$H,D$H,u0W9w_9\>׉ڋ\$0 D$H,Ã=u;W9w(_9_9\>׉ڋ\$0D$H,Ã>uTW9wA_9Q_9F\>O96L7 ً\$0׉ʋL$8qD$H,Ã?\W9w=_9_9_9_9\>׉ڋ\$0D$H,ÍO9_9ҁ|> ~_|$ 9|W)9QL$D yL$l$@t$<9t(|$$)׋t$49l$0|=L$$9rD$H,D$H,ÀuOW9we ;aD$(He vu:u e  roe e ;a,LJ|$0$Y|$D$4Ge u~L$0 e WuG׍t$L$8HL$@H$ e uL$D$PL$p $FT$D$fD$ D$PL$pb $T$D$3D$ D$PL$p&L$DT$`$1y  $$L$pL$ T$$L$PL$D$TL$`$X<Í$$1Y1NS $@ԲD$D$Pl )R Rք=e ;aD`D$dH,L$ ` $$L$äD$ HT$dBx\$|j|9Z|Rtl$|9@D$H$$$|$D$t$ T$l$\$ $D$HЋD$L$,T$ \$(D$PL$l\$pl$xT$4l$8B$L$\$l$ D$D$D$iD$L$ T$$\$4,l$<9wt9T$@D$T $L$PL$\$SD$T$D$<$D$@$D$8$DŽ$DŽ$`ÉL$D3$D$L$T$ l$ۨD$T$L$D\$4l$ ;= 4> $\$'D$|V DŽ$DŽ$Ƅ$f$DŽ$$$@i$$D$WD$ L$ $D$K e $l;A|$\ ل$$11111|$4 ։‹$L$4T$,l$$t$(|$0\$#$q݄$$^݄$Ƌ$`fok|$t$7݄L$tu 9$$݄$-$ ˋL$0T$(@΋$9 t%Ƅ$$DŽ$(DŽ$,Ét$8l$D$ f.!D$# ËD$,l$$tuKcodeuA$$4ۄ$ttL$(ʋL$05$=errmAf=sg$$ڄ$t111t T$(͉t$0|$\$ڄL$pT$lt"ƍ09Q ΉѺ멍L$]L$]AɅ|mrhwc$D$^D$AD$D$ QăT$L$0\$#l$$t$,떉L$0T$(1111\9 $D$'D$Q D$@D$DD$HD$@D$D$D$H@i$D$@D$RD$ L$ $D$F Ie $;A $@Ԅ$87Ԅ$Qh $u Zn@Y $\1ӄ 9, $$؄$\$؄ 9z $d\$(l$$$H0L$  $l$\$ 踀D$$$Q0T$ $T$$T$\$(\$ 课$ HL$dn@ $81ӄ 9 $$ׄ$8$ׄ 9= \$d;e $҄ 9 $p$6ׄ$$p#ׄ 9 $Y A$Q T$D$$$D$L$T$\$l$ 6 \$L$T$P,$\$T$D$ L$T$$khmD$#L$@$$$D$L$L$`$1ф$L$`$$I$$\$$$\$($$k s$$l$#7$L$\   9*getnjonce1Ʉ$Є $9$$fՄ$$SՄ$$@Մ 9 D$P$T$L $T$D$QD$D$0L$L$,T$ T$p@$w|$D$,G$D$0G(e D$pG |$he uW$Ԅ$@hP$$$D$D$hD$DŽ$DŽ$Í($|$$D$~р떍O ω‹D$pz΄c$$gD$L$T$ \$l$t$|$ u$L$LT$PÉЉʉD$xT$Xl$Tt$<$S$L$LL$L$_D$D$HL$L$DT$ $S$T$L$D$ $l$l$Ll$l$Pl$Ҁ$1΄$$L$T$L$X$$[΄Ƅ$ @ $$L$ND$ L$$$$$҄$1΄D$x$D$<$$$҄D$DHT$H9a$L$4-e <u$j҄؋L$4r\$tT$8S$|$$D$jπT$8\$tƍS$$\$D$T$ L$;\$D$T$HD$Di$$Í$ ̈́]@$_td d |$d G$W(e O |$le uW$xф$@hP$$$D$D$lD$DŽ$DŽ$Í($|$$D$@΀떍_ ߉‰>˄e tpt(u copyuJfdb $xD$L$`D$ t1$1L$\$$땉$seD$L$D$ t1$1L$\$$J$'D$L$D$ t1$R1L$\$$$"D$L$D$ t1$ L$\ $$$FD$L$ED$ t1$1L$\$$$D$L$D$ t1$zL$\ $$/$_@D$L$D$ t1$.1L$\$$$Uq|$D$@G$e $G |$|e uW$x΄$@hP$$$D$D$|D$DŽ$DŽ$Í($|$$D$@ˀ떍O ω‹$9Ȅ`khmSDŽ$DŽ$Ë$$$Í$$T$ \$l$D$L$11111v$pȄ$8$`D$L$T$ \$l$=$aȄi1 $v1$눁;eun$@&Ȅ 9uJ$$̄$@$̄ 9u$H311*$DŽ뻍 ፼$DŽ1 d1 DŽ$DŽ$e $@;A5@|$L:DŽ$DQ4$HH$L$$D$|$t1Ƅ$D… ڄ4$Ƅ$HQ$L$ҍt$t$H$s˄L$L$3|$`$Z˄L$3|$Lt$t@˄D$PL$L щ ȁ׃ !Ȅ^?|$tt$`ʄ$DHPI(L$@|$Ht$tʄ$L$@ыD$L$H$DǀH$e$T$PRt$l$\$ $ҋD$L$T$\$ l$$D=e V^n[,T$L$D$ ,$ӋD$L$$D$Y$D$$HD$$LD$$PD$ $TD$^D$L$t$X$\@DŽ$XDŽ$\@ÉD$4L$D$D$$1EĄ$DH@ $$D$4$D$D$ka$DŽ$'$$D$yED$L$ $X$\@Í$1ÄNV $$$$ $DŽ$  $$L$DL$T$ $X$\@ÉD$<=„D$< $$PL$$TT$D$L$ T$\$uʉ$Dg$1„$Di I$$$$ ɼ$DŽ$  $$L$DL$T$ $X$\@ÉL$8$1S„$DYI $$L$8$$ {$DŽ$   $$L$CL$ T$$X$\@Ét$`Ƅ|$t$tƄqUD$(1D$T\$Xʉv{$bƄ$DT$L$獴$9ƄFpt$|$t'Ƅ1w$H@$L $ЋD$L$L$@$1 $DH@ $$D$@$$y$ DŽ$$$$D$BBD$L$ $X$\@Í$(1$DQ I$($, $8DŽ$<  $$(L$AL$ T$$X$\@虧e $;AP$Lƿ$ǿ$迿DŽ$DŽ$DŽ$DŽ$$Q4:$H$$$D$-$1C$QlYp… ӄ $$Q$$ҍt$$$ÄL$L$G$$ÄL$G$$Ä$$  щ ȁ׃ !Ȅ ?x $$Ä$HPI$L$h$$„$L$hыD$Z ` $IeD$$$QYT$\$`$BD$L$ $D$$D$D$ D$,D$L$ $$9  *rzR| o Aa AS Q. L$dT$`$HPT$L$ ` $AD$L$ $D$D$d$ЉD$D$`D$ L$D$L$$$T$L$D$ 6D$L$ T$$D$\$=Iƃ=$1л$ $T$\$l$ KL$T$$($Q$$(D$=D$L$ L$lD$H$$ $$$D$$D$D$HD$ L$lL$D$L$t1DŽ$DŽ$$$)ËD$H$D$l$DŽ$DŽ$)ÉL$LT$x$$ $1荺$H@ $$D$L$D$x$ #$$DŽ$(DŽ$DŽ$$$D$;D$ L$$$(É $ DŽ$DŽ$9$D$\D$8D$L$ $$pF$D$$D$D$ D$MD$L$L$d$1[$H@ $$$ D$d$DŽ$DŽ$$$D$:D$ L$$$'Í$t1ȸ$t $T$\$l$ YL$T$u9$$t2 $$D$:D$L$ L$XT$p$$ $,1I$H@ $,$0D$X$4D$p$8qJ$<DŽ$@DŽ$DŽ$$$,D$g9D$ L$$$&Í$L1蜷$T$\$l$ $L$r#L$T$L$PT$|$D$$ ,OL$I$\1$QI $\$`L$P$dL$|$h 貼$lDŽ$pDŽ$DŽ$  $$\L$;8L$ T$$$_%ÐR%Ë$$|$$L D$8L$,T$0\$4l$<ƋD$@u݉Ӊʋ$t$\+l$PD$|$D$$ ,OL$ $D1ᵄ$QI $D$HL$P$LL$|$P $TDŽ$XDŽ$DŽ$  $$DL$6L$ T$$$#$Ð$ÉL$TT$t$$X$t1$H@ $t$xD$T$|D$t$#$DŽ$DŽ$DŽ$$$tD$26D$ L$$$V#ÉD$TL$t$$$1T$H @$$D$T$D$t$n$DŽ$DŽ$DŽ$$$D$r5D$ L$$$"Í3$\$\$nD$L$T$ $e u؋$_D$tL$T$$v$12$H@ $$D$T$D$t$>ɼ$DŽ$DŽ$DŽ$$$D$P4D$ L$$$t!Ë$@$ $ЋD$L$$$1b$H@ $$$$$@e$DŽ$DŽ$DŽ$$$D$3D$ L$$$ É獴$螶|$$莶[ED$(Xf1D$$ʉj$F$HpPlT$L$獴$#0`t$$1$$J$@$ $ЋD$L$$$1߰$H@ $$$$$Sf$DŽ$DŽ$DŽ$$$D$1D$ L$$$"Í$17$Q I$$ $DŽ$DŽ$DŽ$  $$L$k1L$ T$$$   e ;aXD$\H8P<Å!˅ لuXh|$D D$\H$ g1필@$(uuID$X)Ѕt|$T9ht$\9\))t$dۇ!$HL$ " $T$D$ KD$u!$$$$(f $6D$$$(QӋD$ $$L$D$oD$ L$T$$$D$L$T$ (@D$L$T$\$l$ L$|$1Ž$趎$)I$$$L$|$$  $$T$$\$襹$Q iI9|$X$)))Չl$Pۇ!Ս+$$\$P\$dȉ֋$$$DŽ$4DŽ$8$<$@$Ë$|$TD$`$,$,D$t$l$ $$$$_1X4$*D$l$ղD$ D$X$)ȅ\$T9l$\9))݉ۇ!݋$$V NvÉ|$xD$t$D$`t$pL$l$$$$ߋ$$$$$$-L$tqT$`$1P$ $L$tL$L$xL$$L$ T$L$dL$vt$$讐L$HL$hT$L$$菐L$hZ$(A QYj9ZY Re <$;$$D$lD$D$pD$D$ L$T$t+DŽ$4DŽ$8$<$@$É$D$L$$4$8DŽ$<DŽ$@$Í q$|$$D$ጀI$ q $D$T$\$ l$FD$L$T$$Se u C ʉ{ 蓉DŽ$4DŽ$8$<$@$ÍkS$D$D$D$ D$يD$L$DŽ$4DŽ$8$<$@$ÍQS$D$D$D$ D$WيD$L$DŽ$4DŽ$8$<$@$DŽ$4DŽ$8$<$@$    pe ;a0D$4L$8T$<1 ݉Éȉщ^\$($L$T$aD$ L$T$\$tbh0 tD$(릉D$,L$$T$\$ 4$*D$l$'D$ tL$$T$\$ D$,bL$$T$\$ 먍$/|$Ge u2D$@D$DD$HpD$L|$P0Íɍ$k/|$GEe u2]D$@D$DD$HpD$L|$P0Í]蹆ɋCKS T$@L$DD$HD$LD$P0 o4e $T;A>,$0!b$$L$|$111B9ލX)9$[Nj\$E~$1$$$$9$|5Zn$$# t_p9 \|넍&$L$D$T$ t$BL$D$T$p$$$$먍p9<*&$L$D$T$ t$AL$D$T$p$$$$K9Çދ$+"(#uÇ<wՃwŃR>\;$$$,$\$t$R+|$ l$$$$$$T$$L$D$T$ wD$L$L$D$ $$D$$D$$D$ $D$D$D$rD$$L$($B$9$$$Ƌ$͋$$$$䈄$$ш$ $$$$ $$$L$D$jD$$L$ $"$"$L$L$l޺T$D$ =q|$Ge ,&"$L$L$s޺T$D$ p|$Ge z"$L$L$z޺T$D$ p|$Ge u~{̺"$D$D$ >L$D$ fp|$G e uD$vs$vd}v)mvh!]v^e ;avD$Yu;D$t%H$L${D$L$ D$L$ W멍|$9;u#e ;avBD$$L$L$gD$L$ $D$D$ D$ D$wWe ;avqD$H\$k39t91Ʉt/KP9u!K P 9u@K9D$111$L$l$謡L$ D$\$Vse ;avYD$$L$L$觗D$L$Q$D$D$D$ L$ $D$qD$D$pVe ;aD$H\$k391ɄHP k9k 9!ʄttHSkp99!фtTHS9tAHS8u1K$S X$@ 9t 1D$É$D$L$覓D$ 11111͉4$T$l${L$ D$\$>dUe ;avBD$$L$L$D$L$ $D$D$D$ D$Te ;aviD$HT$Z*09t11Ʉu 1D$ÍJL$$D$蛒D$ ׉4$L$\$4L$ D$T$pT{e ;av'Yu$D$ @L$ $D$D$,"T|$ 9;uԉ#e ;av. Yu+D$@L$ $ЋD$L$L$0D$4 S빍|$9;u͉#e ;avNYuKD$ @ L$$T$@T$T$DT$ $ЋD$L$T$\$ \$HD$LL$PT$TKS뙍|$ 9;u#e ;avNYuKD$ @$L$$T$@T$T$DT$T$HT$ T$LT$ $ЋD$L$L$PD$TR뙍|$ 9;u#e ;a(1D$L$09T$,@\$D$ c c -c ,$T$L$\$ P D$tD$D$ D$$Hc Lc D$L$ D$D$$$D$D$D$ L$L$4D$8(É$L$D$\$ D$ND$4D$8(Qe ;a(1D$L$09T$,@\$D$ c c -c ,$T$L$\$ 0 D$tD$D$ D$$8c D$$" * $$@#T$D$ 2,|$ GGe H?$" $D$$" * $$@#T$D$ +|$ GGe >$" $xD$$" * $$@#T$D$` l+|$ GGe `>$" $D$$" * $$@#T$D$ +|$ GGe =$" $D$$" * $$@#T$D$*|$ GGe x=$" $OD$$" * $$@#T$D$C*|$ GGe =$" $D$$" * $$@#T$D$)|$ GGe <$" $D$$" * $$@#T$D$})|$ GGe <$" $&D$$" * $$@#T$D$)|$ GGe ;$" $D$$" * $$@#T$D$(|$ GGe 4;$" $`D$$" * $$@#T$D$T(|$ GGe :$" $D$$" * $$@#T$D$'|$ GGe L:$" $D$$" * $$@#T$D$ '|$ GGe 9$" $7D$$" * $$@#T$D$ +'|$ GGe d9$" $D$$" * $$@#T$D$ &|$ GGe 8$" $qD$$" * $$@#T$D$ e&|$ GGe |8$" $D$$" * $$@#T$D$ &|$ GGe 8$" $D$$" * $$@#T$D$%|$ GGe 7$" $HD$$" * $$@#T$D$<%|$ GGe  7$" $D$$" * $$@#T$D$$|$ GGe 6$"$@# rd qd d rd e /6$d (d rd e 5,d *$D$[D$D$ $@# š $D$$" p| * $$@#T$D$A#|$ GGe ]5$" š$D$$" | * $$@#T$D$B#|$ GGe 4$" š$0D$$" | * $$@#T$D$C#|$ GGe e4$" š$D$$" | * $$@#T$D$D"|$ GGe 3$" š$ZD$$" } * $$@#T$D$EF"|$ GGe m3$" š$D$$|" L} * $$@#T$D$F!|$ GGe 2$|" š$D$$x" x} * $$@#T$D$Gp!|$ GGe u2$x" š$D$$t" } * $$@#T$D$H!|$ GGe 1$t" š$D$$p" } * $$@#T$D$I |$ GGe }1$p" š$CD$$l" } * $$@#T$D$J/ |$ GGe 1$l" š$D$$h" (~ * $$@#T$D$K|$ GGe 0$h" š$mD$$d" T~ * $$@#T$D$LY|$ GGe  0$d" š$D$$`" ~ * $$@#T$D$M|$ GGe /$`" š$D$$\" ~ * $$@#T$D$N|$ GGe /$\" š$,D$$X" ~ * $$@#T$D$O|$ GGe .$X" š$D$$T"  * $$@#T$D$P|$ GGe .$T" š$VD$$P" , * $$@#T$D$QB|$ GGe -$P" š$D$$L" X * $$@#T$D$R|$ GGe !-$L" š$D$$H"  * $$@#T$D$Sl|$ GGe ,$H" š$D$$D"  * $$@#T$D$T|$ GGe ),$D" š$D$$@"  * $$@#T$D$U|$ GGe +$@" š$?D$$<"  * $$@#T$D$V+|$ GGe 1+$<" š$D$$8"  * $$@#T$D$W|$ GGe *$8" š$iD$$4" L * $$@#T$D$XU|$ GGe 9*$4" š$D$$0" x * $$@#T$D$Y|$ GGe )$0" š$D$$,"  * $$@#T$D$Z|$ GGe A)$," š$(D$$(" Ѐ * $$@#T$D$|$ GGe ($(" š$D$$$"  * $$@#T$D$|$ GGe I($$" š$RD$$ " ( * $$@#T$D$>|$ GGe '$ " š$D$$" T * $$@#T$D$|$ GGe Q'$" š$|D$$" p * $$@#T$D$h|$ GGe &$" š$D$$"  * $$@#T$D$|$ GGe Y&$" š$D$$"  * $$@#T$D$|$ GGe %$" š$;D$$ "  * $$@#T$D$'|$ GGe a%$ " š$D$$"  * $$@#T$D$|$ GGe $$" š$eD$$"  * $$@#T$D$Q|$ GGe i$$" š$D$$"  * $$@#T$D$|$ GGe #$" š$D$$! ā * $$@#T$D${|$ GGe q#$! š$$D$$! ؁ * $$@#T$D$|$ GGe "$! š$D$$!  * $$@#T$D$|$ GGe y"$! š$ND$$!  * $$@#T$D$:|$ GGe !$! š$D$$!  * $$@#T$D$|$ GGe !$! š$xD$$! D * $$@#T$D$d|$ GGe !$! š$ D$$! d * $$@#T$D$|$ GGe  $! š$D$$!  * $$@#T$D$|$ GGe  $! š$7D$$!  * $$@#T$D$#|$ GGe $! š$D$$!  * $$@#T$D$|$ GGe $! š$aD$$!  * $$@#T$D$M|$ GGe $! š$D$$! @ * $$@#T$D$|$ GGe $! š$D$$! L * $$@#T$D$w|$ GGe $! š$ D$$! P * $$@#T$D$ |$ GGe %$! š$D$$! T * $$@#T$D$|$ GGe $! š$JD$$! X * $$@#T$D$6|$ GGe -$! š$D$$! \ * $$@#T$D$ |$ GGe $! š$tD$$! ` * $$@#T$D$` |$ GGe 5$! š$ D$$! | * $$@#T$D$ |$ GGe $! š$D$$!  * $$@#T$D$ |$ GGe =$!`$3D$$! P * $$@#T$D$ |$ GGe $! š$D$$!  * $$@#T$D$ |$ GGe <$! š$TD$$! ( * $$@#T$D$@ |$ GGe $! š$D$$! T * $$@#T$D$ |$ GGe D$! š$~D$$!  * $$@#T$D$j |$ GGe $! š$D$$!  * $$@#T$D$ |$ GGe L$! š$D$$! ؄ * $$@#T$D$  |$ GGe $! š$=D$$!  * $$@#T$D$ ) |$ GGe T$! š$D$$! f * $$@#T$D$|$ GGe $! š$gD$$! f * $$@#T$D$S|$ GGe \$! š$D$$! f * $$@#T$D$|$ GGe $! š$D$$! g * $$@#T$D$}|$ GGe d$! š$&D$$|! 8g * $$@#T$D$|$ GGe $|! š$D$$x! dg * $$@#T$D$|$ GGe l$x! š$PD$$t! g * $$@#T$D$<|$ GGe $t! š$D$$p! g * $$@#T$D$|$ GGe t$p! š$zD$$l! g * $$@#T$D$f|$ GGe $l! š$D$$h! h * $$@#T$D$ |$ GGe |$h! š$D$$d! @h * $$@#T$D$"|$ GGe $d! š$9D$$`! lh * $$@#T$D$$%|$ GGe $`! š$D$$\! h * $$@#T$D$&|$ GGe $\! š$cD$$X! h * $$@#T$D$(O|$ GGe $X! š$D$$T! h * $$@#T$D$*|$ GGe $T! š$D$$P! i * $$@#T$D$,y|$ GGe $P! š$"D$$L! Hi * $$@#T$D$.|$ GGe $L!`$D$$H! P * $$@#T$D$0|$ GGe  $H! š$CD$$D! i * $$@#T$D$2/|$ GGe  $D! š$D$$@! i * $$@#T$D$4|$ GGe  $@! š$mD$$$! š$D$$! k * $$@#T$D$L|$ GGe $! š$`D$$ ! l * $$@#T$D$NL|$ GGe F$ ! š$D$$! ,l * $$@#T$D$P|$ GGe $! š$D$$! Xl * $$@#T$D$Rv|$ GGe N$! š$D$$! l * $$@#T$D$T |$ GGe $! š$D$$ l * $$@#T$D$V|$ GGe V$  š$ID$$ l * $$@#T$D$X5|$ GGe $  š$D$$ m * $$@#T$D$Z|$ GGe ^$  š$sD$$ 4m * $$@#T$D$\_|$ GGe $  š$D$$ `m * $$@#T$D$^|$ GGe f$  š$D$$ m * $$@#T$D$`|$ GGe $  š$2D$$ m * $$@#T$D$b|$ GGe n$  š$D$$ m * $$@#T$D$d|$ GGe $  š$\D$$ n * $$@#T$D$fH|$ GGe v$  š$D$$ $  š$ D$$ v * $$@#T$D$|$ GGe $  š$蠮D$$ v * $$@#T$D$|$ GGe F$  š$5D$$ w * $$@#T$D$!|$ GGe $  š$ʭD$$ 0w * $$@#T$D$|$ GGe N$  š$_D$$ \w * $$@#T$D$K|$ GGe $  š$D$$ w * $$@#T$D$|$ GGe V$ š$艬D$$ w * $$@#T$D$u|$ GGe $ š$D$$ w * $$@#T$D$ |$ GGe ^$ š$賫D$$ w * $$@#T$D$|$ GGe $ š$HD$$ w * $$@#T$D$4|$ GGe f$ š$ݪD$$ w * $$@#T$D$|$ GGe $ š$rD$$ w * $$@#T$D$^|$ GGe n$ š$D$$ x * $$@#T$D$|$ GGe $ š$蜩D$$ x * $$@#T$D$|$ GGe v$ š$1D$$ x * $$@#T$D$|$ GGe $ š$ƨD$$ 8x * $$@#T$D$|$ GGe ~$ š$[D$$ Px * $$@#T$D$G|$ GGe $ š$D$$ hx * $$@#T$D$|$ GGe $ š$腧D$$ x * $$@#T$D$q|$ GGe  $ š$D$$ x * $$@#T$D$|$ GGe $ š$详D$$ x * $$@#T$D$|$ GGe $ š$DD$$ y * $$@#T$D$0|$ GGe $`$٥D$$ hlP * $$@#T$D$|$ GGe $ š$eD$$ 8y * $$@#T$D$Q|$ GGe $ š$D$$ dy * $$@#T$D$|$ GGe $ š$菤D$$ y * $$@#T$D${|$ GGe $ š$$D$$ y * $$@#T$D$|$ GGe !$ š$蹣D$$ y * $$@#T$D$|$ GGe $ š$ND$$ z * $$@#T$D$:|$ GGe )$ š$D$$ Dz * $$@#T$D$|$ GGe $ š$xD$$ Xz * $$@#T$D$d|$ GGe 1$ š$ D$$ \z * $$@#T$D$|$ GGe $ š$袡D$$ `z * $$@#T$D$|$ GGe 9$ š$7D$$ dz * $$@#T$D$#|$ GGe $ š$̠D$$ hz * $$@#T$D$|$ GGe A$ š$aD$$ pz * $$@#T$D$M|$ GGe $ š$D$$ tz * $$@#T$D$|$ GGe I$ š$苟D$$| xz * $$@#T$D$ w|$ GGe $| š$ D$$x |z * $$@#T$D$  |$ GGe Q$x š$赞D$$t z * $$@#T$D$|$ GGe $t š$JD$$p z * $$@#T$D$6|$ GGe Y$p š$ߝD$$l z * $$@#T$D$|$ GGe $l š$tD$$h z * $$@#T$D$`|$ GGe a$h š$ D$$d z * $$@#T$D$|$ GGe $d š$螜D$$` z * $$@#T$D$|$ GGe i$` š$3D$$\ z * $$@#T$D$|$ GGe $\ š$țD$$X z * $$@#T$D$|$ GGe q$X š$]D$$T z * $$@#T$D$I|$ GGe $T š$D$$P z * $$@#T$D$ |$ GGe y$P š$臚D$$L z * $$@#T$D$"s|$ GGe $L š$D$$H z * $$@#T$D$$|$ GGe $H š$豙D$$D z * $$@#T$D$&|$ GGe $D š$FD$$@ z * $$@#T$D$(2|$ GGe $@ š$ۘD$$< z * $$@#T$D$*|$ GGe  $< š$pD$$8 z * $$@#T$D$,\|$ GGe $8 š$D$$4 z * $$@#T$D$.|$ GGe $4 š$蚗D$$0 z * $$@#T$D$0|$ GGe $0 š$/D$$, z * $$@#T$D$2|$ GGe $, š$ĖD$$( z * $$@#T$D$E|$ GGe $(`$YD$$$ P * $$@#T$D$z<|$ GGe $$ š$D$$  z * $$@#T$D$|$ GGe $  š$zD$$ z * $$@#T$D$f|$ GGe $$ š$D$$ z * $$@#T$D$|$ GGe $ š$褔D$$ z * $$@#T$D$|$ GGe ,$ š$9D$$ z * $$@#T$D$%|$ GGe $ š$ΓD$$  z * $$@#T$D$|$ GGe 4$  š$cD$$ z * $$@#T$D$O|$ GGe $$|$$5t*$$@#L$D$|$ GGe 9$ š$芒D$$ z * $$@#T$D$v|$ GGe $ š$D$$ z * $$@#T$D$ |$ GGe A$ š$贑D$$ { * $$@#T$D$|$ GGe $ š$ID$$ { * $$@#T$D$5|$ GGe I$ š$ސD$$ { * $$@#T$D$|$ GGe $ š$sD$$ { * $$@#T$D$_|$ GGe Q$ š$D$$ { * $$@#T$D$|$ GGe $ š$蝏D$$ { * $$@#T$D$|$ GGe Y$ š$2D$$ { * $$@#T$D$|$ GGe $ š$ǎD$$ { * $$@#T$D$|$ GGe a$ š$\D$$ ${ * $$@#T$D$H|$ GGe $ š$D$$ ({ * $$@#T$D$ݿ|$ GGe i$ š$膍D$$ ,{ * $$@#T$D$r|$ GGe $ š$D$$ 0{ * $$@#T$D$|$ GGe q$ š$谌D$$ 4{ * $$@#T$D$蜾|$ GGe $ š$ED$$ 8{ * $$@#T$D$1|$ GGe y$ š$ڋD$$ <{ * $$@#T$D$ƽ|$ GGe $ š$oD$$ D{ * $$@#T$D$[|$ GGe $ š$D$$ H{ * $$@#T$D$|$ GGe $ š$虊D$$ L{ * $$@#T$D$腼|$ GGe $ š$.D$$ P{ * $$@#T$D$|$ GGe  $ š$ÉD$$ T{ * $$@#T$D$读|$ GGe $ š$XD$$ X{ * $$@#T$D$D|$ GGe $ š$D$$ \{ * $$@#T$D$ٺ|$ GGe $ š$肈D$$ `{ * $$@#T$D$n|$ GGe $ š$D$$ d{ * $$@#T$D$|$ GGe $$謇|$$5(*$$@#L$D$蕹|$ GGe "$ š$>D$$ l{ * $$@#T$D$*|$ GGe $ š$ӆD$$ p{ * $$@#T$D$迸|$ GGe *$ š$hD$$ t{ * $$@#T$D$T|$ GGe $ š$D$$ x{ * $$@#T$D$|$ GGe 2$ š$蒅D$$ |{ * $$@#T$D$~|$ GGe $ š$'D$$ { * $$@#T$D$|$ GGe :$ š$輄D$$| { * $$@#T$D$訶|$ GGe $| š$QD$$x { * $$@#T$D$=|$ GGe B$x š$D$$t { * $$@#T$D$ҵ|$ GGe Ƶ$t š${D$$p { * $$@#T$D$g|$ GGe J$p š$D$$l { * $$@#T$D$|$ GGe δ$l š$襂D$$h { * $$@#T$D$葴|$ GGe R$h š$:D$$d { * $$@#T$D$&|$ GGe ֳ$d š$ρD$$` { * $$@#T$D$軳|$ GGe Z$` š$dD$$\ { * $$@#T$D$P|$ GGe ޲$\ š$D$$X { * $$@#T$D$|$ GGe b$X š$莀D$$T { * $$@#T$D$z|$ GGe $T š$#D$$P { * $$@#T$D$|$ GGe j$P š$D$$L { * $$@#T$D$褱|$ GGe $L š$MD$$H { * $$@#T$D$9|$ GGe r$H š$~D$$D { * $$@#T$D$ΰ|$ GGe $D š$w~D$$@ { * $$@#T$D$c|$ GGe z$@ š$ ~D$$< { * $$@#T$D$|$ GGe $< š$}D$$8 { * $$@#T$D$药|$ GGe $8 š$6}D$$4 { * $$@#T$D$"|$ GGe $4 š$|D$$0 { * $$@#T$D$跮|$ GGe $0 š$`|D$$, { * $$@#T$D$L|$ GGe $, š${D$$( { * $$@#T$D$|$ GGe $( š${D$$$ { * $$@#T$D$v|$ GGe $$ š${D$$  { * $$@#T$D$ |$ GGe $  š$zD$$ { * $$@#T$D$蠬|$ GGe $ š$IzD$$ { * $$@#T$D$5|$ GGe $ š$yD$$ { * $$@#T$D$ʫ|$ GGe &$ š$syD$$ { * $$@#T$D$_|$ GGe $ š$yD$$  | * $$@#T$D$ |$ GGe .$  š$xD$$ | * $$@#T$D$ 艪|$ GGe $ š$2xD$$ | * $$@#T$D$ |$ GGe 6$ š$wD$$ | * $$@#T$D$ 賩|$ GGe $ š$\wD$$ | * $$@#T$D$ H|$ GGe >$ š$vD$$ | * $$@#T$D$ݨ|$ GGe ¦$ š$vD$$ | * $$@#T$D$r|$ GGe F$ š$vD$$ | * $$@#T$D$|$ GGe ʥ$ š$uD$$ $| * $$@#T$D$蜧|$ GGe N$ š$EuD$$ (| * $$@#T$D$1|$ GGe Ҥ$ š$tD$$ ,| * $$@#T$D$Ʀ|$ GGe V$ š$otD$$ 0| * $$@#T$D$[|$ GGe ڣ$ š$tD$$ 4| * $$@#T$D$|$ GGe ^$ š$sD$$ 8| * $$@#T$D$腥|$ GGe $ š$.sD$$ <| * $$@#T$D$|$ GGe f$ š$rD$$ @| * $$@#T$D$诤|$ GGe $ š$XrD$$ H| * $$@#T$D$D|$ GGe n$ š$qD$$ L| * $$@#T$D$٣|$ GGe $ š$qD$$ P| * $$@#T$D$n|$ GGe v$ š$qD$$ T| * $$@#T$D$|$ GGe $ š$pD$$ X| * $$@#T$D$蘢|$ GGe ~$ š$ApD$$ \| * $$@#T$D$-|$ GGe $ š$oD$$ `| * $$@#T$D$¡|$ GGe $ š$koD$$ d| * $$@#T$D$ W|$ GGe  $ š$oD$$ h| * $$@#T$D$!|$ GGe $ š$nD$$ l| * $$@#T$D$"聠|$ GGe $ š$*nD$$ t| * $$@#T$D$#|$ GGe $ š$mD$$ x| * $$@#T$D$$諟|$ GGe $ š$TmD$$ || * $$@#T$D$%@|$ GGe $ š$lD$$ | * $$@#T$D$&՞|$ GGe "$ š$~lD$$ | * $$@#T$D$'j|$ GGe $ š$lD$$ | * $$@#T$D$(|$ GGe *$ š$kD$$ | * $$@#T$D$)蔝|$ GGe $ š$=kD$$ | * $$@#T$D$*)|$ GGe 2$ š$jD$$ | * $$@#T$D$+辜|$ GGe $ š$gjD$$ | * $$@#T$D$,S|$ GGe :$ š$iD$$| | * $$@#T$D$-|$ GGe $| š$iD$$x | * $$@#T$D$.}|$ GGe B$x š$&iD$$t | * $$@#T$D$/|$ GGe Ɩ$t š$hD$$p | * $$@#T$D$`觚|$ GGe J$p š$PhD$$l | * $$@#T$D$b<|$ GGe Ε$l š$gD$$h | * $$@#T$D$dљ|$ GGe R$h š$zgD$$d | * $$@#T$D$ff|$ GGe ֔$d š$gD$$` | * $$@#T$D$h|$ GGe Z$` š$fD$$\ | * $$@#T$D$j萘|$ GGe ޓ$\ š$9fD$$X | * $$@#T$D$l%|$ GGe b$X š$eD$$T | * $$@#T$D$n躗|$ GGe $T š$ceD$$P | * $$@#T$D$pO|$ GGe j$P š$dD$$L | * $$@#T$D$r|$ GGe $L š$dD$$H | * $$@#T$D$ty|$ GGe r$H š$"dD$$D | * $$@#T$D$v|$ GGe $D š$cD$$@ | * $$@#T$D$x裕|$ GGe z$@ š$LcD$$< | * $$@#T$D$z8|$ GGe $< š$bD$$8 | * $$@#T$D$|͔|$ GGe $8 š$vbD$$4 | * $$@#T$D$~b|$ GGe $4 š$ bD$$0 | * $$@#T$D$|$ GGe $0 š$aD$$, | * $$@#T$D$茓|$ GGe $, š$5aD$$( | * $$@#T$D$!|$ GGe $( š$`D$$$ } * $$@#T$D$趒|$ GGe $$ š$_`D$$  } * $$@#T$D$K|$ GGe $  š$_D$$ } * $$@#T$D$|$ GGe $ š$_D$$ } * $$@#T$D$u|$ GGe $ š$_D$$ } * $$@#T$D$ |$ GGe &$ š$^D$$ } * $$@#T$D$蟐|$ GGe $ š$H^D$$  } * $$@#T$D$4|$ GGe .$  š$]D$$ } * $$@#T$D$ɏ|$ GGe $ š$r]D$$ $} * $$@#T$D$^|$ GGe 6$ š$]D$$ (} * $$@#T$D$|$ GGe $ š$\D$$ ,} * $$@#T$D$舎|$ GGe >$ š$1\D$$ 0} * $$@#T$D$|$ GGe ‡$ š$[D$$ 4} * $$@#T$D$貍|$ GGe F$ š$[[D$$ 8} * $$@#T$D$G|$ GGe ʆ$ š$ZD$$ <} * $$@#T$D$܌|$ GGe N$ š$ZD$$ @} * $$@#T$D$q|$ GGe ҅$ š$ZD$$ D} * $$@#T$D$|$ GGe V$ š$YD$$ H} * $$@#T$D$蛋|$ GGe ڄ$ š$DYD$$ P} * $$@#T$D$0|$ GGe ^$ š$XD$$ T} * $$@#T$D$Ŋ|$ GGe $ š$nXD$$ X} * $$@#T$D$Z|$ GGe f$ š$XD$$ \} * $$@#T$D$|$ GGe $ š$WD$$ `} * $$@#T$D$脉|$ GGe n$ š$-WD$$ d} * $$@#T$D$|$ GGe $ š$VD$$ h} * $$@#T$D$讈|$ GGe v$ š$WVD$$ l} * $$@#T$D$C|$ GGe $ š$UD$$ p} * $$@#T$D$؇|$ GGe ~$ š$UD$$ t} * $$@#T$D$m|$ GGe $ š$UD$$ |} * $$@#T$D$|$ GGe $ š$TD$$ } * $$@#T$D$藆|$ GGe  $ š$@TD$$ } * $$@#T$D$,|$ GGe ~$ š$SD$$ } * $$@#T$D$|$ GGe ~$ š$jSD$$ } * $$@#T$D$V|$ GGe }$ š$RD$$ } * $$@#T$D$|$ GGe }$ š$RD$$ } * $$@#T$D$耄|$ GGe |$ š$)RD$$ } * $$@#T$D$|$ GGe "|$ š$QD$$ } * $$@#T$D$誃|$ GGe {$ š$SQD$$ } * $$@#T$D$?|$ GGe *{$ š$PD$$ } * $$@#T$D$Ԃ|$ GGe z$ š$}PD$$ } * $$@#T$D$i|$ GGe 2z$ š$PD$$ } * $$@#T$D$|$ GGe y$ š$OD$$ } * $$@#T$D$蓁|$ GGe :y$ š$3t|$ GGe i$ š$AD$$ D~ * $$@#T$D$?s|$ GGe >i$ š$qAD$$ H~ * $$@#T$D$@]s|$ GGe h$ š$AD$$ L~ * $$@#T$D$Ar|$ GGe Fh$ š$@D$$ P~ * $$@#T$D$Br|$ GGe g$ š$0@D$$ X~ * $$@#T$D$Cr|$ GGe Ng$ š$?D$$ \~ * $$@#T$D$Dq|$ GGe f$ š$Z?D$$ `~ * $$@#T$D$EFq|$ GGe Vf$ š$>D$$ d~ * $$@#T$D$Fp|$ GGe e$ š$>D$$ h~ * $$@#T$D$Gpp|$ GGe ^e$ š$>D$$ l~ * $$@#T$D$Hp|$ GGe d$ š$=D$$ p~ * $$@#T$D$Io|$ GGe fd$ š$C=D$$ t~ * $$@#T$D$J/o|$ GGe c$ š$<D$$ x~ * $$@#T$D$Kn|$ GGe nc$ š$m<D$$ |~ * $$@#T$D$LYn|$ GGe b$ š$<D$$ ~ * $$@#T$D$Mm|$ GGe vb$ š$;D$$ ~ * $$@#T$D$Nm|$ GGe a$ š$,;D$$ ~ * $$@#T$D$Om|$ GGe ~a$ š$:D$$ ~ * $$@#T$D$Pl|$ GGe a$ š$V:D$$ ~ * $$@#T$D$QBl|$ GGe `$ š$9D$$ ~ * $$@#T$D$Rk|$ GGe  `$ š$9D$$ ~ * $$@#T$D$Slk|$ GGe _$ š$9D$$ ~ * $$@#T$D$Tk|$ GGe _$ š$8D$$ ~ * $$@#T$D$Uj|$ GGe ^$ š$?8D$$ ~ * $$@#T$D$V+j|$ GGe ^$`$7D$$ H * $$@#T$D$i|$ GGe ]$ š$`7D$$ ~ * $$@#T$D$Li|$ GGe ]$ š$6D$$ ~ * $$@#T$D$h|$ GGe \$ š$6D$$ ~ * $$@#T$D$vh|$ GGe !\$ š$6D$$ ~ * $$@#T$D$ h|$ GGe [$ š$5D$$ ~ * $$@#T$D$g|$ GGe )[$ š$I5D$$ ~ * $$@#T$D$ 5g|$ GGe Z$ š$4D$$ ~ * $$@#T$D$ f|$ GGe 1Z$ š$s4D$$| ~ * $$@#T$D$_f|$ GGe Y$| š$4D$$x ~ * $$@#T$D$e|$ GGe 9Y$x š$3D$$t ~ * $$@#T$D$e|$ GGe X$t š$23D$$p ~ * $$@#T$D$e|$ GGe AX$p š$2D$$l ~ * $$@#T$D$d|$ GGe W$l š$\2D$$h ~ * $$@#T$D$Hd|$ GGe IW$h š$1D$$d ~ * $$@#T$D$c|$ GGe V$d š$1D$$` ~ * $$@#T$D$rc|$ GGe QV$` š$1D$$\ ~ * $$@#T$D$c|$ GGe U$\ š$0D$$X ~ * $$@#T$D$ b|$ GGe YU$X š$E0D$$T ~ * $$@#T$D$"1b|$ GGe T$T š$/D$$P ~ * $$@#T$D$$a|$ GGe aT$P š$o/D$$L  * $$@#T$D$&[a|$ GGe S$L š$/D$$H  * $$@#T$D$(`|$ GGe iS$H š$.D$$D  * $$@#T$D$*`|$ GGe R$D š$..D$$@  * $$@#T$D$,`|$ GGe qR$@ š$-D$$<  * $$@#T$D$._|$ GGe Q$< š$X-D$$8  * $$@#T$D$0D_|$ GGe yQ$8 š$,D$$4  * $$@#T$D$2^|$ GGe P$4 š$,D$$0  * $$@#T$D$4n^|$ GGe P$0 š$,D$$, $ * $$@#T$D$6^|$ GGe P$, š$+D$$( ( * $$@#T$D$8]|$ GGe O$( š$A+D$$$ 0 * $$@#T$D$:-]|$ GGe  O$$ š$*D$$  4 * $$@#T$D$<\|$ GGe N$  š$k*D$$ 8 * $$@#T$D$>W\|$ GGe N$ š$*D$$ < * $$@#T$D$@[|$ GGe M$ š$)D$$ @ * $$@#T$D$B[|$ GGe M$ š$*)D$$ D * $$@#T$D$D[|$ GGe L$ š$(D$$  H * $$@#T$D$FZ|$ GGe %L$  š$T(D$$ L * $$@#T$D$H@Z|$ GGe K$ š$'D$$ P * $$@#T$D$JY|$ GGe -K$ š$~'D$$ T * $$@#T$D$LjY|$ GGe J$ š$'D$$ \ * $$@#T$D$NX|$ GGe 5J$ š$&D$$ ` * $$@#T$D$PX|$ GGe I$ š$=&D$$ d * $$@#T$D$R)X|$ GGe =I$ š$%D$$ h * $$@#T$D$TW|$ GGe H$ š$g%D$$ l * $$@#T$D$VSW|$ GGe EH$ š$$D$$ p * $$@#T$D$XV|$ GGe G$ š$$D$$ t * $$@#T$D$Z}V|$ GGe MG$ š$&$D$$ x * $$@#T$D$\V|$ GGe F$ š$#D$$ | * $$@#T$D$^U|$ GGe UF$ š$P#D$$  * $$@#T$D$`$ š$D$$  * $$@#T$D$N|$ GGe >$ š$5D$$  * $$@#T$D$!N|$ GGe =$ š$D$$  * $$@#T$D$M|$ GGe !=$ š$_D$$  * $$@#T$D$KM|$ GGe <$ š$D$$  * $$@#T$D$L|$ GGe )<$ š$D$$  * $$@#T$D$uL|$ GGe ;$ š$D$$  * $$@#T$D$ L|$ GGe 1;$ š$D$$|  * $$@#T$D$K|$ GGe :$| š$HD$$x  * $$@#T$D$4K|$ GGe 9:$x š$D$$t  * $$@#T$D$J|$ GGe 9$t š$rD$$p  * $$@#T$D$^J|$ GGe A9$p`$D$$l ĩP * $$@#T$D$I|$ GGe 8$l`$D$$h ȩ̩P * $$@#T$D$vI|$ GGe 78$h`$D$$d ЩԩP * $$@#T$D$I|$ GGe 7$d`$D$$` ةܩP * $$@#T$D$H|$ GGe -7$``$7D$$\ P * $$@#T$D$H|$ GGe 6$\ š$D$$X  * $$@#T$D$G|$ GGe ,6$X š$XD$$T  * $$@#T$D$DG|$ GGe 5$T š$D$$P  * $$@#T$D$F|$ GGe 45$P š$D$$L  * $$@#T$D$nF|$ GGe 4$L š$D$$H  * $$@#T$D$F|$ GGe <4$H š$D$$D  * $$@#T$D$E|$ GGe 3$D š$AD$$@  * $$@#T$D$-E|$ GGe D3$@ š$D$$<  * $$@#T$D$D|$ GGe 2$< š$kD$$8  * $$@#T$D$WD|$ GGe L2$8 š$D$$4 $ * $$@#T$D$C|$ GGe 1$4 š$D$$0 ( * $$@#T$D$C|$ GGe T1$0 š$*D$$, , * $$@#T$D$C|$ GGe 0$, š$D$$( 0 * $$@#T$D$B|$ GGe \0$( š$TD$$$ 4 * $$@#T$D$@B|$ GGe /$$ š$D$$  8 * $$@#T$D$A|$ GGe d/$  š$~D$$ < * $$@#T$D$jA|$ GGe .$ š$D$$ @ * $$@#T$D$@|$ GGe l.$ š$D$$ D * $$@#T$D$@|$ GGe -$ š$=D$$ H * $$@#T$D$)@|$ GGe t-$ š$ D$$  P * $$@#T$D$?|$ GGe ,$  š$g D$$ T * $$@#T$D$S?|$ GGe |,$ š$ D$$ X * $$@#T$D$>|$ GGe ,$ š$ D$$ \ * $$@#T$D$}>|$ GGe +$ š$& D$$ ` * $$@#T$D$>|$ GGe +$ š$ D$$ d * $$@#T$D$=|$ GGe *$ š$P D$$ h * $$@#T$D$<=|$ GGe *$ š$ D$$ l * $$@#T$D$<|$ GGe )$ š$z D$$ p * $$@#T$D$f<|$ GGe )$ š$ D$$ t * $$@#T$D$;|$ GGe ($ š$ D$$ | * $$@#T$D$;|$ GGe  ($ š$9 D$$  * $$@#T$D$%;|$ GGe '$ š$D$$  * $$@#T$D$:|$ GGe ('$ š$cD$$  * $$@#T$D$O:|$ GGe &$ š$D$$  * $$@#T$D$9|$ GGe 0&$ š$D$$  * $$@#T$D$y9|$ GGe %$ š$"D$$  * $$@#T$D$9|$ GGe 8%$ š$D$$  * $$@#T$D$8|$ GGe $$ š$LD$$  * $$@#T$D$88|$ GGe @$$ š$D$$  * $$@#T$D$7|$ GGe #$ š$vD$$  * $$@#T$D$b7|$ GGe H#$ š$ D$$  * $$@#T$D$6|$ GGe "$ š$D$$  * $$@#T$D$6|$ GGe P"$ š$5D$$  * $$@#T$D$!6|$ GGe !$ š$D$$  * $$@#T$D$5|$ GGe X!$ š$_D$$  * $$@#T$D$K5|$ GGe  $ š$D$$  * $$@#T$D$4|$ GGe ` $ š$D$$ Ā * $$@#T$D$u4|$ GGe $ š$D$$ Ȁ * $$@#T$D$  4|$ GGe h$ š$D$$ ̀ * $$@#T$D$ 3|$ GGe $ š$HD$$ Ԁ * $$@#T$D$ 43|$ GGe p$ š$D$$ ؀ * $$@#T$D$ 2|$ GGe $ š$rD$$ ܀ * $$@#T$D$ ^2|$ GGe x$ š$D$$  * $$@#T$D$1|$ GGe $ š$~D$$  * $$@#T$D$1|$ GGe $ š$1~D$$  * $$@#T$D$1|$ GGe $ š$~D$$|  * $$@#T$D$0|$ GGe $| š$[~D$$x  * $$@#T$D$G0|$ GGe  $x š$~D$$t  * $$@#T$D$/|$ GGe $t š$~D$$p  * $$@#T$D$q/|$ GGe $p š$~D$$l  * $$@#T$D$/|$ GGe $l š$~D$$h  * $$@#T$D$(.|$ GGe $h š$D~D$$d  * $$@#T$D$)0.|$ GGe $d š$~D$$`  * $$@#T$D$*-|$ GGe $$` š$n~D$$\  * $$@#T$D$+Z-|$ GGe $\ š$~D$$X  * $$@#T$D$,,|$ GGe ,$X š$~D$$T  * $$@#T$D$-,|$ GGe $T š$-~D$$P  * $$@#T$D$.,|$ GGe 4$P š$~D$$L  * $$@#T$D$/+|$ GGe $L š$W~D$$H $ * $$@#T$D$8C+|$ GGe <$H š$~D$$D , * $$@#T$D$9*|$ GGe $D š$~D$$@ 0 * $$@#T$D$:m*|$ GGe D$@ š$~D$$< 4 * $$@#T$D$;*|$ GGe $< š$~D$$8 8 * $$@#T$D$<)|$ GGe L$8 š$@~D$$4 < * $$@#T$D$=,)|$ GGe $4 š$~D$$0 @ * $$@#T$D$>(|$ GGe T$0 š$j~D$$, D * $$@#T$D$?V(|$ GGe $, š$~D$$( H * $$@#T$D$H'|$ GGe \$( š$~D$$$ L * $$@#T$D$I'|$ GGe $$ š$)~D$$  P * $$@#T$D$J'|$ GGe d$  š$~D$$ X * $$@#T$D$K&|$ GGe $ š$S~D$$ \ * $$@#T$D$L?&|$ GGe l$ š$~D$$ ` * $$@#T$D$M%|$ GGe $`$}~D$$ P * $$@#T$D$P`%|$ GGe k$$ ~|$$ 5(P*$$@#L$D$R$|$ GGe  $ $~|$$58P*$$@#L$D$T$|$ GGe m $$-~|$$5HO*$$@#L$D$V$|$ GGe  $ š$~D$$ d * $$@#T$D$Y#|$ GGe r $ š$T~D$$ h * $$@#T$D$[@#|$ GGe  $ š$~D$$ l * $$@#T$D$]"|$ GGe z $ š$~~D$$ t * $$@#T$D$_j"|$ GGe  $ š$~D$$ x * $$@#T$D$h!|$ GGe  $ š$~D$$ | * $$@#T$D$i!|$ GGe  $ š$=~D$$  * $$@#T$D$j)!|$ GGe  $ š$~D$$  * $$@#T$D$k |$ GGe  $ š$g~D$$  * $$@#T$D$lS |$ GGe $ š$~D$$  * $$@#T$D$m|$ GGe $ š$~D$$  * $$@#T$D$n}|$ GGe $ š$&~D$$  * $$@#T$D$o|$ GGe $`$~D$$ P * $$@#T$D$|$ GGe $`$G~D$$ P * $$@#T$D$*|$ GGe $`$~D$$ H * $$@#T$D$|$ GGe $`$_~D$$  P * $$@#T$D$B|$ GGe  $`$~D$$ P * $$@#T$D$|$ GGe $`$w~D$$ P * $$@#T$D$Z|$ GGe $`$~D$$ $P * $$@#T$D$|$ GGe {$`$~D$$ (,P * $$@#T$D$r|$ GGe $`$~D$$ 40H * $$@#T$D$|$ GGe q$`$~D$$ 8<P * $$@#T$D$|$ GGe $`$3~D$$ @DP * $$@#T$D$|$ GGe g$`$~D$$ HLP * $$@#T$D$|$ GGe $`$K~D$$ PTP * $$@#T$D$.|$ GGe ]$`$~D$$ X\P * $$@#T$D$|$ GGe $`$c~D$$ d`H * $$@#T$D$F|$ GGe S$`$~D$$ hlP * $$@#T$D$|$ GGe $`${~D$$ ptP * $$@#T$D$^|$ GGe I$`$~D$$ x|P * $$@#T$D$|$ GGe $`$~D$$ P * $$@#T$D$v|$ GGe ?$`$~D$$ P * $$@#T$D$|$ GGe $`$~D$$ H * $$@#T$D$|$ GGe 5$`$7~D$$| P * $$@#T$D$|$ GGe $|`$~D$$x P * $$@#T$D$|$ GGe +$x`$O~D$$t P * $$@#T$D$2|$ GGe $t`$~D$$p P * $$@#T$D$|$ GGe !$p`$g~D$$l P * $$@#T$D$J|$ GGe $l`$~D$$h ĪH * $$@#T$D$|$ GGe $h`$~D$$d Ȫ̪P * $$@#T$D$b|$ GGe $d`$ ~D$$` ЪԪP * $$@#T$D$|$ GGe  $``$~D$$\ تܪP * $$@#T$D$z|$ GGe $\`$#~D$$X P * $$@#T$D$|$ GGe $X`$~D$$T P * $$@#T$D$|$ GGe ~$T`$;~D$$P H * $$@#T$D$|$ GGe $P`$~D$$L P * $$@#T$D$|$ GGe t$L`$S~D$$H P * $$@#T$D$6|$ GGe $H`$~D$$D  P * $$@#T$D$|$ GGe j$D`$k~D$$@ P * $$@#T$D$N|$ GGe $@`$~D$$< P * $$@#T$D$ |$ GGe `$<`$~D$$8 $ H * $$@#T$D$f |$ GGe $8`$~D$$4 (,P * $$@#T$D$ |$ GGe V$4`$~D$$0 04P * $$@#T$D$~ |$ GGe $0`$'~D$$, 8<P * $$@#T$D$ |$ GGe L$,`$~D$$( @DP * $$@#T$D$ |$ GGe $(`$?~D$$$ HLP * $$@#T$D$" |$ GGe B$$`$~D$$  TPH * $$@#T$D$ |$ GGe $ `$W~D$$ X\P * $$@#T$D$: |$ GGe 8$`$~D$$ `dP * $$@#T$D$ |$ GGe $`$o~D$$ hlP * $$@#T$D$R |$ GGe .$`$~D$$ ptP * $$@#T$D$|$ GGe $`$~D$$  x|P * $$@#T$D$j|$ GGe $$ `$~D$$ P * $$@#T$D$|$ GGe $`$~D$$ H * $$@#T$D$|$ GGe $$+~|$$5X2*$$@#L$D$|$ GGe $ š$~D$$  * $$@#T$D$|$ GGe $ š$R~D$$  * $$@#T$D$>|$ GGe $ š$~D$$  * $$@#T$D$|$ GGe '$ š$|~D$$  * $$@#T$D$h|$ GGe $`$~D$$ P * $$@#T$D$|$ GGe &$ š$~D$$  * $$@#T$D$|$ GGe $`$2~D$$ P * $$@#T$D$|$ GGe %$`$~D$$ P * $$@#T$D$|$ GGe $`$J~D$$ P * $$@#T$D$-|$ GGe $`$~D$$ P * $$@#T$D$|$ GGe $$b~|$$5h-*$$@#L$D$K|$ GGe $ š$~D$$ ȁ * $$@#T$D$|$ GGe $ š$~D$$ ́ * $$@#T$D$u|$ GGe $ š$~D$$ Ё * $$@#T$D$ |$ GGe $ š$~D$$ ԁ * $$@#T$D$|$ GGe '$`$H~D$$ P * $$@#T$D$+|$ GGe $$~|$$5xP+*$$@#L$D$~|$ GGe #$$f~|$$5**$$@#L$D$O~|$ GGe $`$~D$$ īP * $$@#T$D$~|$ GGe $$~|$$5**$$@#L$D$m~|$ GGe $ š$~D$$ ܁ * $$@#T$D$~|$ GGe $$ š$~D$$  * $$@#T$D$~|$ GGe $ š$@~D$$  * $$@#T$D$,~|$ GGe ,$ š$~D$$  * $$@#T$D$~|$ GGe $$j~|$$5'*$$@#L$D$S~|$ GGe 1$$~|$$5x'*$$@#L$D$~|$ GGe $`$~D$$ ȫ̫P * $$@#T$D$q~|$ GGe -$`$~D$$ ЫԫP * $$@#T$D$~|$ GGe $$~|$$5"&*$$@#L$D$~|$ GGe )$ š$8~D$$  * $$@#T$D$$~|$ GGe $ š$~D$$  * $$@#T$D$~|$ GGe 1$ š$b~D$$  * $$@#T$D$N~|$ GGe $ š$~D$$|  * $$@#T$D$~|$ GGe 9$| š$~D$$x  * $$@#T$D$x~|$ GGe $x`$!~D$$t ܫثH * $$@#T$D$~|$ GGe 8$t`$~D$$p P * $$@#T$D$~|$ GGe $p`$9~D$$l P * $$@#T$D$~|$ GGe .$l`$~D$$h P * $$@#T$D$~|$ GGe $h$Q~|$$d5!*$$@#L$D$:~|$ GGe *$d š$~D$$`  * $$@#T$D$~|$ GGe $` š$x~D$$\  * $$@#T$D$d~|$ GGe 2$\ š$ ~D$$X  * $$@#T$D$~|$ GGe $X š$~D$$T  * $$@#T$D$~|$ GGe :$T`$7~D$$P H * $$@#T$D$~|$ GGe $P`$~D$$L P * $$@#T$D$ ~|$ GGe 0$L š$O~D$$H  * $$@#T$D$!;~|$ GGe $H`$~D$$D  P * $$@#T$D$!~|$ GGe /$D š$p~D$$@  * $$@#T$D$!\~|$ GGe $@`$~D$$< P * $$@#T$D$ !~|$ GGe .$< š$葿~D$$8 $ * $$@#T$D$ !}~|$ GGe $8 š$&~D$$4 ( * $$@#T$D$ !~|$ GGe 6$4 š$軾~D$$0 , * $$@#T$D$ !~|$ GGe $0 š$P~D$$, 0 * $$@#T$D$!<~|$ GGe >$, š$~D$$( 4 * $$@#T$D$!~|$ GGe $( š$z~D$$$ 8 * $$@#T$D$!f~|$ GGe F$$ š$~D$$  < * $$@#T$D$!~|$ GGe $ `$褼~D$$ P * $$@#T$D$!~|$ GGe E$ š$0~D$$ @ * $$@#T$D$!~|$ GGe $ š$Ż~D$$ H * $$@#T$D$!~|$ GGe M$ š$Z~D$$ L * $$@#T$D$!F~|$ GGe $ š$~D$$  P * $$@#T$D$!~|$ GGe U$  š$脺~D$$ T * $$@#T$D$!p~|$ GGe $`$~D$$ $ H * $$@#T$D$ !~|$ GGe T$$襹~|$$5!*$$@#L$D$!!~|$ GGe $`$7~D$$ (,P * $$@#T$D$"!~|$ GGe P$ š$ø~D$$ X * $$@#T$D$$!~|$ GGe $ š$X~D$$ \ * $$@#T$D$&!D~|$ GGe X$ š$~D$$ ` * $$@#T$D$(!~|$ GGe $ š$肷~D$$ h * $$@#T$D$*!n~|$ GGe `$ š$~D$$ l * $$@#T$D$+!~|$ GGe $ š$謶~D$$ p * $$@#T$D$,!~|$ GGe h$ š$A~D$$ t * $$@#T$D$-!-~|$ GGe $ š$ֵ~D$$ x * $$@#T$D$0!~|$ GGe p$ š$k~D$$ | * $$@#T$D$1!W~|$ GGe $ š$~D$$  * $$@#T$D$3!~|$ GGe x$ š$蕴~D$$  * $$@#T$D$>!~|$ GGe $ š$*~D$$  * $$@#T$D$?!~|$ GGe $ š$迳~D$$  * $$@#T$D$E!~|$ GGe $ š$T~D$$  * $$@#T$D$`!@~|$ GGe $ š$~D$$  * $$@#T$D$a!~|$ GGe  $ š$~~D$$  * $$@#T$D$b!j~|$ GGe $ š$~D$$  * $$@#T$D$c!~|$ GGe $ š$許~D$$  * $$@#T$D$d!~|$ GGe $ š$=~D$$  * $$@#T$D$e!)~|$ GGe $ š$Ұ~D$$  * $$@#T$D$f!~|$ GGe $ š$g~D$$  * $$@#T$D$g!S~|$ GGe $$ š$~D$$  * $$@#T$D$h!~|$ GGe $ š$葯~D$$  * $$@#T$D$i!}~|$ GGe ,$ š$&~D$$  * $$@#T$D$j!~|$ GGe $ š$軮~D$$ Ă * $$@#T$D$k!~|$ GGe 4$ š$P~D$$ Ȃ * $$@#T$D$l!<~|$ GGe $ š$~D$$ ̂ * $$@#T$D$m!~|$ GGe <$ š$z~D$$ Ђ * $$@#T$D$n!f~|$ GGe $ š$~D$$ Ԃ * $$@#T$D$o!~|$ GGe D$ š$褬~D$$ ؂ * $$@#T$D$$~|$ GGe ȼ$ š$9~D$$ ܂ * $$@#T$D$$%~|$ GGe L$ š$Ϋ~D$$|  * $$@#T$D$$~|$ GGe л$| š$c~D$$x  * $$@#T$D$$O~|$ GGe T$x š$~D$$t  * $$@#T$D$$~|$ GGe غ$t š$荪~D$$p  * $$@#T$D$$y~|$ GGe \$p š$"~D$$l  * $$@#T$D$$~|$ GGe $l š$跩~D$$h  * $$@#T$D$$~|$ GGe d$h š$L~D$$d  * $$@#T$D$$8~|$ GGe $d š$~D$$`  * $$@#T$D$$~|$ GGe l$` š$v~D$$\  * $$@#T$D$$b~|$ GGe $\ š$ ~D$$X  * $$@#T$D$$~|$ GGe t$X š$蠧~D$$T  * $$@#T$D$$~|$ GGe $T š$5~D$$P  * $$@#T$D$$!~|$ GGe |$P š$ʦ~D$$L  * $$@#T$D$$~|$ GGe $L š$_~D$$H  * $$@#T$D$$K~|$ GGe $H š$~D$$D  * $$@#T$D$$~|$ GGe $D š$艥~D$$@ $ * $$@#T$D$$u~|$ GGe $@ š$~D$$< ( * $$@#T$D$$ ~|$ GGe $< š$賤~D$$8 , * $$@#T$D$$~|$ GGe $8 š$H~D$$4 0 * $$@#T$D$$4~|$ GGe $4 š$ݣ~D$$0 4 * $$@#T$D$$~|$ GGe $0 š$r~D$$, 8 * $$@#T$D$$^~|$ GGe  $, š$~D$$( < * $$@#T$D$$~|$ GGe $( š$蜢~D$$$ D * $$@#T$D$$~|$ GGe ($$ š$1~D$$  H * $$@#T$D$$~|$ GGe $ $ơ~|$$5B*$$@#L$D$q3~|$ GGe -$`$X~D$$ 04P * $$@#T$D$s3;~|$ GGe $`$~D$$ 8<P * $$@#T$D$u3~|$ GGe #$`$p~D$$ @DP * $$@#T$D$3S~|$ GGe $`$~D$$  HLP * $$@#T$D$3~|$ GGe $ `$舟~D$$ TPH * $$@#T$D$3k~|$ GGe $`$~D$$ X\P * $$@#T$D$3~|$ GGe $`$蠞~D$$ `dP * $$@#T$D$3~|$ GGe $`$,~D$$ hlP * $$@#T$D$3~|$ GGe $`$踝~D$$ ptP * $$@#T$D$3~|$ GGe $`$D~D$$ x|P * $$@#T$D$3'~|$ GGe $`$М~D$$ H * $$@#T$D$3~|$ GGe v$`$\~D$$ P * $$@#T$D$3?~|$ GGe $`$~D$$ P * $$@#T$D$3~|$ GGe l$`$t~D$$ P * $$@#T$D$3W~|$ GGe $$~|$$5|*$$@#L$D$3~|$ GGe h$$蒚~|$$5*$$@#L$D$3{~|$ GGe $$$~|$$5(*$$@#L$D$3 ~|$ GGe j$$趙~|$$582*$$@#L$D$3~|$ GGe $`$H~D$$ P * $$@#T$D$3+~|$ GGe f$$Ԙ~|$$5HP*$$@#L$D$3~|$ GGe $$f~|$$5X*$$@#L$D$3O~|$ GGe h$$~|$$5ht*$$@#L$D$3~|$ GGe $`$芗~D$$ P * $$@#T$D$3m~|$ GGe d$`$~D$$ P * $$@#T$D$3~|$ GGe ߣ$`$袖~D$$ P * $$@#T$D$3~|$ GGe Z$`$.~D$$ ĬH * $$@#T$D$3~|$ GGe բ$`$躕~D$$ Ȭ̬P * $$@#T$D$3~|$ GGe P$`$F~D$$ ЬԬP * $$@#T$D$3)~|$ GGe ˡ$`$Ҕ~D$$ جܬP * $$@#T$D$3~|$ GGe F$`$^~D$$ P * $$@#T$D$3A~|$ GGe $`$~D$$ P * $$@#T$D$3~|$ GGe <$`$v~D$$ H * $$@#T$D$3Y~|$ GGe $`$~D$$ P * $$@#T$D$3~|$ GGe 2$`$莒~D$$ P * $$@#T$D$3q~|$ GGe $`$~D$$  P * $$@#T$D$3~|$ GGe ($`$覑~D$$ P * $$@#T$D$3~|$ GGe $`$2~D$$ P * $$@#T$D$3~|$ GGe $` $辐~|$$50*$$@#L$D$3~|$ GGe $$P~|$$5x*$$@#L$D$39~|$ GGe  $`$~D$$| $P * $$@#T$D$3~|$ GGe $|`$n~D$$x (,P * $$@#T$D$3Q~|$ GGe $x`$~D$$t 04P * $$@#T$D$3~|$ GGe $t`$膎~D$$p 8<P * $$@#T$D$3i~|$ GGe  $p`$~D$$l D@H * $$@#T$D$3~|$ GGe $l`$融~D$$h HLP * $$@#T$D$3聿~|$ GGe $h$*~|$$d5*$$@#L$D$3~|$ GGe $d`$輌~D$$` TPH * $$@#T$D$3蟾~|$ GGe $``$H~D$$\ X\P * $$@#T$D$3+~|$ GGe y$\`$ԋ~D$$X `dP * $$@#T$D$3跽~|$ GGe $X`$`~D$$T hlP * $$@#T$D$C~|$ GGe o$T`$~D$$P ptP * $$@#T$D$ϼ~|$ GGe $P`$x~D$$L x|P * $$@#T$D$[~|$ GGe e$L$~|$$H5*$$@#L$D$~|$ GGe $H$薉~|$$D5*$$@#L$D$~|$ GGe g$D`$(~D$$@ P * $$@#T$D$ ~|$ GGe $@`$贈~D$$< P * $$@#T$D$藺~|$ GGe ]$<`$@~D$$8 P * $$@#T$D$#~|$ GGe ؒ$8`$̇~D$$4 P * $$@#T$D$诹~|$ GGe S$4`$X~D$$0 H * $$@#T$D$;~|$ GGe Α$0`$~D$$, P * $$@#T$D$Ǹ~|$ GGe I$,`$p~D$$( P * $$@#T$D$S~|$ GGe Đ$( š$~D$$$ d * $$@#T$D$!~|$ GGe H$$ š$葅~D$$  h * $$@#T$D$"}~|$ GGe ̏$  š$&~D$$ l * $$@#T$D$#~|$ GGe P$ š$軄~D$$ p * $$@#T$D$$觶~|$ GGe Ԏ$ š$P~D$$ t * $$@#T$D$%<~|$ GGe X$ š$~D$$ x * $$@#T$D$&ѵ~|$ GGe ܍$ š$z~D$$   * $$@#T$D$'f~|$ GGe `$  š$~D$$  * $$@#T$D$(~|$ GGe $ š$褂~D$$  * $$@#T$D$)萴~|$ GGe h$ š$9~D$$  * $$@#T$D$*%~|$ GGe $ š$΁~D$$  * $$@#T$D$+躳~|$ GGe p$ š$c~D$$  * $$@#T$D$,O~|$ GGe $ š$~D$$  * $$@#T$D$-~|$ GGe x$ š$荀~D$$  * $$@#T$D$.y~|$ GGe $ š$"~D$$  * $$@#T$D$/~|$ GGe $ š$~D$$  * $$@#T$D$0裱~|$ GGe $ š$L~D$$  * $$@#T$D$18~|$ GGe $ š$~~D$$  * $$@#T$D$2Ͱ~|$ GGe  $ š$v~~D$$  * $$@#T$D$3b~|$ GGe $ š$ ~~D$$  * $$@#T$D$4~|$ GGe $ š$}~D$$  * $$@#T$D$5茯~|$ GGe $ š$5}~D$$  * $$@#T$D$6!~|$ GGe $ š$|~D$$ ă * $$@#T$D$7趮~|$ GGe $ š$_|~D$$ ȃ * $$@#T$D$8K~|$ GGe $$ š${~D$$ ̃ * $$@#T$D$9~|$ GGe $ š${~D$$ Ѓ * $$@#T$D$:u~|$ GGe ,$ š${~D$$ ԃ * $$@#T$D$ ~|$ GGe $ š$z~D$$ ؃ * $$@#T$D$蟬~|$ GGe 4$ š$Hz~D$$ ܃ * $$@#T$D$4~|$ GGe $ š$y~D$$  * $$@#T$D$ɫ~|$ GGe <$ š$ry~D$$  * $$@#T$D$^~|$ GGe $ š$y~D$$  * $$@#T$D$~|$ GGe D$ š$x~D$$  * $$@#T$D$航~|$ GGe Ȁ$ š$1x~D$$  * $$@#T$D$~|$ GGe L$ š$w~D$$  * $$@#T$D$販~|$ GGe $ š$[w~D$$  * $$@#T$D$ G~|$ GGe T$ š$v~D$$  * $$@#T$D$ ܨ~|$ GGe ~$ š$v~D$$  * $$@#T$D$ q~|$ GGe \~$ š$v~D$$  * $$@#T$D$ ~|$ GGe }$ š$u~D$$  * $$@#T$D$ 蛧~|$ GGe d}$ š$Du~D$$  * $$@#T$D$0~|$ GGe |$ š$t~D$$  * $$@#T$D$Ŧ~|$ GGe l|$ š$nt~D$$|  * $$@#T$D$Z~|$ GGe {$| š$t~D$$x  * $$@#T$D$~|$ GGe t{$x š$s~D$$t  * $$@#T$D$脥~|$ GGe z$t š$-s~D$$p $ * $$@#T$D$~|$ GGe |z$p š$r~D$$l , * $$@#T$D$认~|$ GGe z$l š$Wr~D$$h 0 * $$@#T$D$C~|$ GGe y$h š$q~D$$d 4 * $$@#T$D$أ~|$ GGe y$d š$q~D$$` 8 * $$@#T$D$m~|$ GGe x$` š$q~D$$\ < * $$@#T$D$~|$ GGe x$\ š$p~D$$X @ * $$@#T$D$藢~|$ GGe w$X š$@p~D$$T D * $$@#T$D$,~|$ GGe w$T š$o~D$$P H * $$@#T$D$~|$ GGe v$P š$jo~D$$L L * $$@#T$D$V~|$ GGe  v$L š$n~D$$H P * $$@#T$D$~|$ GGe u$H š$n~D$$D X * $$@#T$D$耠~|$ GGe (u$D š$)n~D$$@ \ * $$@#T$D$~|$ GGe t$@ š$m~D$$< ` * $$@#T$D$ 誟~|$ GGe 0t$< š$Sm~D$$8 d * $$@#T$D$!?~|$ GGe s$8 š$l~D$$4 h * $$@#T$D$"Ԟ~|$ GGe 8s$4 š$}l~D$$0 l * $$@#T$D$#i~|$ GGe r$0 š$l~D$$, p * $$@#T$D$$~|$ GGe @r$, š$k~D$$( t * $$@#T$D$%蓝~|$ GGe q$( š$~|$ GGe _$ š$[~D$$  * $$@#T$D$?豍~|$ GGe \_$ š$Z[~D$$  * $$@#T$D$@F~|$ GGe ^$ š$Z~D$$ $ * $$@#T$D$Aی~|$ GGe d^$ š$Z~D$$ ( * $$@#T$D$Bp~|$ GGe ]$ š$Z~D$$ , * $$@#T$D$C~|$ GGe l]$ š$Y~D$$| f * $$@#T$D$D蚋~|$ GGe \$| š$CY~D$$x f * $$@#T$D$E/~|$ GGe t\$x š$X~D$$t f * $$@#T$D$FĊ~|$ GGe [$t š$mX~D$$p f * $$@#T$D$GY~|$ GGe |[$p š$X~D$$l f * $$@#T$D$H~|$ GGe [$l š$W~D$$h f * $$@#T$D$I胉~|$ GGe Z$h š$,W~D$$d f * $$@#T$D$J~|$ GGe Z$d š$V~D$$` f * $$@#T$D$K譈~|$ GGe Y$` š$VV~D$$\ f * $$@#T$D$LB~|$ GGe Y$\ š$U~D$$X f * $$@#T$D$Mׇ~|$ GGe X$X š$U~D$$T f * $$@#T$D$hl~|$ GGe X$T š$U~D$$P f * $$@#T$D$i~|$ GGe W$P š$T~D$$L f * $$@#T$D$j薆~|$ GGe  W$L š$?T~D$$H f * $$@#T$D$k+~|$ GGe V$H š$S~D$$D f * $$@#T$D$l~|$ GGe (V$D š$iS~D$$@ f * $$@#T$D$mU~|$ GGe U$@ š$R~D$$< f * $$@#T$D$n~|$ GGe 0U$< š$R~D$$8 f * $$@#T$D$o~|$ GGe T$8 š$(R~D$$4 f * $$@#T$D$p~|$ GGe 8T$4 š$Q~D$$0 f * $$@#T$D$q詃~|$ GGe S$0 š$RQ~D$$, f * $$@#T$D$r>~|$ GGe @S$, š$P~D$$( f * $$@#T$D$sӂ~|$ GGe R$( š$|P~D$$$ f * $$@#T$D$th~|$ GGe HR$$ š$P~D$$  f * $$@#T$D$u~|$ GGe Q$  š$O~D$$ f * $$@#T$D$v蒁~|$ GGe PQ$ š$;O~D$$ f * $$@#T$D$w'~|$ GGe P$ š$N~D$$ f * $$@#T$D$x輀~|$ GGe XP$ š$eN~D$$ g * $$@#T$D$yQ~|$ GGe O$ š$M~D$$  g * $$@#T$D$z~|$ GGe `O$  š$M~D$$ g * $$@#T$D${{~|$ GGe N$ š$$M~D$$ g * $$@#T$D$|~|$ GGe hN$ š$L~D$$ g * $$@#T$D$}~~|$ GGe M$ š$NL~D$$ g * $$@#T$D$~:~~|$ GGe pM$ š$K~D$$ g * $$@#T$D$}~|$ GGe L$ š$xK~D$$ g * $$@#T$D$d}~|$ GGe xL$ š$ K~D$$ $g * $$@#T$D$|~|$ GGe K$ š$J~D$$ (g * $$@#T$D$|~|$ GGe K$ š$7J~D$$ ,g * $$@#T$D$#|~|$ GGe K$ š$I~D$$ 0g * $$@#T$D${~|$ GGe J$ š$aI~D$$ 4g * $$@#T$D$M{~|$ GGe  J$ š$H~D$$ $ š$Y?~D$$ g * $$@#T$D$Eq~|$ GGe l>$ š$>~D$$| g * $$@#T$D$p~|$ GGe =$| š$>~D$$x g * $$@#T$D$op~|$ GGe t=$x š$>~D$$t g * $$@#T$D$p~|$ GGe <$t š$=~D$$p g * $$@#T$D$o~|$ GGe |<$p š$B=~D$$l g * $$@#T$D$.o~|$ GGe <$l š$<~D$$h g * $$@#T$D$n~|$ GGe ;$h š$l<~D$$d g * $$@#T$D$Xn~|$ GGe ;$d š$<~D$$` g * $$@#T$D$m~|$ GGe :$` š$;~D$$\ g * $$@#T$D$m~|$ GGe :$\ š$+;~D$$X g * $$@#T$D$m~|$ GGe 9$X š$:~D$$T g * $$@#T$D$l~|$ GGe 9$T š$U:~D$$P g * $$@#T$D$Al~|$ GGe 8$P š$9~D$$L g * $$@#T$D$k~|$ GGe  8$L š$9~D$$H g * $$@#T$D$kk~|$ GGe 7$H š$9~D$$D g * $$@#T$D$k~|$ GGe (7$D š$8~D$$@ g * $$@#T$D$j~|$ GGe 6$@ š$>8~D$$< g * $$@#T$D$*j~|$ GGe 06$< š$7~D$$8 g * $$@#T$D$i~|$ GGe 5$8 š$h7~D$$4 g * $$@#T$D$Ti~|$ GGe 85$4 š$6~D$$0 g * $$@#T$D$h~|$ GGe 4$0 š$6~D$$, g * $$@#T$D$ ~h~|$ GGe @4$, š$'6~D$$( h * $$@#T$D$ h~|$ GGe 3$( š$5~D$$$ h * $$@#T$D$ g~|$ GGe H3$$ š$Q5~D$$  h * $$@#T$D$=g~|$ GGe 2$  š$4~D$$ h * $$@#T$D$f~|$ GGe P2$ š${4~D$$ h * $$@#T$D$gf~|$ GGe 1$ š$4~D$$ h * $$@#T$D$e~|$ GGe X1$ š$3~D$$ h * $$@#T$D$e~|$ GGe 0$ š$:3~D$$  h * $$@#T$D$&e~|$ GGe `0$  š$2~D$$ $h * $$@#T$D$d~|$ GGe /$ š$d2~D$$ (h * $$@#T$D$Pd~|$ GGe h/$ š$1~D$$ ,h * $$@#T$D$c~|$ GGe .$ š$1~D$$ 0h * $$@#T$D$zc~|$ GGe p.$ š$#1~D$$ 4h * $$@#T$D$c~|$ GGe -$ š$0~D$$ 8h * $$@#T$D$b~|$ GGe x-$ š$M0~D$$ L_~|$ GGe )$ š$,~D$$ `h * $$@#T$D$@^~|$ GGe )$ š$,~D$$ dh * $$@#T$D$Av^~|$ GGe ($ š$,~D$$ hh * $$@#T$D$B ^~|$ GGe $($ š$+~D$$ ph * $$@#T$D$C]~|$ GGe '$ š$I+~D$$ th * $$@#T$D$D5]~|$ GGe ,'$ š$*~D$$ xh * $$@#T$D$F\~|$ GGe &$ š$s*~D$$ |h * $$@#T$D$J_\~|$ GGe 4&$ š$*~D$$ h * $$@#T$D$K[~|$ GGe %$ š$)~D$$ h * $$@#T$D$L[~|$ GGe <%$ š$2)~D$$ h * $$@#T$D$M[~|$ GGe $$ š$(~D$$ h * $$@#T$D$NZ~|$ GGe D$$ š$\(~D$$ h * $$@#T$D$OHZ~|$ GGe #$ š$'~D$$ h * $$@#T$D$PY~|$ GGe L#$ š$'~D$$ h * $$@#T$D$lrY~|$ GGe "$ š$'~D$$ h * $$@#T$D$mY~|$ GGe T"$ š$&~D$$ h * $$@#T$D$nX~|$ GGe !$ š$E&~D$$ h * $$@#T$D$o1X~|$ GGe \!$ š$%~D$$ h * $$@#T$D$pW~|$ GGe  $ š$o%~D$$ h * $$@#T$D$q[W~|$ GGe d $ š$%~D$$ h * $$@#T$D$rV~|$ GGe $ š$$~D$$ h * $$@#T$D$sV~|$ GGe l$ š$.$~D$$| h * $$@#T$D$tV~|$ GGe $| š$#~D$$x h * $$@#T$D$uU~|$ GGe t$x š$X#~D$$t h * $$@#T$D$vDU~|$ GGe $t š$"~D$$p h * $$@#T$D$wT~|$ GGe |$p š$"~D$$l h * $$@#T$D$xnT~|$ GGe $l š$"~D$$h h * $$@#T$D$yT~|$ GGe $h š$!~D$$d h * $$@#T$D$zS~|$ GGe $d š$A!~D$$` h * $$@#T$D${-S~|$ GGe $` š$ ~D$$\ h * $$@#T$D$|R~|$ GGe $\ š$k ~D$$X h * $$@#T$D$}WR~|$ GGe $X š$ ~D$$T h * $$@#T$D$~Q~|$ GGe $T š$~D$$P h * $$@#T$D$Q~|$ GGe $P š$*~D$$L h * $$@#T$D$Q~|$ GGe  $L š$~D$$H h * $$@#T$D$P~|$ GGe $H š$T~D$$D h * $$@#T$D$@P~|$ GGe ($D š$~D$$@ i * $$@#T$D$O~|$ GGe $@ š$~~D$$< i * $$@#T$D$jO~|$ GGe 0$< š$~D$$8 i * $$@#T$D$N~|$ GGe $8 š$~D$$4 i * $$@#T$D$N~|$ GGe 8$4 š$=~D$$0 i * $$@#T$D$)N~|$ GGe $0 š$~D$$, i * $$@#T$D$M~|$ GGe @$, š$g~D$$( i * $$@#T$D$SM~|$ GGe $( š$~D$$$ i * $$@#T$D$L~|$ GGe H$$ š$~D$$  $i * $$@#T$D$}L~|$ GGe $  š$&~D$$ (i * $$@#T$D$L~|$ GGe P$ š$~D$$ ,i * $$@#T$D$K~|$ GGe $ š$P~D$$ 0i * $$@#T$D$~|$ GGe $ š$[ ~D$$ i * $$@#T$D$G>~|$ GGe T$ š$ ~D$$ i * $$@#T$D$=~|$ GGe $ š$ ~D$$ i * $$@#T$D$q=~|$ GGe \$ š$ ~D$$ i * $$@#T$D$=~|$ GGe $ š$ ~D$$ i * $$@#T$D$<~|$ GGe d$ š$D ~D$$ i * $$@#T$D$0<~|$ GGe $ š$ ~D$$ i * $$@#T$D$;~|$ GGe l$ š$n ~D$$| i * $$@#T$D$Z;~|$ GGe $| š$ ~D$$x i * $$@#T$D$:~|$ GGe t$x š$~D$$t i * $$@#T$D$:~|$ GGe $t š$-~D$$p i * $$@#T$D$:~|$ GGe |$p š$~D$$l i * $$@#T$D$9~|$ GGe $l š$W~D$$h i * $$@#T$D$C9~|$ GGe $h š$~D$$d i * $$@#T$D$8~|$ GGe $d š$~D$$` i * $$@#T$D$ m8~|$ GGe $` š$~D$$\ i * $$@#T$D$ 8~|$ GGe $\ š$~D$$X i * $$@#T$D$ 7~|$ GGe $X š$@~D$$T j * $$@#T$D$ ,7~|$ GGe $T š$~D$$P j * $$@#T$D$ 6~|$ GGe $P š$j~D$$L j * $$@#T$D$V6~|$ GGe  $L š$~D$$H j * $$@#T$D$5~|$ GGe $H š$~D$$D j * $$@#T$D$5~|$ GGe ($D š$)~D$$@ j * $$@#T$D$5~|$ GGe $@ š$~D$$< j * $$@#T$D$4~|$ GGe 0$< š$S~D$$8 j * $$@#T$D$?4~|$ GGe $8 š$~D$$4 $j * $$@#T$D$3~|$ GGe 8$4 š$}~D$$0 (j * $$@#T$D$i3~|$ GGe $0 š$~D$$, ,j * $$@#T$D$2~|$ GGe @$, š$~D$$( 0j * $$@#T$D$2~|$ GGe $( š$<~D$$$ 4j * $$@#T$D$(2~|$ GGe H$$ š$}D$$  8j * $$@#T$D$1~|$ GGe $  š$f}D$$ $-~|$ GGe x$ š$}D$$ lj * $$@#T$D$?,~|$ GGe $ š$b}D$$ pj * $$@#T$D$@N,~|$ GGe $ š$}D$$ tj * $$@#T$D$A+~|$ GGe $ š$}D$$ |j * $$@#T$D$Bx+~|$ GGe $ š$!}D$$ j * $$@#T$D$C +~|$ GGe  $ š$}D$$ j * $$@#T$D$D*~|$ GGe $ š$K}D$$ j * $$@#T$D$E7*~|$ GGe $ š$}D$$ j * $$@#T$D$F)~|$ GGe $ š$u}D$$ j * $$@#T$D$Ga)~|$ GGe $ š$ }D$$ j * $$@#T$D$H(~|$ GGe $ š$}D$$ j * $$@#T$D$I(~|$ GGe $$ š$4}D$$ j * $$@#T$D$J (~|$ GGe $ š$}D$$ j * $$@#T$D$K'~|$ GGe ,$ š$^}D$$ j * $$@#T$D$LJ'~|$ GGe $ š$}D$$ j * $$@#T$D$M&~|$ GGe 4$ š$}D$$ j * $$@#T$D$Nt&~|$ GGe $ š$}D$$ j * $$@#T$D$O &~|$ GGe <$ š$}D$$ j * $$@#T$D$P%~|$ GGe $ š$G}D$$ j * $$@#T$D$Q3%~|$ GGe D$ š$}D$$ j * $$@#T$D$R$~|$ GGe $ š$q}D$$ j * $$@#T$D$S]$~|$ GGe L$ š$}D$$ j * $$@#T$D$T#~|$ GGe $ š$}D$$ j * $$@#T$D$U#~|$ GGe T$ š$0}D$$ j * $$@#T$D$p#~|$ GGe $ š$}D$$ j * $$@#T$D$q"~|$ GGe \$ š$Z}D$$ j * $$@#T$D$rF"~|$ GGe $ š$}D$$ j * $$@#T$D$s!~|$ GGe d$ š$}D$$ j * $$@#T$D$tp!~|$ GGe $ š$}D$$ j * $$@#T$D$u!~|$ GGe l$ š$}D$$| j * $$@#T$D$v ~|$ GGe $| š$C}D$$x j * $$@#T$D$w/ ~|$ GGe t$x š$}D$$t j * $$@#T$D$x~|$ GGe $t š$m}D$$p j * $$@#T$D$yY~|$ GGe |$p š$}D$$l k * $$@#T$D$z~|$ GGe $l š$}D$$h k * $$@#T$D${~|$ GGe $h š$,}D$$d k * $$@#T$D$|~|$ GGe $d š$}D$$` k * $$@#T$D$}~|$ GGe $` š$V}D$$\ k * $$@#T$D$~B~|$ GGe $\ š$}D$$X k * $$@#T$D$~|$ GGe $X š$}D$$T k * $$@#T$D$l~|$ GGe $T š$}D$$P k * $$@#T$D$~|$ GGe $P š$}D$$L k * $$@#T$D$~|$ GGe  $L š$?}D$$H $k * $$@#T$D$+~|$ GGe $H š$}D$$D ,k * $$@#T$D$~|$ GGe ($D š$i}D$$@ 0k * $$@#T$D$U~|$ GGe $@ š$}D$$< 4k * $$@#T$D$~|$ GGe 0$< š$}D$$8 8k * $$@#T$D$~|$ GGe $8 š$(}D$$4 ~|$ GGe @$, š$}D$$( Hk * $$@#T$D$~|$ GGe $( š$|}D$$$ Lk * $$@#T$D$h~|$ GGe H$$ š$}D$$  Pk * $$@#T$D$~|$ GGe $  š$}D$$ Xk * $$@#T$D$~|$ GGe P$ š$;}D$$ \k * $$@#T$D$'~|$ GGe $ š$}D$$ `k * $$@#T$D$~|$ GGe X$ š$e}D$$ dk * $$@#T$D$Q~|$ GGe $ š$}D$$  hk * $$@#T$D$~|$ GGe `$  š$}D$$ lk * $$@#T$D${~|$ GGe $ š$$}D$$ pk * $$@#T$D$~|$ GGe h$ š$}D$$ tk * $$@#T$D$~|$ GGe $ š$N}D$$ xk * $$@#T$D$:~|$ GGe p$ š$}D$$ |k * $$@#T$D$~|$ GGe $ š$x}D$$ k * $$@#T$D$d~|$ GGe x$ š$ }D$$ k * $$@#T$D$~|$ GGe $ š$}D$$ k * $$@#T$D$~|$ GGe $ š$7}D$$ k * $$@#T$D$#~|$ GGe $ š$}D$$ k * $$@#T$D$~|$ GGe $ š$a}D$$ k * $$@#T$D$M~|$ GGe  $ š$}D$$ k * $$@#T$D$~|$ GGe $ š$}D$$ k * $$@#T$D$w~|$ GGe $ š$ }D$$ k * $$@#T$D$ ~|$ GGe $ š$}D$$ k * $$@#T$D$~|$ GGe $ š$J}D$$ k * $$@#T$D$6~|$ GGe $ š$}D$$ k * $$@#T$D$ ~|$ GGe $$ š$t}D$$ k * $$@#T$D$` ~|$ GGe $ š$ }D$$ k * $$@#T$D$ ~|$ GGe ,$ š$}D$$ k * $$@#T$D$ ~|$ GGe $ š$3}D$$ k * $$@#T$D$ ~|$ GGe 4$ š$}D$$ k * $$@#T$D$ ~|$ GGe $ š$]}D$$ k * $$@#T$D$I ~|$ GGe <$ š$}D$$ k * $$@#T$D$ ~|$ GGe $ š$}D$$ k * $$@#T$D$s ~|$ GGe D$ š$}D$$ k * $$@#T$D$ ~|$ GGe $ š$}D$$ k * $$@#T$D$ ~|$ GGe L$ š$F}D$$ k * $$@#T$D$2 ~|$ GGe $ š$}D$$ k * $$@#T$D$~|$ GGe T$ š$p}D$$ k * $$@#T$D$\~|$ GGe $ š$}D$$ k * $$@#T$D$~|$ GGe \$ š$}D$$ k * $$@#T$D$~|$ GGe $ š$/}D$$ k * $$@#T$D$~|$ GGe d$ š$}D$$ k * $$@#T$D$~|$ GGe $ š$Y}D$$ k * $$@#T$D$E~|$ GGe l$ š$}D$$| l * $$@#T$D$~|$ GGe $| š$}D$$x l * $$@#T$D$o~|$ GGe t$x š$}D$$t l * $$@#T$D$~|$ GGe $t š$}D$$p l * $$@#T$D$~|$ GGe |$p š$B}D$$l l * $$@#T$D$.~|$ GGe $l š$}D$$h l * $$@#T$D$~|$ GGe $h š$l}D$$d l * $$@#T$D$X~|$ GGe $d š$}D$$` l * $$@#T$D$ ~|$ GGe $` š$}D$$\ $l * $$@#T$D$~|$ GGe $\ š$+}D$$X (l * $$@#T$D$~|$ GGe $X š$}D$$T 0l * $$@#T$D$~|$ GGe $T š$U}D$$P 4l * $$@#T$D$A~|$ GGe $P š$}D$$L 8l * $$@#T$D$ ~|$ GGe  $L š$}D$$H }D$$< Hl * $$@#T$D$$*}|$ GGe 0$< š$}D$$8 Ll * $$@#T$D$%}|$ GGe $8 š$h}D$$4 Pl * $$@#T$D$&T}|$ GGe 8$4 š$}D$$0 Tl * $$@#T$D$'}|$ GGe $0 š$}D$$, \l * $$@#T$D$(~}|$ GGe @$, š$'}D$$( `l * $$@#T$D$)}|$ GGe ķ$( š$}D$$$ dl * $$@#T$D$*}|$ GGe H$$ š$Q}D$$  hl * $$@#T$D$+=}|$ GGe ̶$  š$}D$$ ll * $$@#T$D$,}|$ GGe P$ š${}D$$ pl * $$@#T$D$-g}|$ GGe Ե$ š$}D$$ tl * $$@#T$D$.}|$ GGe X$ š$}D$$ xl * $$@#T$D$/}|$ GGe ܴ$ š$:}D$$  |l * $$@#T$D$0&}|$ GGe `$  š$}D$$ l * $$@#T$D$1}|$ GGe $ š$d}D$$ l * $$@#T$D$2P}|$ GGe h$ š$}D$$ l * $$@#T$D$3}|$ GGe $ š$}D$$ l * $$@#T$D$4z}|$ GGe p$  š$#}D$$ l * $$@#T$D$G}|$ GGe $  š$}D$$ l * $$@#T$D$V}|$ GGe x$  š$M}D$$ l * $$@#T$D$W9}|$ GGe $  š$}D$$ l * $$@#T$D$X}|$ GGe $  š$w}D$$ l * $$@#T$D$Yc}|$ GGe $  š$ }D$$ l * $$@#T$D$Z}|$ GGe $  š$}D$$ l * $$@#T$D$[}|$ GGe  $  š$6}D$$ l * $$@#T$D$\"}|$ GGe $  š$}D$$ l * $$@#T$D$]}|$ GGe $  š$`}D$$ l * $$@#T$D$^L}|$ GGe $  š$}D$$ l * $$@#T$D$_}|$ GGe $  š$}D$$ l * $$@#T$D$`v}|$ GGe $  š$}D$$ l * $$@#T$D$a }|$ GGe $$  š$}D$$ l * $$@#T$D$b}|$ GGe $  š$I}D$$ l * $$@#T$D$c5}|$ GGe ,$  š$޿}D$$ l * $$@#T$D$d}|$ GGe $  š$s}D$$ l * $$@#T$D$e_}|$ GGe 4$  š$}D$$ l * $$@#T$D$f}|$ GGe $  š$蝾}D$$ l * $$@#T$D$g}|$ GGe <$  š$2}D$$ l * $$@#T$D$h}|$ GGe $  š$ǽ}D$$ l * $$@#T$D$i}|$ GGe D$  š$\}D$$ l * $$@#T$D$jH}|$ GGe ȧ$  š$}D$$ l * $$@#T$D$k}|$ GGe L$  š$膼}D$$ l * $$@#T$D$lr}|$ GGe Ц$  š$}D$$ l * $$@#T$D$m}|$ GGe T$  š$谻}D$$ m * $$@#T$D$n}|$ GGe إ$  š$E}D$$ m * $$@#T$D$1}|$ GGe \$  š$ں}D$$ m * $$@#T$D$}|$ GGe $  š$o}D$$ m * $$@#T$D$[}|$ GGe d$  š$}D$$ m * $$@#T$D$}|$ GGe $  š$虹}D$$ m * $$@#T$D$}|$ GGe l$  š$.}D$$| m * $$@#T$D$}|$ GGe $|  š$ø}D$$x m * $$@#T$D$}|$ GGe t$x  š$X}D$$t $m * $$@#T$D$D}|$ GGe $t  š$}D$$p (m * $$@#T$D$}|$ GGe |$p  š$肷}D$$l ,m * $$@#T$D$n}|$ GGe $l  š$}D$$h 0m * $$@#T$D$}|$ GGe $h  š$謶}D$$d 8m * $$@#T$D$}|$ GGe $d  š$A}D$$` }D$$ m * $$@#T$D$G*}|$ GGe $  š$Ӭ}D$$ m * $$@#T$D$H}|$ GGe $  š$h}D$$ m * $$@#T$D$IT}|$ GGe $  š$}D$$ m * $$@#T$D$J}|$ GGe $  š$蒫}D$$ m * $$@#T$D$K~}|$ GGe $  š$'}D$$ m * $$@#T$D$L}|$ GGe $  š$輪}D$$ m * $$@#T$D$M}|$ GGe $  š$Q}D$$ m * $$@#T$D$N=}|$ GGe $  š$}D$$ m * $$@#T$D$O}|$ GGe '$  š${}D$$ m * $$@#T$D$Pg}|$ GGe $  š$}D$$ m * $$@#T$D$Q}|$ GGe /$  š$襨}D$$ m * $$@#T$D$R}|$ GGe $  š$:}D$$ m * $$@#T$D$S&}|$ GGe 7$  š$ϧ}D$$ m * $$@#T$D$T}|$ GGe $  š$d}D$$ m * $$@#T$D$UP}|$ GGe ?$  š$}D$$ m * $$@#T$D$V}|$ GGe Í$  š$莦}D$$ m * $$@#T$D$Wz}|$ GGe G$  š$#}D$$ m * $$@#T$D$X}|$ GGe ˌ$  š$踥}D$$ m * $$@#T$D$Y}|$ GGe O$  š$M}D$$ m * $$@#T$D$Z9}|$ GGe Ӌ$  š$}D$$ m * $$@#T$D$}|$ GGe W$  š$w}D$$ m * $$@#T$D$c}|$ GGe ۊ$  š$ }D$$ m * $$@#T$D$}|$ GGe _$  š$衣}D$$ m * $$@#T$D$}|$ GGe $  š$6}D$$ n * $$@#T$D$"}|$ GGe g$  š$ˢ}D$$ n * $$@#T$D$}|$ GGe $  š$`}D$$ n * $$@#T$D$L}|$ GGe o$  š$}D$$ n * $$@#T$D$}|$ GGe $  š$芡}D$$ n * $$@#T$D$v}|$ GGe w$  š$}D$$ n * $$@#T$D$ }|$ GGe $  š$贠}D$$ n * $$@#T$D$}|$ GGe $  š$I}D$$ n * $$@#T$D$5}|$ GGe $  š$ޟ}D$$ $n * $$@#T$D$}|$ GGe $  š$s}D$$ (n * $$@#T$D$_}|$ GGe  $  š$}D$$ ,n * $$@#T$D$}|$ GGe $  š$蝞}D$$ 0n * $$@#T$D$}|$ GGe $  š$2}D$$| 4n * $$@#T$D$}|$ GGe $|  š$ǝ}D$$x 8n * $$@#T$D$}|$ GGe $x  š$\}D$$t @n * $$@#T$D$H}|$ GGe $t  š$}D$$p Dn * $$@#T$D$}|$ GGe #$p  š$膜}D$$l Hn * $$@#T$D$r}|$ GGe $l  š$}D$$h Ln * $$@#T$D$}|$ GGe +$h  š$谛}D$$d Pn * $$@#T$D$}|$ GGe $d  š$E}D$$` Tn * $$@#T$D$1}|$ GGe 3$`  š$ښ}D$$\ Xn * $$@#T$D$}|$ GGe $\  š$o}D$$X \n * $$@#T$D$[}|$ GGe ;$X  š$}D$$T `n * $$@#T$D$}|$ GGe ~$T  š$虙}D$$P dn * $$@#T$D$}|$ GGe C~$P  š$.}D$$L ln * $$@#T$D$}|$ GGe }$L  š$Ø}D$$H pn * $$@#T$D$}|$ GGe K}$H  š$X}D$$D tn * $$@#T$D$D}|$ GGe |$D `$}D$$@ P * $$@#T$D$}|$ GGe J|$@  š$y}D$$< xn * $$@#T$D$e}|$ GGe {$<  š$}D$$8 |n * $$@#T$D$}|$ GGe R{$8  š$裖}D$$4 n * $$@#T$D$}|$ GGe z$4  š$8}D$$0 n * $$@#T$D$$}|$ GGe Zz$0  š$͕}D$$, n * $$@#T$D$}|$ GGe y$,  š$b}D$$( n * $$@#T$D$ N}|$ GGe by$(  š$}D$$$ n * $$@#T$D$ }|$ GGe x$$  š$茔}D$$ n * $$@#T$D$x}|$ GGe jx$  š$!}D$$ n * $$@#T$D$ }|$ GGe w$  š$趓}D$$ n * $$@#T$D$}|$ GGe rw$  š$K}D$$ n * $$@#T$D$7}|$ GGe v$  š$}D$$ n * $$@#T$D$}|$ GGe zv$  š$u}D$$ n * $$@#T$D$a}|$ GGe u$  š$ }D$$ n * $$@#T$D$}|$ GGe u$  š$蟑}D$$ n * $$@#T$D$}|$ GGe u$  š$4}D$$ n * $$@#T$D$ }|$ GGe t$  š$ɐ}D$$ n * $$@#T$D$ }|$ GGe t$  š$^}D$$ n * $$@#T$D$"J}|$ GGe s$  š$}D$$ n * $$@#T$D$$}|$ GGe s$  š$舏}D$$ n * $$@#T$D$&t}|$ GGe r$  š$}D$$ n * $$@#T$D$( }|$ GGe r$  š$貎}D$$ n * $$@#T$D$*}|$ GGe q$  š$G}D$$ n * $$@#T$D$,3}|$ GGe &q$  š$܍}D$$ n * $$@#T$D$.ȿ}|$ GGe p$ `$q}D$$ H * $$@#T$D$0T}|$ GGe %p$  š$}D$$ n * $$@#T$D$2}|$ GGe o$  š$蒌}D$$ n * $$@#T$D$4~}|$ GGe -o$  š$'}D$$ n * $$@#T$D$6}|$ GGe n$  š$輋}D$$ n * $$@#T$D$9訽}|$ GGe 5n$  š$Q}D$$ n * $$@#T$D$;=}|$ GGe m$  š$}D$$ n * $$@#T$D$=Ҽ}|$ GGe =m$  š${}D$$ n * $$@#T$D$?g}|$ GGe l$  š$}D$$ o * $$@#T$D$A}|$ GGe El$  š$襉}D$$ o * $$@#T$D$C葻}|$ GGe k$  š$:}D$$ o * $$@#T$D$E&}|$ GGe Mk$  š$ψ}D$$ o * $$@#T$D$G軺}|$ GGe j$ `$d}D$$ P * $$@#T$D$IG}|$ GGe Lj$  š$}D$$ o * $$@#T$D$Jܹ}|$ GGe i$  š$腇}D$$ o * $$@#T$D$Lq}|$ GGe Ti$  š$}D$$ o * $$@#T$D$N}|$ GGe h$  š$识}D$$ o * $$@#T$D$P蛸}|$ GGe \h$  š$D}D$$ $o * $$@#T$D$R0}|$ GGe g$  š$م}D$$ (o * $$@#T$D$Tŷ}|$ GGe dg$  š$n}D$$ ,o * $$@#T$D$VZ}|$ GGe f$  š$}D$$ 0o * $$@#T$D$X}|$ GGe lf$  š$蘄}D$$ 4o * $$@#T$D$Z脶}|$ GGe e$  š$-}D$$ $D  š$Ib}D$$@ p * $$@#T$D$5}|$ GGe />$@  š$a}D$$< p * $$@#T$D$ʓ}|$ GGe =$<  š$sa}D$$8 p * $$@#T$D$_}|$ GGe 7=$8  š$a}D$$4 p * $$@#T$D$}|$ GGe <$4  š$`}D$$0 p * $$@#T$D$艒}|$ GGe ?<$0  š$2`}D$$, p * $$@#T$D$}|$ GGe ;$,  š$_}D$$( p * $$@#T$D$賑}|$ GGe G;$(  š$\_}D$$$ p * $$@#T$D$H}|$ GGe :$$  š$^}D$$ p * $$@#T$D$ݐ}|$ GGe O:$  š$^}D$$ p * $$@#T$D$r}|$ GGe 9$  š$^}D$$ p * $$@#T$D$}|$ GGe W9$  š$]}D$$ p * $$@#T$D$蜏}|$ GGe 8$  š$E]}D$$ p * $$@#T$D$ 1}|$ GGe _8$  š$\}D$$ p * $$@#T$D$ Ǝ}|$ GGe 7$  š$o\}D$$ p * $$@#T$D$[}|$ GGe g7$  š$\}D$$ p * $$@#T$D$}|$ GGe 6$  š$[}D$$ p * $$@#T$D$腍}|$ GGe o6$  š$.[}D$$ p * $$@#T$D$}|$ GGe 5$  š$Z}D$$ p * $$@#T$D$诌}|$ GGe w5$  š$XZ}D$$ p * $$@#T$D$D}|$ GGe 4$  š$Y}D$$ p * $$@#T$D$ً}|$ GGe 4$  š$Y}D$$ p * $$@#T$D$n}|$ GGe 4$  š$Y}D$$ p * $$@#T$D$}|$ GGe 3$  š$X}D$$ q * $$@#T$D$ 蘊}|$ GGe  3$  š$AX}D$$ q * $$@#T$D$"-}|$ GGe 2$  š$W}D$$ q * $$@#T$D$$‰}|$ GGe 2$  š$kW}D$$ q * $$@#T$D$&W}|$ GGe 1$  š$W}D$$ q * $$@#T$D$(}|$ GGe 1$  š$V}D$$ q * $$@#T$D$*聈}|$ GGe 0$  š$*V}D$$ q * $$@#T$D$,}|$ GGe #0$  š$U}D$$ q * $$@#T$D$.談}|$ GGe /$  š$TU}D$$ $q * $$@#T$D$0@}|$ GGe +/$  š$T}D$$ (q * $$@#T$D$2Ն}|$ GGe .$  š$~T}D$$ ,q * $$@#T$D$Ej}|$ GGe 3.$  š$T}D$$ 0q * $$@#T$D$}|$ GGe -$  š$S}D$$ 4q * $$@#T$D$蔅}|$ GGe ;-$  š$=S}D$$ 8q * $$@#T$D$)}|$ GGe ,$  š$R}D$$ A}D$$ q * $$@#T$D$*s}|$ GGe $  š$@}D$$ q * $$@#T$D$r}|$ GGe i$  š$h@}D$$ q * $$@#T$D$Tr}|$ GGe $ š$?}D$$ q * $$@#T$D$q}|$ GGe q$ š$?}D$$ r * $$@#T$D$~q}|$ GGe $ š$'?}D$$ r * $$@#T$D$q}|$ GGe y$ š$>}D$$ r * $$@#T$D$p}|$ GGe $ š$Q>}D$$ r * $$@#T$D$=p}|$ GGe $ š$=}D$$ r * $$@#T$D$o}|$ GGe $ š${=}D$$ r * $$@#T$D$go}|$ GGe $ š$=}D$$ r * $$@#T$D$n}|$ GGe  $ š$<}D$$ r * $$@#T$D$n}|$ GGe $ š$:<}D$$ $r * $$@#T$D$&n}|$ GGe $ š$;}D$$ (r * $$@#T$D$m}|$ GGe $ š$d;}D$$ ,r * $$@#T$D$Pm}|$ GGe $ š$:}D$$ 0r * $$@#T$D$l}|$ GGe $ š$:}D$$ 4r * $$@#T$D$zl}|$ GGe %$ š$#:}D$$ 8r * $$@#T$D$l}|$ GGe $ š$9}D$$ }|$ GGe Y$ š$ }D$$  t * $$@#T$D$>}|$ GGe $  š$) }D$$ t * $$@#T$D$>}|$ GGe a$ š$ }D$$ t * $$@#T$D$=}|$ GGe $ š$S }D$$ $t * $$@#T$D$?=}|$ GGe i$ š$ }D$$ 0t * $$@#T$D$<}|$ GGe $ š$} }D$$ 4t * $$@#T$D$i<}|$ GGe q$ š$ }D$$ 8t * $$@#T$D$;}|$ GGe $ š$ }D$$ 3}|$ GGe E$ š$K}D$$ t * $$@#T$D$?73}|$ GGe $ š$}D$$ t * $$@#T$D$@2}|$ GGe M$ š$u}D$$ t * $$@#T$D$Aa2}|$ GGe $ š$ }D$$ t * $$@#T$D$B1}|$ GGe U$ š$|D$$ t * $$@#T$D$C1}|$ GGe $ š$4|D$$ t * $$@#T$D$D 1}|$ GGe ]$ š$|D$$ t * $$@#T$D$E0}|$ GGe $ š$^|D$$ t * $$@#T$D$FJ0}|$ GGe e$ š$|D$$ t * $$@#T$D$G/}|$ GGe $ š$|D$$| t * $$@#T$D$Ht/}|$ GGe m$| š$|D$$x t * $$@#T$D$I /}|$ GGe $x š$|D$$t t * $$@#T$D$J.}|$ GGe u$t š$G|D$$p t * $$@#T$D$K3.}|$ GGe $p š$|D$$l t * $$@#T$D$L-}|$ GGe }$l š$q|D$$h t * $$@#T$D$M]-}|$ GGe $h š$|D$$d t * $$@#T$D$N,}|$ GGe $d š$|D$$` t * $$@#T$D$O,}|$ GGe  $` š$0|D$$\ t * $$@#T$D$P,}|$ GGe $\ š$|D$$X t * $$@#T$D$Q+}|$ GGe $X š$Z|D$$T t * $$@#T$D$RF+}|$ GGe $T š$|D$$P t * $$@#T$D$S*}|$ GGe $P š$|D$$L t * $$@#T$D$Tp*}|$ GGe $L š$|D$$H t * $$@#T$D$U*}|$ GGe !$H š$|D$$D t * $$@#T$D$V)}|$ GGe $D`$C|D$$@ P * $$@#T$D$&)}|$ GGe  $@ š$|D$$< t * $$@#T$D$(}|$ GGe $< š$d|D$$8 u * $$@#T$D$P(}|$ GGe ($8 š$|D$$4 u * $$@#T$D$'}|$ GGe $4 š$|D$$0 u * $$@#T$D$z'}|$ GGe 0$0 š$#|D$$, u * $$@#T$D$'}|$ GGe $, š$|D$$( u * $$@#T$D$ &}|$ GGe 8$( š$M|D$$$ u * $$@#T$D$ 9&}|$ GGe $$ š$|D$$  u * $$@#T$D$%}|$ GGe @$  š$w|D$$ u * $$@#T$D$c%}|$ GGe Ľ$ š$ |D$$ $u * $$@#T$D$$}|$ GGe H$ š$|D$$ (u * $$@#T$D$$}|$ GGe ̼$ š$6|D$$ ,u * $$@#T$D$"$}|$ GGe P$ š$|D$$  4u * $$@#T$D$#}|$ GGe Ի$  š$`|D$$ 8u * $$@#T$D$L#}|$ GGe X$ š$|D$$ }|$ GGe $ š$o|D$$ u * $$@#T$D$@[}|$ GGe $$ š$|D$$ u * $$@#T$D$B}|$ GGe $ š$|D$$ u * $$@#T$D$D}|$ GGe ,$ š$.|D$$ u * $$@#T$D$F}|$ GGe $ š$|D$$ u * $$@#T$D$H}|$ GGe 4$ š$X|D$$ u * $$@#T$D$JD}|$ GGe $ š$|D$$ u * $$@#T$D$L}|$ GGe <$ š$|D$$ u * $$@#T$D$Nn}|$ GGe $ š$|D$$ u * $$@#T$D$P}|$ GGe D$ š$|D$$ u * $$@#T$D$R}|$ GGe ȭ$ š$A|D$$ u * $$@#T$D$T-}|$ GGe L$ š$|D$$ u * $$@#T$D$V}|$ GGe Ь$ š$k|D$$ u * $$@#T$D$XW}|$ GGe T$ š$|D$$ u * $$@#T$D$Z}|$ GGe ث$ š$|D$$ u * $$@#T$D$\}|$ GGe \$ š$*|D$$ u * $$@#T$D$^}|$ GGe $ š$|D$$| u * $$@#T$D$`}|$ GGe d$| š$T|D$$x u * $$@#T$D$b@}|$ GGe $x š$|D$$t u * $$@#T$D$d}|$ GGe l$t š$~|D$$p u * $$@#T$D$fj}|$ GGe $p š$|D$$l u * $$@#T$D$h}|$ GGe t$l š$|uL$$h*$$@#T$D$j}|$ GGe $h š$=|uL$$d*$$@#T$D$l)}|$ GGe |$d š$|uL$$`*$$@#T$D$n}|$ GGe $` š$g|uL$$\*$$@#T$D$pS}|$ GGe $\ š$|uL$$X*$$@#T$D$r}|$ GGe $X š$|vL$$T*$$@#T$D$t}}|$ GGe $T š$&|vL$$P*$$@#T$D$v}|$ GGe $P š$|vL$$L*$$@#T$D$x}|$ GGe $L š$P| vL$$H*$$@#T$D$z<}|$ GGe $H š$|vL$$D*$$@#T$D$|}|$ GGe $D š$z|vL$$@*$$@#T$D$~f}|$ GGe  $@ š$|vL$$<*$$@#T$D$ }|$ GGe $< š$| vL$$8*$$@#T$D$ }|$ GGe ($8 š$9|$vL$$4*$$@#T$D$% }|$ GGe $4 š$|(vL$$0*$$@#T$D$ }|$ GGe 0$0 š$c|,vL$$,*$$@#T$D$O }|$ GGe $, š$|0vL$$(*$$@#T$D$ }|$ GGe 8$( š$|4vL$$$*$$@#T$D$y }|$ GGe $$ š$"|8vL$$ *$$@#T$D$ }|$ GGe @$  š$|@vL$$*$$@#T$D$ }|$ GGe Ğ$ š$L|DvL$$*$$@#T$D$8 }|$ GGe H$ š$|HvL$$*$$@#T$D$ }|$ GGe ̝$`$v|D$$ P * $$@#T$D$Y }|$ GGe G$`$|D$$  $P * $$@#T$D$}|$ GGe œ$ `$|D$$ (,P * $$@#T$D$q}|$ GGe =$`$|D$$ 40H * $$@#T$D$}|$ GGe $`$|D$$ 8<P * $$@#T$D$}|$ GGe 3$ š$2|LvL$$*$$@#T$D$}|$ GGe $ š$|PvL$$*$$@#T$D$}|$ GGe ;$ š$\|XvL$$*$$@#T$D$H}|$ GGe $ š$|\vL$$*$$@#T$D$}|$ GGe C$ š$|`vL$$*$$@#T$D$r}|$ GGe ǘ$ š$|dvL$$*$$@#T$D$}|$ GGe K$ š$|hvL$$*$$@#T$D$}|$ GGe ϗ$ š$E|lvL$$*$$@#T$D$1}|$ GGe S$ š$|pvL$$*$$@#T$D$}|$ GGe ז$ š$o|tvL$$*$$@#T$D$[}|$ GGe [$ š$|xvL$$*$$@#T$D$}|$ GGe ߕ$ š$||vL$$*$$@#T$D$}|$ GGe c$ š$.|vL$$*$$@#T$D$}|$ GGe $ š$|vL$$*$$@#T$D$}|$ GGe k$ š$X|vL$$*$$@#T$D$D}|$ GGe $ š$|vL$$*$$@#T$D$}|$ GGe s$ š$|vL$$*$$@#T$D$n}|$ GGe $ š$|vL$$*$$@#T$D$}|$ GGe {$ š$|vL$$*$$@#T$D$||$ GGe $ š$A|vL$$*$$@#T$D$-||$ GGe $ š$|vL$$*$$@#T$D$||$ GGe $ š$k|vL$$*$$@#T$D$W||$ GGe $ š$|vL$$*$$@#T$D$||$ GGe $ š$|vL$$*$$@#T$D$||$ GGe $ š$*|vL$$*$$@#T$D$||$ GGe $ š$|vL$$*$$@#T$D$||$ GGe $ š$T|vL$$*$$@#T$D$@||$ GGe $ š$|vL$$*$$@#T$D$||$ GGe $ š$~|vL$$*$$@#T$D$j||$ GGe '$ š$|vL$$*$$@#T$D$||$ GGe $ š$|vL$$*$$@#T$D$||$ GGe /$ š$=|vL$$*$$@#T$D$)||$ GGe $ š$|vL$$|*$$@#T$D$||$ GGe 7$| š$g|vL$$x*$$@#T$D$S||$ GGe $x š$|vL$$t*$$@#T$D$||$ GGe ?$t š$|vL$$p*$$@#T$D$}||$ GGe É$p š$&|vL$$l*$$@#T$D$||$ GGe G$l š$|vL$$h*$$@#T$D$||$ GGe ˈ$h š$P|vL$$d*$$@#T$D$<||$ GGe O$d š$|vL$$`*$$@#T$D$||$ GGe Ӈ$` š$z|vL$$\*$$@#T$D$f||$ GGe W$\ š$|wL$$X*$$@#T$D$||$ GGe ۆ$X š$|wL$$T*$$@#T$D$||$ GGe _$T š$9| wL$$P*$$@#T$D$%||$ GGe $P š$|wL$$L*$$@#T$D$||$ GGe g$L š$c|wL$$H*$$@#T$D$O||$ GGe $H š$|wL$$D*$$@#T$D$||$ GGe o$D š$|wL$$@*$$@#T$D$ y||$ GGe $@ š$"| wL$$<*$$@#T$D$ ||$ GGe w$< š$|$wL$$8*$$@#T$D$ ||$ GGe $8 š$L|(wL$$4*$$@#T$D$ 8||$ GGe $4 š$|,wL$$0*$$@#T$D$ ||$ GGe $0 š$v|4wL$$,*$$@#T$D$b||$ GGe $, š$ |8wL$$(*$$@#T$D$||$ GGe  $( š$蠾|0||$ GGe v$ š$ٵ|wL$$*$$@#T$D$?||$ GGe cv$ š$n|wL$$*$$@#T$D$HZ||$ GGe u$ š$|wL$$*$$@#T$D$I||$ GGe ku$ š$蘴|wL$$*$$@#T$D$J||$ GGe t$ š$-|wL$$*$$@#T$D$K||$ GGe st$ š$³|wL$$*$$@#T$D$L||$ GGe s$ š$W|wL$$*$$@#T$D$MC||$ GGe {s$`$|D$$ @DP * $$@#T$D$P||$ GGe r$$x||$$5(*$$@#L$D$Ra||$ GGe wr$$ ||$$58*$$@#L$D$T||$ GGe q$$蜱||$$5H*$$@#L$D$V||$ GGe yq$ š$.|wL$$*$$@#T$D$Y||$ GGe p$ š$ð|wL$$*$$@#T$D$[||$ GGe p$ š$X|wL$$*$$@#T$D$]D||$ GGe p$ š$|wL$$*$$@#T$D$_||$ GGe o$ š$肯|wL$$*$$@#T$D$hn||$ GGe  o$ š$|wL$$*$$@#T$D$i||$ GGe n$ š$謮|wL$$*$$@#T$D$j||$ GGe n$ š$A|wL$$*$$@#T$D$k-||$ GGe m$ š$֭|wL$$*$$@#T$D$l||$ GGe m$ š$k|wL$$*$$@#T$D$mW||$ GGe l$ š$|wL$$|*$$@#T$D$n||$ GGe %l$| š$蕬|wL$$x*$$@#T$D$o||$ GGe k$x`$*|D$$t HLP * $$@#T$D$ ||$ GGe $k$t`$趫|D$$p PTP * $$@#T$D$||$ GGe j$p`$B|D$$l X\P * $$@#T$D$%||$ GGe j$l`$Ϊ|D$$h d`H * $$@#T$D$||$ GGe i$h`$Z|D$$d hlP * $$@#T$D$=||$ GGe i$d`$|D$$` ptP * $$@#T$D$||$ GGe h$``$r|D$$\ x|P * $$@#T$D$U||$ GGe h$\`$|D$$X P * $$@#T$D$||$ GGe g$X`$芨|D$$T P * $$@#T$D$m||$ GGe f$T`$|D$$P H * $$@#T$D$||$ GGe wf$P`$袧|D$$L P * $$@#T$D$||$ GGe e$L`$.|D$$H P * $$@#T$D$||$ GGe me$H`$躦|D$$D P * $$@#T$D$||$ GGe d$D`$F|D$$@ P * $$@#T$D$)||$ GGe cd$@`$ҥ|D$$< P * $$@#T$D$||$ GGe c$<`$^|D$$8 ħH * $$@#T$D$A||$ GGe Yc$8`$|D$$4 ȧ̧P * $$@#T$D$||$ GGe b$4`$v|D$$0 ЧԧP * $$@#T$D$Y||$ GGe Ob$0`$|D$$, اܧP * $$@#T$D$||$ GGe a$,`$莣|D$$( P * $$@#T$D$q||$ GGe Ea$(`$|D$$$ P * $$@#T$D$||$ GGe `$$`$覢|D$$  H * $$@#T$D$||$ GGe ;`$ `$2|D$$ P * $$@#T$D$||$ GGe _$`$辡|D$$ P * $$@#T$D$||$ GGe 1_$`$J|D$$  P * $$@#T$D$-||$ GGe ^$`$֠|D$$ P * $$@#T$D$||$ GGe '^$`$b|D$$  P * $$@#T$D$E||$ GGe ]$ `$|D$$ $ H * $$@#T$D$||$ GGe ]$`$z|D$$ (,P * $$@#T$D$]||$ GGe \$`$|D$$ 04P * $$@#T$D$||$ GGe \$`$蒞|D$$ 8<P * $$@#T$D$u||$ GGe [$`$|D$$ @DP * $$@#T$D$||$ GGe  [$`$誝|D$$ HLP * $$@#T$D$||$ GGe Z$`$6|D$$ TPH * $$@#T$D$||$ GGe Y$`$œ|D$$ X\P * $$@#T$D$||$ GGe zY$`$N|D$$ `dP * $$@#T$D$1||$ GGe X$`$ڛ|D$$ hlP * $$@#T$D$||$ GGe pX$`$f|D$$ ptP * $$@#T$D$I||$ GGe W$`$|D$$ x|P * $$@#T$D$||$ GGe fW$`$~|D$$ H * $$@#T$D$a||$ GGe V$`$ |D$$ P * $$@#T$D$||$ GGe \V$`$薙|D$$ P * $$@#T$D$y||$ GGe U$`$"|D$$ P * $$@#T$D$||$ GGe RU$`$讘|D$$ P * $$@#T$D$||$ GGe T$`$:|D$$ P * $$@#T$D$||$ GGe HT$`$Ɨ|D$$ H * $$@#T$D$||$ GGe S$`$R|D$$ P * $$@#T$D$5||$ GGe >S$`$ޖ|D$$ ĨP * $$@#T$D$||$ GGe R$`$j|D$$ Ȩ̨P * $$@#T$D$M||$ GGe 4R$`$|D$$ ШԨP * $$@#T$D$||$ GGe Q$`$肕|D$$ بܨP * $$@#T$D$e||$ GGe *Q$`$|D$$ P * $$@#T$D$||$ GGe P$$蚔||$$5X*$$@#L$D$||$ GGe &P$ š$,|xL$$*$$@#T$D$||$ GGe O$ š$| xL$$*$$@#T$D$||$ GGe .O$ š$V|xL$$*$$@#T$D$B||$ GGe N$ š$|xL$$*$$@#T$D$||$ GGe 6N$`$耒|D$$ P * $$@#T$D$c||$ GGe M$ š$ |xL$$*$$@#T$D$||$ GGe 5M$`$衑|D$$ P * $$@#T$D$||$ GGe L$`$-|D$$ P * $$@#T$D$||$ GGe +L$`$蹐|D$$ P * $$@#T$D$||$ GGe K$`$E|D$$|  P * $$@#T$D$(||$ GGe !K$|$я||$$x5hM*$$@#L$D$||$ GGe J$x š$c| xL$$t*$$@#T$D$O||$ GGe &J$t š$|$xL$$p*$$@#T$D$||$ GGe I$p š$荎|(xL$$l*$$@#T$D$y||$ GGe .I$l š$"|,xL$$h*$$@#T$D$||$ GGe H$h`$跍|D$$d P * $$@#T$D$蚿||$ GGe -H$d$C||$$`5x*$$@#L$D$,||$ GGe G$`$Ռ||$$\5Q*$$@#L$D$达||$ GGe /G$\`$g|D$$X P * $$@#T$D$J||$ GGe F$X$||$$T5o*$$@#L$D$ܽ||$ GGe +F$T š$腋|0xL$$P*$$@#T$D$q||$ GGe E$P š$|$`$|D$$ 8<P * $$@#T$D$||$ GGe >>$`$訄|D$$ @DP * $$@#T$D$苶||$ GGe =$`$4|D$$  HLP * $$@#T$D$||$ GGe 4=$ $||$$5<*$$@#L$D$詵||$ GGe <$ š$R|`xL$$*$$@#T$D$>||$ GGe 9<$ š$|dxL$$*$$@#T$D$Ӵ||$ GGe ;$ š$||lxL$$*$$@#T$D$h||$ GGe A;$ š$|pxL$$*$$@#T$D$||$ GGe :$`$要|D$$ TPH * $$@#T$D$艳||$ GGe @:$ š$2|txL$$*$$@#T$D$&!||$ GGe 9$ š$ǀ|xxL$$*$$@#T$D$*!賲||$ GGe H9$ š$\||xL$$*$$@#T$D$+!H||$ GGe 8$ š$|xL$$*$$@#T$D$`!ݱ||$ GGe P8$ š$|xL$$*$$@#T$D$a!r||$ GGe 7$ š$|xL$$*$$@#T$D$b!||$ GGe X7$ š$~|xL$$*$$@#T$D$c!蜰||$ GGe 6$ š$E~|xL$$*$$@#T$D$d!1||$ GGe `6$ š$}|xL$$*$$@#T$D$e!Ư||$ GGe 5$ š$o}|xL$$*$$@#T$D$f![||$ GGe h5$ š$}|xL$$*$$@#T$D$g!||$ GGe 4$ š$||xL$$*$$@#T$D$h!腮||$ GGe p4$ š$.||xL$$*$$@#T$D$i!||$ GGe 3$ š${|xL$$*$$@#T$D$j!语||$ GGe x3$ š$X{|xL$$*$$@#T$D$k!D||$ GGe 2$ š$z|xL$$*$$@#T$D$l!٬||$ GGe 2$ š$z|xL$$*$$@#T$D$m!n||$ GGe 2$ š$z|xL$$*$$@#T$D$n!||$ GGe 1$ š$y|xL$$*$$@#T$D$o!蘫||$ GGe  1$ š$Ay|xL$$*$$@#T$D$$-||$ GGe 0$ š$x|xL$$*$$@#T$D$$ª||$ GGe 0$ š$kx|xL$$*$$@#T$D$$W||$ GGe /$ š$x|xL$$*$$@#T$D$$||$ GGe /$ š$w|xL$$*$$@#T$D$$聩||$ GGe .$ š$*w|xL$$*$$@#T$D$$||$ GGe $.$ š$v|xL$$*$$@#T$D$$諨||$ GGe -$ š$Tv|xL$$*$$@#T$D$$@||$ GGe ,-$ š$u|xL$$*$$@#T$D$$է||$ GGe ,$ š$~u|xL$$*$$@#T$D$$j||$ GGe 4,$ š$u|xL$$|*$$@#T$D$$||$ GGe +$| š$t|xL$$x*$$@#T$D$$蔦||$ GGe <+$x š$=t|xL$$t*$$@#T$D$$)||$ GGe *$t š$s|yL$$p*$$@#T$D$$辥||$ GGe D*$p š$gs|yL$$l*$$@#T$D$$S||$ GGe )$l š$r|yL$$h*$$@#T$D$$||$ GGe L)$h š$r| yL$$d*$$@#T$D$$}||$ GGe ($d š$&r|yL$$`*$$@#T$D$$||$ GGe T($` š$q|yL$$\*$$@#T$D$$解||$ GGe '$\ š$Pq|yL$$X*$$@#T$D$$<||$ GGe \'$X š$p| yL$$T*$$@#T$D$$Ѣ||$ GGe &$T š$zp|$yL$$P*$$@#T$D$$f||$ GGe d&$P š$p|(yL$$L*$$@#T$D$$||$ GGe %$L š$o|,yL$$H*$$@#T$D$$萡||$ GGe l%$H š$9o|0yL$$D*$$@#T$D$$%||$ GGe $$D š$n|4yL$$@*$$@#T$D$$躠||$ GGe t$$@`$cn|D$$< X\P * $$@#T$D$F||$ GGe #$<`$m|D$$8 `dP * $$@#T$D$ҟ||$ GGe j#$8`${m|D$$4 ptP * $$@#T$D$^||$ GGe "$4$m||$$05ʀ*$$@#L$D$||$ GGe f"$0$l||$$,5ʀ*$$@#L$D$肞||$ GGe !$,`$+l|D$$( |xH * $$@#T$D$||$ GGe b!$(`$k|D$$$ P * $$@#T$D$蚝||$ GGe  $$`$Ck|D$$  P * $$@#T$D$&||$ GGe X $ `$j|D$$ P * $$@#T$D$貜||$ GGe $`$[j|D$$ P * $$@#T$D$>||$ GGe N$`$i|D$$ P * $$@#T$D$ʛ||$ GGe $`$si|D$$ H * $$@#T$D$V||$ GGe D$ š$h|S|(zL$L$8*$$@#T$D$-||$ GGe D$8 š$R|,zL$L$4*$$@#T$D$Ȅ||$ GGe HD$4 š$tR|0zL$L$0*$$@#T$D$c||$ GGe D$0 š$R|4zL$L$,*$$@#T$D$||$ GGe bD$, š$Q|8zL$L$(*$$@#T$D$虃||$ GGe D$( š$EQ|遍$-$}$ $酋$門 $ؖ鍊$ǖ$趖镉$襖$蔖靈$胖!$r饇$a)$P魆$?1$.鵅$9$ 齄$A$ꕀŃ$ٕI$ȕ͂$ 跕Q$覕Ձ$蕕Y$脕݀$sa$ b$$Qi$(@~$,/q~$0}$4 y}$8|$<딀|$@ڔ|$Dɔ{$H踔 {$L觔z$P薔z$T腔y$Xty$\cx$`R%x$dAw$h0-w$lv$p5v$tu$x쓀=u$|ۓt$ʓEt$蹓s$訓Ms$藓r$膓Ur$uq$d]q$Sp$Bep$1o$ mo$n$un$풀m$ܒ}m$˒m$躒l$詒 l$蘒k$臒k$vj$ej$Ti$C!i$2h$!)h$g$1g$f$ݑ9f$̑e$軑Ae$誑d$虑@d$舑c$ w6c$fb$U,b$Da$34a$ "`$$<`$(_$,D_$0ސ^$4͐L^$8輐]$<諐T]$@蚐\$D艐\\$Hx[$Lgd[$PVZ$TElZ$X4Y$\#tY$`X$d|X$hX$lߏW$pΏW$t轏V$x謏V$|蛏U$芏U$yT$h T$WS$F(S$5R$$0R$Q$8Q$P$@P$ώO$辎HO$譎N$蜎PN$苎M$zXM$iL$X`L$GK$6hK$%J$pJ$I$xI$ፀH$ЍH$迍H$讍G$蝍 G$茍F${F$jE$YE$HD$ 7$D$&C$,C$B$4B$ ⌀A$$ь$<kT>$@Z=$DIS=$H8<$L'[<$P;$Tc;$X:$\㋀k:$`ҋ9$ds9$h谋8$l蟋{8$p莋7$t}7$xl7$|[6$J6$95$(5$4$4$3$䊀'3$ӊ2$Š/2$豊1$蠊71$菊0$~?0$m/$\G/$K.$:O.$)-$W-$,$_,$剀+$ԉg+$É*$貉o*$衉)$萉w)$($n($]($L'$; '$*&$&$%$ %$戀$$Ո#$$Ĉ#$賈+#$ 袈"$$葈3"$(耈!$,o;!$0^ $4MC $8<$<+K$@$D S$H$L燀[$Pև$TŇc$X贇$\裇k$`蒇$d聇s$hp$l_{$pN$t=$x,$|$ $$膀$׆$Ɔ$赆$褆'$蓆$肆/$q$`7$O$>?$-$G$ $O$酀$؅W$Dž $超_ $襅 $蔅g $胅 $ro $a $Pw $? $. $ $ $ $ꄀ$ل$Ȅ$ 跄$覄$蕄#$脄$s+$ b$$Q3$(@$,/;$0$4 C$8$<냀K$@ڃ$DɃS$H踃$L觃[$P薃$T腃c$Xt$\ck$`R$dAs$h0$l{$p$t$x삀$|ۂ$ʂ$蹂$訂$藂$膂$u$d'$S$B/$1$ 7$$?$큀$܁G$ˁ$躁O$詁$蘁W$臁$v_$e$Tg$C$2o$!$w$$$݀$̀$軀 $ 誀$ 虀$ 舀$ w$ f$ U#$ D$ 3+$ "$$ 3$( $, ;$0 $4 @$8 $< H$@ $D P$H x$L gX$P V$T E`$X 4$\ #h$` $d p$h ~$l ~x$p ~$t ~$x ~$| ~$ ~ $ y~$ h~$ W~$ F~$ 5~$ $~$$ ~$ ~)$ }$ }1$ }$ }9$ }$ }A$ }$ z}I$ i}$ X}Q$ G}$ 6}Y$ %}$ }a$ }$ |i$ |$ |q$ |$ |y$ |$ |$ {|$ j|$ Y| $ H|$ 7|$ &|$ |$ |$ {%$ {$$ {-$( {$, {5$0 {$4 {=$8 |{$< k{E$@ Z{$D I{M$H 8{$L '{U$P {п$T {T$X zؾ$\ z\$` z$d zd$h z$l zl$p z$t }zt$x lz$| [z|$ Jz$ 9z鄹$ (z$ z錸$ z$ y锷$ y$ y霶$ y $ y餵$ y($ y鬴$ ~y0$ my鴳$ \y8$ Ky鼲$ :y@$ )yı$ yH$ y̰$ xP$ xԯ$ xX$ xܮ$ x`$ x$ xh$ x$ nxp$ ]x$ Lxx$ ;x$ *x逪$ x$ x鈩$ w $ w鐨$ w$ w阧$ w$ w頦$$ w$$( w騥$, ow,$0 ^w鰤$4 Mw4$8 u'$ -u體$ u/$ u鳓$ t7$ t黒$ t?$ tÑ$ tG$ tː$ tO$ tӏ$ rtN$ atҎ$ PtV$ ?tڍ$ .t^$ t$ tf$ s$ sn$ s$ sv$ s$ s~$ s$ s醈$ ss $ bs鎇$$ Qs$( @s閆$, /s$0 s鞅$4 s"$8 r馄$< r*$@ r鮃$D r)$H r魂$L r1$P r鵁$T r9$X tr齀$\ crA$` Rr$d ArI$h 0r~$l rQ~$p r}$t qY}$x q|$| qa|$ q{$ qi{$ qz$ qqz$ qy$ uqyy$ dqx$ Sqx$ Bqx$ 1qw$ q w$ qv$ pv$ pu$ pu$ pt$ p%t$ ps$ p-s$ pr$ vp5r$ epq$ Tp=q$ Cpp$ 2pEp$ !po$ pMo$ on$ oUn$ om$ o]m$ ol$ oel$ ok$ omk$ woj$ fouj$ Uoi$ Do}i$ 3oi$ "oh$$ o h$( o= rd $@#n=qd nGg$, nf$0 n$|>i>$-i=$i=$ i<$h<$h;$h ;$h:$h(:$h9$h09$h8$rh88$ah7$Ph@7$?h6$.hH6$h5$ hP5$g4$gX4$g3$g`3$g2$gh2$g1$gp1$sg0$bgx0$Qg/$@g/$/g/$g.$ g .$f-$f-$ f,$f,$f+$f$+$f*$ f,*$$tf)$(cf4)$,Rf($0Af<($40f'$8fD'$<f&$@eL&$De%$HeT%$Le$$Pe\$$Te#$Xed#$\e"$`uel"$dde!$hSet!$lBe $p1e| $t e $xe$|d$d$d$d$d$d$d $d$vd($ed$Td0$Cd$2d8$!d$d@$c$cH$c$cP$c$cX$c$c`$wc$fch$Uc$Dcp$3c$"cx$c$c$b$b$b $b$b$ b $b $xb $gb$ $Vb $ Eb, $$4b $(#b4 $,b $0b< $4a$8aD$<a$@aL$Da$HaT$La$Pya\$Tha$XWad$\Fa$`5al$d$a$hat$la$p`|$t`$x`$|`$`$`$`$z`$i`$X` $G`$6`($%`$`0$`$_8$_$_@$_$_H$_$_P${_$j_X$Y_$H_`$7_$&_h$_$_p$^$^x$^$^$^$^$^ $|^$k^$ Z^$I^$8^$'^$$^$ ^,$$]$(]4$,]$0]<$4]$8]D$<]$@}]L$Dl]$H[]T$LJ]$P9]\$T(]$X]d$\]$`\l$d\$h\t$l\$p\|$t\$x\$|~\$m\$\\$K\$:\$)\$\ $\$[($[$[0$[$[8$[$[@$[$n[H$][$L[P$;[$*[X$[$[`$Z$Zh$Z$Zp$Z$Zx$Z$Z$oZ$^Z$MZ $X$-X$X$ X$W$W霿$W $W餾$W($W鬽$W0$W鴼$rW8$aW鼻$PW@$?Wĺ$.WH$W̹$ WP$VԸ$VX$Vܷ$V`$V$Vh$V$Vp$sV$bVx$QV$@V逳$/V$V鈲$ V $U鐱$U$ U阰$U$U頯$U$$U騮$ U,$$tU鰭$(cU4$,RU鸬$0AU<$40U$8UD$<UȪ$@TL$DTЩ$HTT$LTب$PT\$TT$XTd$\T$`uTl$ddT$hSTt$lBT$p1T|$t T$xT鄣$|S$S錢$S$S锡$S$S霠$S $S餟$vS($eS鬞$TS0$CS鴝$2S8$!S鼜$S@$Rě$RH$R̚$RP$Rԙ$RX$Rܘ$R`$wR$fRh$UR$DRp$3R$"Rx$R$R途$Q$Q鈓$Q $Q鐒$Q$ Q阑$Q$xQ預$gQ$$VQ騏$ EQ,$$4Q鰎$(#Q4$,Q鸍$0Q<$4P$8PD$<Pȋ$@PL$DPЊ$HPT$LP؉$PyP\$ThP$XWPd$\FP$`5Pl$d$P$hPt$lP$pO|$tO$xO鄄$|O$O錃$O$O锂$zO$iO霁$XO $GO餀$6O($%O$O0$O~$N8~$N}$N@}$N|$NH|$N{$NP{${Nz$jNXz$YNy$HN`y$7Nx$&Nhx$Nw$Npw$Mv$Mxv$Mu$Mu$Mu$Mt$M t$|Ms$kMs$ ZMr$IMr$8Mq$'M$q$Mp$ M,p$$Lo$(L4o$,Ln$0L*n$4Lm$8L m$<Ll$@}Ll$DlLk$H[Lk$LJLj$P9Lj$T(Li$XLi$\Lh$`Kg$dKug$hKf$lKqf$pKe$tKge$xKd$|~K]d$mKc$\KYc$KKb$:KUb$)Ka$KKa$K`$JA`$J_$J7_$J^$J-^$J]$J#]$J\$nJ\$]J[$LJ[$;JZ$*JZ$JY$J Y$IX$IX$IW$IW$IV$IV$IU$IT$oIxT$^IS$MInS$G(D$-GC$G0C$ GB$F8B$FA$F@A$F@$FH@$F?$FP?$F>$rFX>$aF=$PF`=$?F<$.Fh<$F;$ Fp;$E:$Ex:$E9$E9$E9$E8$E 8$E7$sE7$bE6$QE6$@E5$/E$5$E4$ E#4$D3$D3$ D2$D'2$D1$D/1$D0$ D.0$$tD/$(cD6/$,RD.$0AD>.$40D-$8DF-$<D,$@CE,$DC+$HCD+$LC*$PCC*$TC)$XCB)$\C($`uCJ($ddC'$hSCO'$lBC&$p1CE&$t C%$xC;%$|B$$BC$$B#$BK#$B"$BP"$B!$BF!$vB $eBH $TB$CBP$2B$!BX$B$AT$A$AV$A$AU$A$A]$A$wAb$fA$UAX$DA$3AN$"A$AM$A$@U$@$@]$@$@Y$ @$@O$x@$g@E$V@$ E@;$$4@$(#@1$,@$0@'$4? $8? $<? $@? $D? $H? $L? $Py? $Th?z $XW?$\F?p$`5?$d$?f$h?$l?\$p>$t>R$x>$|>H$>$>>$>$z>4$i>$X>*$G>$6> $%>$>$>$= $=$=$=}$=$=s$=${=i$j=$Y=_$H=$7=^$&=$=f$=$6C$-6$6K$ 6$5S$5$5[$5$5c$5$5k$5$r5s$a5$P5{$?5$.5都$5$ 5鋼$4$4铻$4$4雺$4$4飹$4'$4髸$s4/$b4鳷$Q47$@4黶$/4?$4õ$ 4G$3˴$3O$ 3ӳ$3W$3۲$3_$3$ 3g$$t3$(c3o$,R3$0A3w$403$83$<3$@2釭$D2 $H2鏬$L2$P2闫$T2$X2韪$\2#$`u2駩$dd2+$hS2鯨$lB23$p12鷧$t 2;$x2鿦$|1C$1ǥ$1K$1Ϥ$1S$1ף$1[$1ߢ$v1c$e1ޡ$T1b$C1$21j$!1$1r$0$0z$0$0邝$0$0銜$0$0钛$w0$f0隚$U0$D0颙$30&$"0骘$0.$0鲗$/6$/麖$/>$/•$/F$ /ʔ$/N$x/ғ$g/V$V/ڒ$ E/^$$4/$(#/f$,/$0/n$4.$8.v$<.$@.~$D.$H.醍$L. $Py.鎌$Th.$XW.開$\F.$`5.鞊$d$."$h.馉$l.*$p-鮈$t-2$x-鶇$|-:$-龆$-B$-ƅ$z-J$i-΄$X-R$G-փ$6-Z$%-ނ$-b$-$,j$,$,r$,$,z$,~$,~${,~$j,}$Y,}$H,|$7,|$&,{$,{$,z$+&z$+y$+.y$+x$+6x$+w$+>w$|+v$k+Fv$ Z+u$I+Nu$8+t$'+Vt$+s$ +^s$$*r$(*fr$,*q$0*nq$4*p$8*vp$<*o$@}*~o$Dl*o$H[*n$LJ* n$P9*m$T(*m$X*l$\*l$`)k$d)"k$h)j$l)*j$p)i$t)2i$x)h$|~):h$m)g$\)Bg$K)f$:)Jf$))e$)Re$)d$(Zd$(c$(bc$(b$(jb$(a$(ra$(`$n(z`$](_$L(_$;(_$*(^$(^$(]$']$'\$'\$'[$'&[$'Z$'.Z$'Y$o'6Y$^'X$M'>X$<'W$+'FW$ 'V$ 'NV$&U$&VU$&T$ &^T$$&S$(&fS$,&R$0&nR$4p&Q$8_&vQ$<N&P$@=&~P$D,&P$H&O$L & O$P%N$T%N$X%M$\%M$`%L$d%"L$h%K$l%*K$pq%J$t`%2J$xO%I$|>%:I$-%H$%BH$ %G$$JG$$F$$RF$$E$$WE$$D$$_D$$C$r$gC$a$B$P$oB$?$A$.$wA$$@$ $@$#@$#?$# ?$#>$#>$#=$#=$#<$s##<$b#;$Q#+;$@#:$/#3:$#9$ #;9$"8$"@8$ "7$"H7$"6$"P6$"5$ "X5$$t"4$(c"W4$,R"3$0A"_3$40"2$8"g2$<"1$@!o1$D!0$H!w0$L!/$P!/$T!/$X!.$\! .$`u!-$dd!-$hS!,$lB!,$p1!+$t !#+$x!*$| +*$ )$ 3)$ ($ ;($ '$ C'$ &$v K&$e %$T S%$C $$2 [$$! #$ c#$"$b"$!$j!$ $r $$z$w$f$U$D$3$"$$$$$ &$ $ .$ $ 6$ x$ g>$ V$ EF$$ 4$( #N$, $0 V$4 $8 ^$< $@ f$D $H n$L $P yv$T h$X W~$\ F$` 5$d $ $h  $l  $p  $t  $x  $| " $  $ * $  $ z2 $ i$ X:$ G$ 6B$ %$ J$ $ R$ $ Z$ $ b$ $ j$ {$ jr$ Y$ Hz$ 7$ &$ $ $ $ $ $ $ $ $!&$!|$!k.$ !Z$!I6$!8$!'>$!$ !=$$!$(!E$,!$0!M$4!$8!U$$"-$"$" $"$"=,d =$d =(d $"=rd $@#=qd = d e$"p$"_d$"N$"=|$",$"$"  $"$"8$"$"P$"$"h$"$"$"q $"`$"O$$">$"-<$"ȿ$" T$"$"l$"$"=rd $@#I$#$#D$#Ȼ$ #qL$#`к$#OT$#>ع$#-\$ #$$# d$(#$,#l$0#$4#t$8#$<#|ve ;avBD$$L$L$9{D$L$ $D$D$H{D$ D$e ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$X6{L$ D$T$De ;avEYuBD$t,H@$D$L$TD$ L$D$L$ y{ 뢍|$9;u#e ;avPYuMD$t7$D$ D$ʫD$ L$T$\$T$$D$(L$,\$0py{ i뗍|$9;u#e ;av?YuD$D$ D$L$T$\$D$\L$`u D$ tNH4$H8L$TH<$DŽ$DŽ$ĤÍx4tNy8$y{$p0$|$$\D${$* $|$D${+$$0$$D$7{D$ L$$$$$ 0$$L$7{D$ L$$$$$$(0$$$L$?7{D$ L$$,$0$$$X^{|$Ge uZ $O e u%$G p$@$DpÍO ω‹$荵̍~롉$L$4D$D$ D$L$$@$DpÍ0$|$$D${$ ࿡$|$`D${Bke ;a< $]{D$D$$#Eg@@ܺ@ vT2@P@T@X @ $`T$D$E:{D$L$ $D$D$DD$D$HD$ a@$ `L$T$$T$:{D$L$ T$@Zj \$l$ $D$D$@HP X@D$\$ $T$'D$D$L$L$ @$`T$\$$\$9{D$ L$$L$D$ D$D$D$ `D$D$D$ D$$$D$L$T$D$0L$4T$8D$(D$,$D$0D$4{D$L$ D$(L$,$D$D$(D$D$ D$D$L$D$LL$P{$ w0$|$$D${$ 1`$|$D${Ѻj$$($, 0 $$(L$#{D$ L$$ $$C$L$|$D$ /D$L$$x$|C}ĜÄT$$AD$c }u}ĜË$h謊'e ;a4D$8H PXh\$l$ $L$3 D$D$L$L$$c T$(\$8k l$st$ T{$D$0 \ $I{D$L$H e lL$ HL$H$ e ;L$$H @, e  @(@0 e  tNH4L$(H8L$0HL$LH @, e @(@0 e  tNH4L$XH8L$`H{|$D$ H@ Ge u$D$|$D$D$ÉW~e $;AS$$T1$TfDŽ$T$<֖$ʖƄ$$ 趖Ƅ$ $$c<9t $T$D$ 膝$ $G$$ 4$<$!$={|$$e 55`苚$ye $T˚ e $z($<觚$Is$I$$$1處$荕Ƅ$$ly$$$E$9t,$\$L$:$l$$$l$$$ՙ$1 x$DŽ$$$$蜙 S $$L$D$D$ D$P~L$$T$\$-e y@$'J$$$18 $DŽ$ $ $$$$<ד$<$7$ $$L$$L$|$ $<$$$$*$$$$$:{|$Ge uZ $O e u%$G p$$ÍO ω‹$̍DŽ$DŽ$É$$S$|$$D$蜔{$$2:$$0$$D$x{D$ L$$$л0$|$$<D${$@0$|$$TD${$|$`D$œ{Kye ;ae vu`| e i}UY$֗8k&4C{e $u 4rd Ie Í=4rd xEe ;av: D$$L$L$GzD$L$ $D$zD$D$ /xe ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$uzD$ 1݉4$T$l$誵zL$ D$\$wqe ;avQ D$$L$L$WzD$L$Q$D$@zD$L$ $D$)zD$D$ (we ;aD$H\$k39tt1ɄtjH Pks 9t;1Ʉt1H@S[9t 1D$É$D$\$諴zD$ 1݉,$T$t$萴zL$ D$\$1뤉4$T$l$mzL$ D$\$lVv1e ;av: D$$L$L$zD$L$ $D$zD$D$ ue ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$蕳zD$ 1݉4$T$l$zzL$ D$\$fuqe ;avYD$$L$L$'zD$L$Q$D$zD$L$ $D$D$zD$ D$te ;aD$HT$Z*09tV1ɄtLH Z jp9t1Ʉt@J9D$1,$t$\$nzL$ D$T$1‰,$t$\$KzL$ D$T$7tRe ;av: D$$L$L$zD$L$ $D$zD$D$ se ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$uzD$ 1݉4$T$l$ZzL$ D$\$Fsqe ;avBD$$L$L$zD$L$ $D$D$xzD$ D$re ;avUD$HT$Z*09t1Ʉt@J9D$1,$t$\$舰zL$ D$T$tre ;av:1L$"D$ \$؉$L$QL$D$ @|ىL$re ;avN1L$ A}2D$ T$$\$؉D$QD$uD$D$qe ;avHe vu| e ag0yءte Aqe ;avD$HD$L$ qe ;ae vu | e B-:Skn詌D蚆xP;{$D$ `# $D$l!T$D$ %{D$`#$D$D$ b&L$D$ {D$e uD$@rd e Í=@rd D$胇oe ;a,D$0PI \$4\$\$8\$$ыD$ D$L$L$$T$T$ \$\$(t8D$0$T$\$D$D$zL$ T$T$L$L$,Q,$vzL$,QX$ T$$T$uzL$4Q4fNY6iqIL$09ӇÇ߅!Ç ϗ$c D$zD$ L$11ۋl$,]$e uKU(t DŽ$ $$$(É$ DŽ$$DŽ$(Í}(É_먉D$$l$T$ t$@|$\$D$PzD$ D$< @ ${D$D$(L$ T$$P{$D$8 b ${|$$ Ge $L$|ËD$ ^UOω‹$IU릋D$ D$ D$$L$L$8|$`19L$8L$`T$d$ku}EW9MWUi׸<e ut$`<4N$|$D$`D$];{$l$< N $D$|$t$ T$/}D$L$T$|$|D$ D$$$|Ð|e ;av> D$$|D$tD$uD$$D$gz à [e ;aXBD$J L$$RP@T$ $ID$HHL$|$(1p'$L$L$L$(L$zPL$, T$@D$ $dzD$HHL$ ' $T$T$T$T$ x{D$($zD$(uD$@TD$ $0LD$$Ht @ $ЃXÃXe ;av D$$| e ;avBH0@,D$ L$Ue ;avBH0@,D$ L$%e ;avBH0@,D$ L$e ;avD$ D$Xe ;av D$0e ;avOD$ $D$$D$G߇D$ D$L$L$T$ӋD$($D$D$D$D$e D$;Av<B nd $D$L$|$ $.e ;ae vup| e }iW4 }j1Xv&茇J轕{3讏$D$PD$L$ e e  $D$ cD$ L$ ȃd e ̃d Wλ$D$bD$L$ Ѓd e _ ԃd qD虅ޚoGuŅP[9氆)~臓袚ͪ#UYee rd u ,rd e Í=,rd ~臔~2e ;aD$$L$L$CyD$L$Q$D$D$zD$ L$Q $D$ yD$L$Q$D$D$~zD$ L$Q$D$yD$L$Q$$D$yD$L$, $D$D$1zD$ D$蠓~e ;atD$HT$Z*0951Ʉ$HZ8 HX jr 91ɄHZ9HZ8H Xj r9th1Ʉt^H(X$j(r$9t/1Ʉt%H,Z,8u@-J-8D$114$\$l$yL$ D$T$1밉4$\$l$yL$ D$T$x1q1j1c4$\$l$HyL$ D$T$ 11,$t$\$yL$ D$T$~le ;avBD$$L$L$D$?zD$ L$ $D$yD$D$藑~e ;aveD$D$L$ $D$_yD$ t9D$H @T$Z R9t 1D$É$L$\$yD$ 1~e ;avaD$$L$L$D$_zD$ L$Q$D$yD$L$ $D$D$)zD$ D$蘐~e ;aD$D$L$ $cyD$tTD$HP\$ks9t1Ʉt@K9D$14$l$L$yL$ D$\$ƋD$\$1~`e ;avaD$$L$L$D$?zD$ L$Q$D$yD$L$ $D$D$ zD$ D$x~e ;avwD$T$9u`HXjr9t11Ʉu 1D$à D$B $D$ yD$ ׉4$l$L$yL$ D$T$1~me ;avYD$$L$L$D$zD$ L$Q$D$hyD$L$ $D$QyD$D$`~e ;aD$T$9uxJX9ujJ Xjp 9t;1Ʉt1JRX@9t 1D$É$L$\$yD$ 1݉,$L$t$ryL$ D$T$11覍~Qe ;aD$$L$L$D$ zD$ L$Q $D$4yD$L$Q$D$D$zD$ L$Q$D$yD$L$ $D$D$zD$ D$~Ie ;aD$D$L$ $D$ yD$ D$H T$Z hr9td1ɄtZHZ9uLJXhr9t1Ʉt@ J 9D$14$L$\$yL$ D$T$11뾉$t$l$yL$ D$T$|D$T$1m~e ;aD$$L$L$D$+zD$ L$Q$D$tyD$L$Q$D$D$zD$ L$Q$D$>yD$L$$ $D$D$zD$ D$.~Ie ;aD$D$L$ $yD$D$HT$Zhr9td1ɄtZHZ9uLJ X hr9t1Ʉt@$J$9D$14$L$\$1yL$ D$T$11뾉$t$l$ yL$ D$T$|D$T$1m4~e ;aD$$L$L$D$kzD$ L$Q$D$yD$L$Q$D$yD$L$Q$$D$D$zD$ L$Q,$D$gyD$L$Q4$D$D$zD$ L$Q<$D$1yD$L$QD$D$D$zD$ L$T $D$yD$D$ ~e ;aD$D$L$ $D$yD$ D$HT$Zjp91ɄsH Z jp9=1Ʉ,J$X$9J(X(9H0Z0j,p,91ɄJ4X49J8X89H@Z@jyD$L$Q($D$D$zD$ L$Q0$D$yD$L$Q8$D$D$zD$ L$Q@$D$yD$L$QH$D$D$SzD$ L$X $D$yD$D$諅~e ;aD$D$L$ $D$kyD$ D$HP\$ks91ɄKP9sH$P k$s 9=1Ʉ,K(P(9K,P,9H4P0k4s091ɄK8P89Kz|$$$Ge $$G$G $$$L$$T$$\$ $\$SfD$L$T$t^$t-DŽ$$$$|ĨDŽ$$$|ĨÉ$$&1t$$~${$$$D$$L$P9D$L$ T$\$t^$t-DŽ$$$$|ĨDŽ$$$|ĨÉ$$D$$ QT${T$$D$$D$zD$L$ $$$$$D$$D$|$ $迗~蠧$$$$$$ |ĨÐ|ĨË$$cD$t$tE@QDŽ$$$$$|Ĩ1$Ē~Oω‹$诒~z $蠒~ {~qe $t;A $pV~DŽ$DŽ$DŽ$`$:z|$$ e f$2~$ $yD$$t$$L$$T$$\$ $\$bD$L$T$T$$-t$$P踕~$ $$L$$T$6D$L$T$\$ $ $T$$ CD$({$ H4PDT$ $D$L$ T$A e $ A4ADK$$$D$$D$蛈D$ $ $$h1f~$(Z~$(N~Ƅ$($tƄ$)$h$(~$~ #@$DŽ$ $$h•~$ Y(i,֋Q0ύM9MO, +e ω$c~Kv $$}~$@q~$@e~Ƅ$@$$A$B$C$D$$@~$P ~ $PDŽ$T $X$軔~J,iދZ(׋R09PQW,ًe ω$Pd~J iދZ$׋R9~Y_ ыe 3ω$P!~K $k΋$׋Q   M$$~$~$~Ƅ$$tƄ$$$藓~$诎~ e-$DŽ$$$`~J0j,ދZ(׍U9 MO, +e u ω$~K $m $D$L$ T$$D$L$vD$ L$T$\$l$ $,$0$4$$,D$zD$ L$ $D$Ht$$l~$1肍~ $DŽ$ $$3~$ Q0Y(i,u9 UQ,<+e l $ޑ~$QMQFQ#Z$ߌ~$pӌ~Ƅ$p$迌~$q$q$r9t $T$\$舓~$$pI~$$6~$$#~$19~ 0$DŽ$$$~$ Q,Y(i0΍J9JN,< e \$蓐~$QT$$D$$ D$}zD$ L$$$$ $$L$$L$|$ $P葎~$$$$$$@}V$D$,$\$T$$D$ p D$L$T$$$${ Ë$ HDp@$$?$x$p @D$t$|$ ,$\$T$L$ $D$$D$D$$L$,T$($$${ É$$$u1zD$$$1~$P9$$討~$$蕎~e $$t~$9tF$ @D$DŽ$$$$$&{ Ë$$L$$3뜍$$D$$L$z$ P9b$~$Ԉ~$QI T$L$  $D$$L$t$$V~L$4$T$8$0$4~$$ H,QX0h(9QQP,| e u$0~eS$|$$0D$z$ <S$l$L$\$ T$C}D$L$T$$ S0e u C(ʼne{(諆~DŽ$$$Z{ ÍS$|$$D$Vz1S$\$T$l$ L$1C}D$L$T$$ S0e uC(މʉ1{( ~Z$$$(0$$$D$zD$ L$$$3B $D$D$@BD$ =~D$L$$$1u~$i~Ƅ$$PU~$$ ʈ$ 눜$ ш$$$$$$P$變~$$P蛊~$$舊~$0蠅~ $0DŽ$4 $8$Q~$ Q Zi$q9OZY e <u$0~$7S$|$$0D$ z1ӍS$t$T$l$ \$@}D$L$T$$ S$e uCʉ1c{~B $D$D$@BD$ ;~D$L$$$1y~$Xm~Ƅ$X$8Y~$Y$ ʈ$Z 눜$[ ш$\$]$^$_$`$8$X貈~$$8蟈~$$茈~$p褃~ $pDŽ$t $x$U~$ Q,Y(i0r9Oji,-e <u$p~$0S$|$$pD$z1ӍS$\$T$l$ t$>}D$L$T$$ S0e uC(ʉ1$ ^{(~S$|$$D$葄z1|S$\$l$T$ t$l>}D$L$T$$ S0e uC(͉1$ {(?~DŽ$$${ DŽ$|d xd $${ ÍS$L$$D$踃z1$ $kS$\$l$L$ T$=}D$L$T$$ S0e uC($߉͉1{(V~1ΉS$L$$PD$z1$ $S$T$L$\$ l$<}D$L$T$$ S$e uC$߉1/{~S$L$$PD$脂z1$ $S$\$L$T$ l$Q<}D$L$T$$ S0e uC($߉1]{($~1S$L$$D$z1$ $FS$\$l$T$ L$;}D$L$T$$ S0e uC($߉͉1{(~~1$ $$t$ND$u $ $$|$$~D$D$D$D$ D$$L$,T$(e u8$ CD-DŽ$$${ Ë$ {D}~$ y4}~DŽ$$$S{ ÐF{ DŽ$$$ { DŽ$$${ Ë$t$$L$$T$$x\$ $|\$MD$L$T$7DŽ$$${ Í`$|$$D$ze~e ;a$$$$$ta$$$@$ $Ћ$$XA e u$A$TÍy$$X`~艌$$$$@$ $ЋD$L$t*$XB e u J$TÍz$_~퍼$1`~$85e~$ $$T$$\$$8l$ D$D$Egt$$$\e~L$,$D$0$H$:e~$t($XJ e u B$TÍz$+_~獴$Hd~膊D$L$T$$XCK!…!ф$p1_~$5d~$ $$L$$L$$L$ D$D$0f$p$Kd~L$,$D$0$\$p)d~$t($XJ e u B$TÍz$^~獴$\c~u{D$L$T$ \$tH$Xj8Ej8ME e u]B8t@TÍ}]~$\DŽ$DŽ$ DŽ$DŽ$ 6$_ Љ$ c$Љ$$D$$D$D$ D$萭D$L$$XJ e u B$TÍz$\~$$HDŽ$(DŽ$,DŽ$0DŽ$4 6$(_ Љ$,c$0Љ$4$D$$(D$D$ D$軬D$L$$XJ e u B$TÍz$ \~{(\~{[~{[~{[~S{$[~T?D~e $P;A0$4H( $t$$$x_~$ u$80Ë$4@($$$e_~$h@C~Ue D$;A$H( $$L$$T$xD$L$T$\$ ~T$,\$ |$01[~D$D `š $zL$$Zj)YL$HD$LD$PJZL$\\$`J Z\$TL$X|$dt$0_~L$ Y$\$$-`,$l$dl$yL$T$ L$ T$$L$$L$L$, $T$$ҋL$T$umD$ @L$, $ЋD$L$t$$ĘË$@@@8@DŽ$DŽ$ĘÉL$(T$D$ @L$, $ЋD$$D$($ĘÉ$$ĘA~e $;A$H8AHP…!ʄNH( $$L$$T$QD$L$T$\$ t($J e u B$ĬÍz$WX~T$X\$4$iDqHЋQLߍ\9)օVt$($1X~$Q Yiqt$l$$\$T$T$ D$F}L$T$ $$$QY$$T$($$$%]~L$4Q$T$H $$\$yL$T$ L$ T$$L$$T$\$X$l$HՋL$T$tLL$PT$,D$4@L$X $ЋD$,$A e uD$PA$ĬÍy$D$PV~D$4H $T$$\$l$X,$ыD$L$T$ \$tLD$,L$PD$4@L$X $ЋD$,$A e uD$PA$ĬÍy$D$PFV~T$$\$LD$4@L$X $ЋD$L$/$|1W~L$$ 9$Lt$L[~$|$Lq[~$$|^[~L$$9R$$?[~$<$D9$,ʃp|$tbV~ &WL$tD$x $D$@BJT$|$$$D$tD$yD$ L$$$$JB$ BLBLJHt9BB8$$D$D1l$` Ћ$ˉL$`\$@j8q9M1D$<] m99\$8l$\D $|$t$9\~$H8T$$D$$ OL$i{u ${É$$85 L~$d$$hض{É$$85L~$$d$h蝶{Í$85VL~$d$hp{{ ݪ{ /~qe $;A $1DG~y $$$d1'G~$$$4 $Hk;sT7m>Yu5P9,a\59;sT-9$F~$ $$L$$L$$L$ $L$$L$$L$$L$$L$ $L$$$L$($L$,$L$0$L$4T$8$L$<$L$@$ L$D$L$H$L$Lt$P$J~L$h$T$d$$oJ~s$$|$$$$$$D$D$|D$ L$T$$$$1,$$ωڋ$$$$$$$$^ N$V.$ 1D~$ $$$$($,$Q$0$4$Z$9$$ e Rׅu|׍$ H~$A$9$$$dH~DŽ$@$D$H$LDŽ$PDŽ$TļÉ$$$T$$ D$tEz1$$R$$L$T$l$ \$:||$D$l$X1$$$Ӊ$5G~DŽ$@DŽ$DDŽ$HDŽ$L$P$$Tļ11P$B~$ $$L$$L$$L$ $L$$L$$L$$L$$L$ $L$$$L$($L$,$L$0$L$4T$8$L$<$L$@$ L$D$L$H$L$L$L$Pt$T$RF~$$$$8$*F~=$<$8$l$p$D$@$t$x$L$$$X$$T$$L$H$1 $Zʼn$$KS $s$=<$$|$D$L$ (zD$$ e u4$H$@$9t$$x$E?~ō$5 D~DŽ$@DŽ$DDŽ$HDŽ$L$P$$TļÁ;sTCגu59jUg59$ ?~$ $$L$$L$$L$ $L$$L$$L$$L$$L$ $L$$$L$($L$,$L$0$L$4T$8$L$<$L$@$ L$D$L$H$L$L$L$Pt$T$ C~L$l$T$h$$ gC~u+$$d$h$$$5B~DŽ$@DŽ$DDŽ$HDŽ$L$P$$TļÁR8-09*.,{ U%~Pe $;Ac $01=~  $$L$L$|L$$T$ $\$$$$,$1:B$$,$ڋ$$$,Nj$9C-9$H$L$t$$}D$L$T$\$l$ uS$$914Rߋ$LD ȋ e u,3ljp;~!$055A~$D$HÍ`a$yD$$$5`7@~$($$$$$ $$$$$$$$$$ $$4$$$ $0e Ǎ$?~$1L;~$@;~$4;~Ƅ$$(w$$?~࿡$ay|$$e 5?~ e $x$?~$A(A,e y$A$$$$1f:~$Z:~$N:~Ƅ$tƄ$$$?~$:~ e-$DŽ$$$>~$Q,i(ދY$ύM9uMO( e +7׍$o>~$$t$$$<~$H4$P0$$$$$<~$$nD$$$t$t$ $Q4tB-$X18~$L$$ $$L$$L$ D$D$:$X$v=~L$,$T$0$l$XT=~$0$lA=~$$D$HË$Z4K-J4 Y iY i$D18~T$$ $$\$$l$ D$D$9$D$<~L$0$T$,$$$D~<~$$L$$\$"'L$ $$$L$$T$$\$ $\$:D$L$t6$0$;~$$D$$HÉ$$$2$`$ :~$H4$P0$$$$$`9~$$贋$F$1a6~$L$$ $$L$$L$ $L$$L$8$$:~L$0$T$,$0$:~$0$0:~$D$$HÍ$0$:~$$D$$HÍS$T$$D$Y7z1$S$\$l$T$ L$-|D$L$T$$S,e uC$߉͉16$4~3~e0$|$$D$6z$࿡$|$D$6zƄ$| `a $D$$L$q6z${ $ D$ѨD$±y ~ve $;A$1 4~  $$L$L$b|L$$T$$\$ $$$1@$$ڋ$9ύ Ƌi$ 9]Um$W95$Yi 1111ɉ$ 1ɉ$1Ʌuk$9@$l$l,$-e u$ ,$ŋ$ 1~$$57~$$$ĔÉ $l$\$D$ $D$-L$$\$ D$l$T$$$$ $$,$T$\$D$ $D$-\$ D$l$L$T$$$$$$ $э$ _$yD$$$55~$$$$$$$$$$$$$$$$$$$$$$e hǍ$4~$10~$0~$0~Ƅ$$$$:5~࿡$y|$$e 54~ e $xh$4~$A$A(e ,A $$+t$$$2~$H4$P,$$$$$2~$$詄D$$$t$t$$Q4tB-$d1!/~$L$$ $$L$$L$ D$D$Ve$d$3~L$,$T$0$x$d3~$$x|3~$$$ĔË$Z4K-J4 Y iY i$P1K.~T$$ $$\$$l$ D$D$d$P$2~L$0$T$,$$$P2~$$L$$$\$]L$ $$$L$$T$$\$ $\$uD$L$t6$$42~$$$$ĔÉ$$$m$$D0~$H4$P,$$$$$ 0~$$$F$(1,~$L$$ $$L$$L$ $L$$L$b$($&1~L$0$ T$,$<$(1~$$<0~$$ $ĔÍ$$0~$$$$ĔÍy *~0$|$$D$-z${࿡$|$D$_-z6Ƅ$ _ $D$$L$0-z$}{ ~e $;A $,1*~  $$L$L$B|L$$T$$\$ $$$16K$$$$$$ȋ$9@$ Ƌi $$17*~ $9$.~$$.~$l$.~ 9$)~ P9$`.~$$M.~$$:.~ P9$s)~ 09$X.~$$X-~$$-~ 0911111$1uQ$9 ,[$t$L ΋ e u<9'~1'$,5`V-~$X$\Ë$$ $D$$ $L$D$ $$$$T$\$L$D$$ D$ $)$($$T$$L$(D$)D$,$(D$0\$Dl$@D$Y$$1p~ P9]$!~$$!~ P9$$ Ç݄ta$|4/&xd |d $|$hËpd td $|$hË$뢋$a\$1~ 9ue$Q!~$$>!~ 9u$$Ç݋$l P1$l P11$~뛍 ԍ$~a\G$;sTu29]uۇÇ݉ P$1Cגu29]uۇÇ݉ P$1QR$(1N~ 09ui$T~$($T~ 09u*$H$LÇݍ P$ $$T~뗉 0$ͻ% jDŽ$|DŽ$h~?e ;a\D$l6`$D$D$|D$ L$T$1 D ]} 9r:D$LL$4T$8\$`l$d1t$,|$ 1|$D1!t$@FL$4T$,\$ l$DT$8\$`l$d9xt$@ RS|$(L$0T$HY;sT7m>Y-P9\$ \$Dkt$49W\$ l$$4lT L$XJ9YJL ֋l$0) e Tu&L$H 09uD T$,\$ l$$׉ƋD$H~ˉ\$DѨ$t$T$l$ L$|D$L$T$\$Dl$LTe uD|$(ʉƉP|$XV~l$D a\^-9u -P;sT59\$,\$Dkt$49\$,l$$tl L$TM9_ML t$01Le u,T$H 9uD 0T$,\$ l$$ωŋD$Hs~ʼn\$DѨ$T$l$t$ L$;|D$L$T$\$Dl$LTe uD|$(͉‹D$LH|$T ~l$D 0T$,\$ l$D$;sT--PzCגy-9u-jUgJ-9\$Dkt$49\$Dl$$t,T L$PN9UNLLT$0Le u!T$H 0|$DT$,\$ l$$=ωËD$H~؉Љ\$<Ѩ$l$t$T$ L$|D$L$T$\$Y P9 þL$" PD$ I$$X1}$}Ƅ$$(}$$ Օ$ Ζ$ Օ$$$$$$($}$$(}$X$}$ } $DŽ$$$X}$Qi ލ]ϋI$9MO  *e Tω$\}K2KX)I$$h}$\}Ƅ$$H}$$ 눜$ ϗ$ ݕ$$$$$$$}$$}$$u}$} t$DŽ$$$>}J Zi֋R$9QV < e a$}$$[$ D$L$T$ $L$T$V^D$ L$T$\$l$$$$ $$D$|qyD$L$ $L$([t$$0L}$h1b} $hDŽ$l $p$0}$Q$Yi u9UQ <+e B$h}$QT$$D$$D$qyD$L$ $$$$$D$$D$|$ $}t$$$$$H$L$P$T[{Í$$}$QIT$L$  $D$$8L$.t$$}L$8$T$4$H$}$H QX$h9QQP | e u$HB}S$|$$HD$Py$hS$l$L$\$ T$&|D$L$T$$S$e u Cʼne{}DŽ$HDŽ$L$P$$TY{ÍS$|$$hD$y1S$\$l$T$ t$v|D$L$T$$S$e uC͉1$-{I}DŽ$HDŽ$L$P$TX{DŽ$HDŽ$L|d xd $P$TX{ÍS$|$$D$y1S$\$L$T$ l$臥|D$L$T$$S$e uCމ1{a}A $D$D$@BD$ .}D$L$$$p1}$ }Ƅ$$@}$$ ӈ$ ͕$ ӈ$$$$$$@$P}$$@=}$p$*}$B} $DŽ$ $$p}$Q Zi$q9VZY <e u$}$$BS$|$$D$y1̍S$t$T$l$ \$脣|D$L$T$$S$e uCʉ1\{\}S$L$$D$-y1$$S$T$l$L$ \$|D$L$T$$S$e uC$߉͉1 {}1$$$$5D$u $N$4$|$$$^}D$D$D$D$ /D$$L$(T$,e uo$C4u0D$$OD$&M{uT{DŽ$HDŽ$L$P$TT{Ë${4}늋$y(}YDŽ$HDŽ$L$P$TLT{Ð?T{DŽ$HDŽ$L$P$TT{DŽ$HDŽ$L$P$TS{Í $|$$D$yv_}e $;A DŽ$<DŽ$@DŽ$DDŽ$H$ $$L$$T$$\$ $\$FD$L$T$c$$st$$M}$$$D$$L$謇D$ L$T$\$$$T$$ HL$J{$$$D$D$L$ T$9$$S$0$$4D$$8D$D$ $H*$R $D$ L$T$$L$D$USD$L$T$ \$l$X$$$$$D${fyD$ L$ $D$'Pt$$dK}$1a} $DŽ$ $$d}$$$j9nJ$ e <,$}$QT$$D$$D$fyD$ L$$$$$$D$$D$|$ $}w$$$$$<$@$D$HP{ĸÍ$}$QIL$T$  $D$$,L$"t$$}L$4$T$8$|$z}$$H$$9MH$<e u$|)}S$|$$|D$7y`-S,$T$D$\$ L$|T$D$L$$$vDŽ$<DŽ$@$D$HN{ĸÍS$|$$D$y1S$\$T$L$ l$肛|\$T$D$$$1SDŽ$<DŽ$@$D$HN{ĸDŽ$<DŽ$@xd |d $D$HM{ĸ1A $D$D$@BD$ ˕}D$L$$$1}$4}Ƅ$4$}$$5 ʈ$6 ݕ$7 ʈ$8$9$:$;$<$$4}$L$}$$L}$} $DŽ$ $$}$Q$$9SQ$< e u$:}$HS$|$$D$Ay1ӍS$\$L$l$ T$|\$L$D$$$1n$ $菬D$$($|$$}D$D$D$D$ 6&D$$L$,T$($u0D$$OD$C{uFK{ĸDŽ$<DŽ$@$D$HK{ĸDŽ$<DŽ$@$D$HJ{ĸÐJ{ĸDŽ$<DŽ$@$D$HJ{ĸDŽ$<DŽ$@$D$HuJ{ĸ}e $;AƄ$tDŽ$xDŽ$|DŽ$DŽ$a$苂y|$$e $b}$H$$L$$T$$L\$ $P\$˪D$L$T$$$ut$$$|}$$@$ $$L$$T$~D$L$ T$\$o$$D$$ QT$(A{3$h$$lD$$pD$kD$ $H0$$ u$8$}T$$D$$D$e^yD$L$ $$$$$D$$D$|$ $8y}y$$$$$$t$x$|$$G{Ë$H$gD$u $$d$|$$T}D$D$D$D$ "D$,L$(T$$e uw$S0u0T$$OD$X?{ut G{Ƅ$tDŽ$xDŽ$|$$F{Ë${0ʼn}yH$L$D$@BD$ 讎}D$L$$$1}$,}Ƅ$,$y}$$- ʈ$. ݕ$/ ʈ$0$1$2$3$4$$,}$D$}$$D}$\}$\DŽ$` $d$s}$H$PX k9PKH < e u$\&}S$|$$\D$4y$[S$T$\$L$ l$ |D$L$T$$S$e uCˉ‹$_{}D{Ƅ$tDŽ$xDŽ$|$$nD{É狴$}D$HƄ$tDŽ$xDŽ$|xd |d $$ D{Ƅ$tDŽ$xDŽ$|$$C{Ía$|$$D$yR}=e ;a$$D$D1 \$Lى‰L$LT$@|$h<}|$Pt$h/}t$P$}+CD$ D${lÉ$谶D$$$$pL$$tT$$\$ $\$hD$L$t<$$'}$$$$ ={lÉ$$aj$8$8}$H4$P,$$$$$8}$$#$G$$P}$1}} p $$L$OyL$ T$T$L$$p $$tL$$L$$L$ $$}L$0$T$,$0$}$$0}$$$ <{lË$獴$e}pD$ 1 p$$k};$$$h$$}$X@$$D$ L$T$$L$D$u=D$L$ T$\$l$H$$$$$D$PyD$ L$ $D$G:t$$k}$1} $DŽ$ $$2}$Q(Y$i s9ISQ$|e u$}S$|$$D$y1ڍS$l$\$T$ t$Ї|D$L$T$$S(e uC ˉ1$d{ }䍼$5pm}$$ K:{lÍ$5P@}|d xd $$ :{lË$$輚D$u$$r$H, $D$u$$D$$|$$}D$D$D$D$ &D$$L$,T$(e uy$C4u0D$$OD$x1{u)9{lÉ$$50}$$$ 8{lË${4}뀉$$5}$$$ 8{lÍ _$|$$xD$y$}e $;A~$1Z}DŽ$DŽ$ T $pyL$$$$qdt$ e $=}$ $$L$$T$lD$L$T$\$ tz$t4$5}$$$`7{ĠÉ$$5N}$$$%7{ĠÉ$$$H, $D$f$$L$$ PT$ /{*$1}$$ } T $$L$$L$LyL$ T$$$$ $$L$$L$|$ $}2v$$-}$$$$$$}$ $$L$q$$}$$$$5{ĠÐ5{ĠË$D$$D$$D$ $D$$D$$D$$ND${$5/}0d 4d $$5{ĠÍ$(X} T$$D$$(L$yp}[e $L;A4DŽ$DŽ$DŽ$DŽ$DŽ$ b$ly|$$e $@}$$$8L$$<T$$\$ $\$D$L$T$$ $$8L$$<T$hD$L$T$\$ n$$T$$ CD$+{2$$$D$$D$D$ $H,$$_t$$xl}T$$D$$D$HyD$L$ $$$$$8D$$<D$|$ $x}$$$$$$$$$$G2{4Ë$$D$u $$$|$$}D$D$D$D$ D$,L$(T$$e uz$S,u0T$$OD$){ux1{4DŽ$DŽ$DŽ$$$W1{4Ë${,ʼnm}vH$L$D$@BD$ 5y}D$L$$$1 }$(}Ƅ$($}$$) ʈ$* ݕ$+ ʈ$,$-$.$/$0$$(W}$@$D}$$@1}$XI}$XDŽ$\ $`$}$H PXj9PJH< e u$X}S$|$$XD$y$\S$\$T$L$ l$||D$L$T$$S e uCʉË$_{f}./{4DŽ$DŽ$DŽ$$$.{4DŽ$DŽ$DŽ$$$.{4Í b$|$$@D$yj8}e ;a8D$<TL$D=9T$@jrL$DT$@D$< 3 $D$D$y|D$ L$T$\$D$D$L$T$ D$yD$T$ T$@ rd  $eyD$D$HD$LD$PD$TD$X8x}Ce $L;A4$L1跽}L$L$ $@ZR>x-9R$D΋M׋Um\m 09I$DZ*.|$D6}|$t-}D$t|$\}\$uL$uL$v9t $l$\$}|$\t$t}$t$\}|$D$}$1讼}$8$$<$$t$D^}$L$7}DŽ$lDŽ$p4ûGl$$\$(0$D$$D$ByD$L$ $L$V($t$ z}$1萺}$8$$<$$$=}$L$}DŽ$lDŽ$p4ÉΉ׺Ή׋$D腡}e ;av"D$t H(tÉ$G}e $;A|DŽ$DŽ$ DŽ$DŽ$DŽ$_$`y|$$e 8$q}$$$L$$T$$\$ $\$D$L$T$$$%Tt$$}$$$D$$L$^\D$L$ T$\$$$T$$ AD$o{$H0PD$L$T$ b e @$A0A<'$$$D$$D$"D$ H$hI$.D$L$T$ $L$T$(D$ L$T$\$l$ $$$$$D$(;yD$L$ $L$$t$$h}$1}$DŽ$ $$h迻}$H$P(X,j9ZX(< e $j}T$$D$$D$f;yD$ L$$$$$$D$$D$|$ $z}+q$$$$$$$ $$$${|ÍS$|$$D$軷y$S$L$T$\$ l$q|D$L$T$$S,e uC$ʉ{$k}DŽ$DŽ$ DŽ$$$${|DŽ$DŽ$ DŽ$xd |d $$#{|É$A $D$D$@BD$ k}D$L$$$1蘴}$8茴}Ƅ$8$ x}$$9 ʈ$: ݕ$; ʈ$<$=$>$?$@$ $8ϸ}$P$ 輸}$$P詸}$} $DŽ$ $$r}$Q(Zi,q$9OZY(<e u$%}$S$|$$D$,y1ӍS$t$T$l$ \$ o|D$L$T$$S,e uC$ʉ1c{$}鋄$$aD$u $$$|$$芷}D$D$D$D$ D$$L$,T$(e uz$C$DŽ$ $$$躢}$<Q0Y(i,΍M9MN,<+ e O$c}L$$4$ZZ+[$d}$ X}Ƅ$ $D}$  ݕ$ Ζ$ 눜$$$$$$$ 螡}$$苡}$$x}$萜} $DŽ$$$A}$<Y(i,֍UϋI09MO, e +׉$}K LK(=K,3K0 K8  $$ћ}$dś}$d蹛}Ƅ$d$tƄ$e$$dd}$\|} :}$\DŽ$`$d$-}$<Q0i,ދY(ύM9 MO, +e H ω$\Ο}K< $$}$ۚ}$Ϛ}Ƅ$$tƄ$$$z}$<蒚} N5$<DŽ$@ $D$C}J0j(ދZ,׍S9 KO,Le  ω$<}K@D KH $$}$}$}Ƅ$$tƄ$$$苞}$裙} $DŽ$  $$$T}J0j,ދZ(׍U9.MO, +e ω$}KL $$}$L }$L}Ƅ$L$tƄ$M$$L訝}$} CG$DŽ$ $$q}J,j(ދZ0׍Q9QW,e qω$}KPg)I$$1}$%}Ƅ$$\}$$ ͕$ $ ͕$$$$$$\$\}$l$\I}$$l6}$N} t$DŽ$$$}J(j,ލ]׋R09UW,e nω$訛}KT $$}$|赖}$|詖}Ƅ$|$tƄ$}$$|T}$l} $DŽ$$$}J0j(ދZ,׍S9FKO,Le ω$Ě}KX{T$$D$$$D$yD$L$ $$$<$$ L$$ L$|$ $\ɘ}$$$$$tT$$$<@@$CDŽ$ $$ $$ { Ë$<k@s<$0$ ?$,{s [$|$t$\$ $D$T$l$ $0D$$,D$\!D$$L$(T$,$ $ $ U{ Í$j}KXS\L$T$  $D$$ L$S$$4}L$8$ T$4$$Θ}$<H,QX0h(9QQP,| e u$茘}S$|$$D$蚕y$<S$l$L$\$ T$pO|D$L$T$$<S0e u C(ʼne{(L}DŽ$ $ $ $ { ÍS$L$$D$y1$<$S$l$\$L$ T$N|D$L$T$$<S0e uC($߉ˉ1e{(莑}S$L$$D$_y1$<$rS$L$l$T$ \$,N|D$L$T$$<S0e uC($߉͉1{(}S$L$$D$Γy1$<$oS$l$L$\$ T$M|D$L$T$$<S0e uC($߉1{(n}S$L$$D$?y1$<$S$\$l$L$ T$ M|D$L$T$$<S0e uC($߉͉1}{(ݏ}⍼$ǐ}KDS@T$L$ & $D$ $ L$$$4M}L$8$T$4$$+}$<Q,Zi(ȋI09^JH, e |u!$}1$<$S$|$$D$y$<ōS$l$T$L$ \$K|D$L$T$$<S0e uC(ʉʼnV{(蘎}DŽ$ $ $$ @z ÍS$L$$<D$ ݕ$? ш$@$A$B$C$D$l$<}$$l讐}$$蛐}$|賋} $|DŽ$ $$d}$<Q,Y0i(r9PZY,e |u$|}$GS$|$$|D$y1ӍS$l$T$\$ t$F|D$L$T$$<S0e uC(ʉ1b{(Ӊ}A $D$D$@BD$ A}D$L$$$1苊}$T}Ƅ$T$k}$U$ ʈ$V ݕ$W ш$X$Y$Z$[$\$$TŽ}$$诎}$$蜎}$贉} $DŽ$ $$e}$<Q$Y is9PSQ |e u$}$=S$|$$D$y1ӍS$l$\$T$ t$D|D$L$T$$<S$e uCˉ1$<]{χ}䍼$蹈}K$S T$L$  $D$$ L$$$4?}L$4$T$8$\$}$$<Q,Zi(ȋI09WJH,| e u$\Ҍ}1$S$|$$\D$׉y$<̍S$l$T$L$ \$C|D$L$T$$<S0e uC(ʉʼn]{(芆}DŽ$ $ $ 9z ÍS$T$$D$5y1$S$\$l$L$ T$ C|D$L$T$$<S0e uC($߉͉1{(څ}$<轆}JZL$\$  $D$$ L$$<$4C}L$8$T$4$|$<!}$<Q,Zi0ȋI(9]ZX,< e u!$|ފ}1$4$S$|$$|D$܇y$<ōS$L$T$l$ \$A|D$L$T$$<S0e uC(ʉW{(菄}DŽ$ $ $$ 7z ÍS$|$$D$3y1S$\$l$T$ L$A|D$L$T$$<S0e uC(މ͉1%{(}8$Ʉ}$轄}fDŽ$$T规}$T蛄}fDŽ$T$胄} >$DŽ$$$4}$L} } $DŽ$ $$T}$<Q0Y(i,΍M9MN,<+L+ $(e u&$蝈}$($芈}"S$|$$L$蘅yS$$(D$$D$ty1$<S$\$l$T$ L$H?|D$L$T$$<S0e uC(މ͉1{( }S$|$$<D$y1S$\$l$T$ L$>|D$L$T$$<S0e uC(މ͉1){(褁}k$@$D0$$@D$yD$ L$$4$8DS$|$$\D$)y1S$\$l$T$ t$>|D$L$T$$<S0e uC(͉1$<'{(׀}DŽ$ $ $ z DŽ$ xd |d $ $ Tz ÍS$|$$|D$Py1S$\$l$T$ L$+=|D$L$T$$<S0e uC(މ͉1"$8}3,S$L$$D$‚y1$$8$<S$T$L$\$ l$<|D$L$T$$<S$e uC$8$1{V}ߍS$L$$D$'y1$<$$81S$\$l$T$ L$;|D$L$T$$<S0e uC($8$͉1$8~}ٍS$L$$D$膁y1$<$S$l$\$T$ L$S;|D$L$T$$<S0e uC($߉ˉ1{($~}1$<$$| $ND$u $<$ $|$$ 跃}D$D$D$D$ -D$$L$,T$(e u8$<C@lDŽ$ $ $ 6z Ë$<{@P}}$<y4?}}DŽ$ $ $ z Í|$$<8}$ $$ D$$ D$`$ D$d$D$h$$D$l$ D$p$ D$t$ D$xD$|$$$ $ $ @z Ð3z DŽ$ $ $ z DŽ$ $ $ z Í`$|$$$ D$~yid}e $ ;A4 `$ |}$1|}$$l$pL$T$ L$ D$$x$tT$L$4j|L$ T$$$$ $$L$$L$9L$ $ $$T${L$T$\$l$t$ "$$$$H@PD+HPt $Ƅ$HDŽ$PtzP8tPI}e $;A$hXa}$A $yD$$$Q   $`1#a}$a}Ƅ$$xa}Ƅ$$$9t $\$D$g}$x$e}$$xe}$`$ne}$1`} t$DŽ$$$`5e} S $$T$D$D$ D$ ||$$L$$T$e $d}$@$T$LD$H$$k504$D$l$*|D$L$T$ $ks l$ ߍ\$$$1$$ $$$^'$C9|υL$X$01_}b$058c}$^} $DŽ$$$0c}L$HQl$L9$e <^$Sc}K3[u$$$ĸÉL$Tt$PT$|$l$x4$L$D$ʚ;D$ '}D$D$L$T$\$k $$s $4$$8D$$<D$nD$ $L$$ PT$$XxX$$$0$M}$ $$$0M}$$$$sD$$L$l$$t$,$tB-$1I}$ $$L$$$N}$L$`D$dD$h, $$cN}$$$$$;N}$@$(N}$\$$`zĨË$Q-$ Q YQ Y$1I}$ $$T$$$M}$L$`D$dD$hA $$xM}$$$$$PM}$1pH} p9$$M}$$$L}$t$L} p9F$u5$@$L}$\$$`賶zĨÉ$.D$$ $$L$$T$$\$ $\$D$L$t<$@$7L}$$\$$`zĨÉ$ $$t$\J}$ $$$t?J}$$$$$T$$tK}$1F} p $$L$*xL$ T$T$dL$h$ $$L$$$J}$L$`$$ K}$$$$$J}$@$J}$\$$`蹴zĨË$獴$tJ}+D$ 1 p$$E}:$41{E}$QIL$T$  $D$$0L$]$4$I}L$8$T$4$4$4I}$H$$9MH$ e <u$4I}&S$|$$4D$Fy-S,$\$D$T$ L$y|\$D$L$$$v$@50\"I}$\$$` zĨÍ$T1 D}$Q Y\$T$ Һ$D$$0T$$T$H}L$8$T$4$T$T}H}$Q$$9`Q$| e u&$T2H}$$$S$|$$TD$+EyǍS$l$L$\$ T$ {l$L$D$$$c$@5\G}$\$$`蟱zĨËB $D$D$@BD$ |D$L$$$,1B}$DvB}Ƅ$D$bB}$$E ʈ$F ݕ$G ʈ$H$I$J$K$L$$DF}$\$F}$,$\F}$A} $DŽ$ $$,\F}$$$j9ZJ$< e u$F}$$oS$|$$D$Cy1̍S$\$T$L$ l${\$T$D$$$1g$$$$C}$@$ $ sD$ L$T$ $T$D$D$L$T$\$l$ @$$ $$$D$xD$L$ $L$賭t$$tD}$1?} $DŽ$ $$tD}$$$k9ZK$< e u$HD}$$S$|$$D$HAy1̍S$T$\$L$ l$&{T$\$D$$$1g$$@5[C}$$\$`豭zĨÍ$@5[C}xd |d $\$`xzĨË$ $"D$u $i$($|$$KC}D$D$D$D$ D$$L$(T$,$u0D$$OD$ zuѬzĨÉ$$@5[B}$$\$`薬zĨÍ$@5[wB}$\$`izĨ %}e $;A$,1H=}DŽ$HDŽ$L `c $x|$$ e `$:A} T$XxD$$$  $.t$e $?}$  $$L$$T$YD$L$T$\$ tz$$t4$,5P\2A}$H$($LzļÉ$$,5p\@}$$H$LzļÉ$$$H( $8D$f$$L$$ PT$Ǣz*$(1;}$$>} T $$L$$L$JxL$ T$$$$ $$L$$L$|$ $^>}<$$(?}$$$$$ $(?}$  $$$L$q$,$ x?}$$H$$L\zļÐOzļË$D$$D$$D$ $D$$D$$D$$ND$@5{$,5\>}0d 4d $H$L辨zļÍ$D=} T$$D$$DL$;y`c$|$$D$;y !}e $;A $<1H9}DŽ$XDŽ$\$ $$T$$\$$ l$ $t$L$T$\$z$$$0$$4D$$8D$TD$ $A $$\1z8}$n8}$b8}Ƅ$$tƄ$$\$ =}$%8} M-$DŽ$$$\<}$$$֍S9AS$< e $v<}L$$$Z Z \$$j . jm$tW7}$K7}$?7}Ƅ$uƄ$$t$;}$d7} *$dDŽ$h$l$t;}$$ދ$׍U9)M$ e +׉$dR;}$Q^I  $$Y6}$M6}$A6}Ƅ$$tƄ$$$:}$D6} ۺ$DDŽ$H$L$:}$$$k9`S$< e $DW:}$$$ $8}$$$$ 8}$$$$gD$$L$x$$t$($tB-$14}$ $$L$$$8}$L$lD$pD$tp $$W9}$$$$$/9}$<$9}$X$$\zĘË$Q-$ Q YQ Y$p13}$ $$T$$$7}$L$lD$pD$t $p$l8}$$$$$pD8}$1d3} p9$$$ 8}$$$$7}$$7} p9F$4u5$<$7}$X$$\觡zĘÉ$D$$$$L$$T$$ \$ $\$D$L$t<$<$+7}$$X$$\zĘÉ$ $y$d$P5}$$$$d35}$$$$$T$$u6}$811} p $$L$xL$ T$T$pL$t$ $$L$$$l5}$L$l $8$5}$$$$T$85}$<$T5}$X$$\譟zĘË$獴$|5}D$ 1 p$$$0}:S$|$$DD$X2y1S$L$\$T$ l$3{L$\$D$$$1a$$0}$QY\$T$ $D$$,T$q$$$4}L$8$T$4$$$k4}$Q$$9TQ$| e u$ 4}1$S$|$$D$%1yӍS$l$L$\$ T${l$L$D$$$o$<5P]3}$X$$\虝zĘÍS$T$$dD$0y1$S$\$l$L$ T$i{\$l$D$$$1$$$D6.}J ZL$\$ Һ $D$$,L$p$D$2}L$4$T$8$$D2}$$Q$$9aQ$< e u($I2}1$$$S$|$$D$@/yōS$\$L$l$ T$ {\$L$D$$$b$<50]1}$$X$\贛zĘËC $D$D$@BD$ |D$L$$$,1,}$,}Ƅ$$Dw,}$$ ш$ ݕ$ ʈ$$$$$$D$0}$$D0}$,$0}$+} $DŽ$ $$,q0}$$$j9ZJ$< e u$0}$$S$|$$D$-y1̍S$\$T$L$ l${\$T$D$$$1g$$)$$.}$@$H $!]D$L$T$ $D$T$D$L$T$\$ l$@$$ $$$D$xD$ L$ $D$Ǘt$$.}$1*} $DŽ$ $$.}$$$i9ZY$< e u$\.}$$S$|$$D$\+y1̍S$T$L$\$ l$:{T$L$D$$$1g$<5]-}$X$\ӗzĘÍ$<5\-}|d xd $X$\蚗zĘÍS$|$$D$*y1S$L$\$l$ T$q{L$\$D$$$1$y1$$D$u $Z$$$|$$,}D$D$D$D$ rqD$$L$,T$($u0D$$OD$юzu肖zĘÉ$$<5\\,}$X$$\GzĘÍ$<5\(,}$X$\zĘ}e $;A$81&}DŽ$TDŽ$X  $;x|$$ e `$*} T$xD$$$, $t$e $)}$, $$L$$T$ D$L$T$\$ tz$0t4$85p]*}$T$4$X͔zļÉ$$85]*}$$T$X蒔zļÉ$$$H4 $["D$f$$L$$ PT$wz*$(1J%}$$x(} T $$L$$L$xL$ T$$$$ $$L$$L$|$ $(}o0$$()}$$$$$ $(W)}$, $$$L$!$8$ ()}$$T$$X zļÐzļË$D$$D$$D$ $D$$D$$D$$ND${$85](}0d 4d $T$XnzļÍ$D&} T$$D$$DL$W%y$|$$D$5%y }e $<;AKD$1"}DŽ$DŽ$$ $$HT$$L\$$l$ $t$L$T$\$$$$$$D$$D$?CD$ $L$$0LP:$1"}$"}$"}Ƅ$tƄ$$$&}$!} e-$DŽ$$$&}$x$$|ލ]9IU$|<) e $&}L$$,$Z Z  \$$(j9 jm$!}$ }$ }Ƅ$uƄ$$$%}$ } *$DŽ$$$a%}$$|ދ$x׍U94M$| +e ω$$}JoJ$ $$p }$}$}Ƅ$$tƄ$$p$$}$p} ۺ$pDŽ$t$x$pc$}$|$x$i9qY$|< e /$p$}$$膺$$,]"}$$$,$@"}$$$$tD$$$L$x$ $t$$tB-$1}$H $$LL$$$$P"}$L$lD$pD$t$$ #}$$$$4$"}$$4"}$$$赌zDË$Q-$ Q YQ Y$1}$H $$LT$$$$P!}$L$lD$pD$t$$ "}$$$$$!}$1}$p9$P!}$$$P!}$$!}$9M$u5$$g!}$$$RzDÉ,$sD$$$$HL$$LT$$\$ $\$+D$L$t<$$ }$$$$躊zDÉ$$$$$,}$$$,$}$$$$p$T$$ }$1K} p $$L$ɜxL$ T$T$pL$t$H $$LL$$$$P}$L$lA$$ }$$$$$}$$m}$$$XzDË$$獴$ }+D$ 1$$px$P}+S$|$$pD$y1S$T$L$\$ l${T$L$D$$$x1P$}J Z\$L$  $D$$L$[$$(1}L$8$T$4$P$}$|Q$x$9SQ$|< e u$P}1$S$|$$PD$yӍS$\$L$l$ T${\$L$D$$$xp$5^S}$$$>zDÍS$L$$D$:y1$$(S$\$l$L$ T${\$l$D$$$x1$($$0}JZ\$L$ Һ $D$$L$Y$0$(Z}L$8$ T$4$p$08}$|Q$$x9bQ$|| e u($p}1$,$$(S$|$$pD$yōS$l$L$\$ T${l$L$D$$$xa$5^m}$$ $XzDËC $D$D$@BD$ P|D$L$$$1;}$0/}Ƅ$0$}$1$ ʈ$2 ݕ$3 ʈ$4$5$6$7$8$$0r}$$_}$$L}$d} $DŽ$ $$}$$|$xj9ZJ$|< e u$}$,$S$|$$D$y1̍S$\$T$L$ l${\$T$D$$$x1g$$ͯ$$,}$0@$H $FD$ L$T$$L$D$虄D$L$T$\$ l$C$4$8$<$$4D$迗xD$ L$ $D$k$`$0}$1} $DŽ$ $$`S}$$|$xj9ZJ$|< e u$}$,$S$|$$D$y1̍S$\$T$L$ l${\$T$D$$$x1g$5p^}$$tzDÍ$5P^U}xd |d $$;zDÍS$|$$D$7y1S$L$l$T$ \${L$l$D$$$x1$q1$YD$L$T$\$$$0$D${D$L$ T$$u$1$ ΉЋ$ى$$$$$]}m$|$l$褁D$L$T$ \$l$$L$P$T$$LL$ʔxD$ L$ $D$v~$x$0}$H$9$$,@<-e $xP}$A$9$$$X1C}$X58}$} S@$DŽ$ $$X}$x$|$j9ZZ$|< e u$v}$$0dS$|$$D$vy1̍S$L$T$\$ l$T{L$T$D$$$x1g$@$$D$H$H}Ƅ$H @ $$@L$芏xL$ T$$X$\$X$H}1$$0$|$$xD$y$$0$$l$D$T$ L$W{\$D$T$H$$50^}$$|zDÉˉՉ‰$$5^}$$$|zDË$$XD$u $/$$|$$}D$D$D$D$ VD$$L$(T$,$u0D$$OD$Vtzu|zDÉ$$5]}$$${zDÍ$5]}$${zDC|e $;A$81x }DŽ$TDŽ$X ` $軳x|$$ e `$L} T$舳xD$$$, $^t$e $*}$, $$L$$T$良D$L$T$\$ tz$0t4$85^b}$T$4$XMzzļÉ$$85^'}$$T$XzzļÉ$$$H4 $D$f$$L$$ PT$qz*$(1 }$$ } T $$L$$L$zxL$ T$$$$ $$L$$L$|$ $ } $$(}$$$$$ $(}$, $$$L$衴$8$ }$$T$$XxzļÐxzļË$D$$D$$D$ $D$$D$$D$$ND$p{$85_}0d 4d $T$XwzļÍ$DE } T$$D$$DL$ y`$|$$D$ y;|e $;Ah $h1z}DŽ$|DŽ$ `a $軯x|$$ e  $V }$8$$L$$T$$<\$ $@l$D$L$T$_ $$Q4?$\$$`D$$dD$7D$ L$$CP$1n}$b}$V}Ƅ$tƄ$$$ }$!} ($DŽ$$ $ }$Q(Y$i,΍J9<JN(< e ${ }$$$T$ }$H4$P0$$8$$$T }$$~[D$$$t$X$Q4tB-$P1}$L$$ $$L$$L$ D$D$$P$ }L$,$T$0$d$Pp }$h$d] }$$|$4tzË$Z4K-J4 Y iY i$<1&}T$$ $$\$$l$ D$D$$<$ }L$0$T$,$$< }$x1} p9$$N }$$x$4 }$$x! } p9E$u5$h$ }$|$$rzÉ$ D$$8$$L$$T$$<\$ $@\$D$L$t<$h$}$$|$$RrzÉ$$輞$$}$H4$P0$$8$$$[}$$>X$G$X$}$1} p $$XL$TxL$ T$T$L$$ $$L$$L$$L$ d$$O}L$0$T$,$($-}$h$(}$|$$pzË$獴$}D$ 1 p$$};S$|$$D$y1S$\$T$l$ L$w{D$L$T$$S,e uC$މʉ1v{$O}鉄$$$臜$$^}$HyX$$x1}$}$}Ƅ$tƄ$$x$|}$8} e-$8DŽ$<$@$xE}$Q(Y,i$΍J9WJN(| e u$8}$$S$|$$8D$y1̍S$l$T$\$ L$ӻ{D$L$T$$S,e uC$މʉ1[{$|鋄$$1$8$D$u$$$T$|$$D2}D$D$D$D$ HD$$L$,e \$(uy$B4u0D$$OD$ezumzÉ$$h5}$|$$pmzË$z4|뀉$$h5M}$$|$$mzÍ`a$|$$D$ y|qe $;A~$1|DŽ$DŽ$ T $+xL$$$$t$ e $}$ $$L$$T$,D$L$T$\$ tz$t4$50}$$$kzĠÉ$$5P}$$$kzĠÉ$$$H0 $~D$f$$L$$ PT$cz*$1o|$$| T $$L$$L$xL$ T$$$$ $$L$$L$|$ $1|'$$}$$$$$$}$ $$L$D$$_}$$$$/jzĠÐ"jzĠË$D$$D$$D$ $D$$D$$D$$ND$z$5p|0d 4d $$izĠÍ$(| T$$D$$(L$zx|[e $ ;A`$16|DŽ$DŽ$$| $*t$$D|$| $$dL$$hT$襝L$T$ \$l$$$L$$ BD$`z$L@$ݠxD$$ $X1Q|$l$\$p$`$t$d$x$h `š $~xD$$$H$lDŽ$pDŽ$te $ $X|$1| T $$L$$L$w}xL$ T$$$$  $$dL$$hL$|$ $|>$$|$$$$4$|$$4|$$$fz`Í$$ D$$XL$x$d$$hD$$lD$$pD$ $tD$$xD$$D$$D$$D$ $D$$D$(L$,$$5|$$$ez`Ðez`Í$5|$$ez`?|Je D$;A|$ 1x|D$4 `š $ϝxL$$$QL$8D$<D$@$L$L$L$P$L$D$L$H|$Tt$ |$I$L$`$T$TT$wwxL$ T$T$ L$$L$$L$$ $L$ыL$T$$$Ĉ|e $;A DŽ$TDŽ$XDŽ$\$($$L$$T$$,\$ $0\$D$L$T$p$ $$L$$T$膘D$L$T$\$  $$T$$ CD$[z$$t$$$|$@$ $$D$,/D$L$ T$$ $$H$$LD$$PD$%D$ $$1|$ |$ |Ƅ$ $tƄ$!$$ D|$8\| $8DŽ$<$@$ |$$$j9B$<e $8|$$0$X$|T$$D$$D$wxD$L$ $$$$$D$$D$|$ $X|>A$$$$$$\$$L$D$$D$ $D$$$$D$L$T$ ~D$$L$(T$,$Ů$xD$$ . $xe L$u:$A$A11҉$T$X$\$`zÍy$>|y$/|뺍$x|$Ge uHxp1뇍Hx|牌$$$$6DŽ$T$$X$$\o_zÉ$$$${6DŽ$T$$X$$\_zÍS$|$$8D$x6S$L$T$\$ l${L$T$D$$$$($iD$$D$|$$4|D$D$D$D$ 9D$,L$(T$$$sDŽ$T$X$\&^zDŽ$T$X$\^zË$$$D$|$$V|$D$T$D$X$D$\D$`L$hT$d$T$X$\]zÐz]zDŽ$T$X$\T]zDŽ$T$X$\.]z|e D$;Az$ $$ $T$D$$$L$ D$ED$L$T$\$ l$$$$$$1|$$ $DŽ$$($$$$$$ $$L$|$$c|D$`$DL$d$HL$h$LL$lD$pD$tD$x pL$|$$$Ů$xD$$ . $xD$ e u4$H$H11҉$P$T$XÍx$C|y$4|뼍$肓x|$Ge uHxp1뉍Hx|DŽ$P$T$XDŽ$P$T$X'|be $H;A8$f|$<;$ 1I| `ȡ $衒x|$( ,O e $<$$@L$$DT$|$ D$D$Edt$$ |D$0$$ |C$$w|$x111҄(L$|e ;avD$@H@L$D$ |e ;a~D$L$T$@J e zB|$8$D$ L$T$\$l$@M 5e EEH4t$,x @9wj9|$(D$4 $T$\$_|D$@HT$,QT$(Q e u T$4QyD$4&|T$0\$$L$(3$D$L$|$ t${|$D$L$(T$0\$$l$@t$,KD$L<Ë|$8|d 9t D$L<É $D$d D$xD$ t؋L$@A e uAD$L<Ë|$81[|T|kQY[8QY[8k sCrj e uBAt@D$L<Íz|D$L<>Hz g|be ;av D$@D$=|e ;avD$@@(D$ |e ;av)D$HP t T$L$ Ë@H @$L$D$ |e ;av6D$@$D$D$D$ D$zD$ L$D$$L$(c|e D$;A($$$D$$D$k.D$L$ T$\$T$<1111$ ՉƉ؉ˉ$D$d\$Pl$Xt$|T$ty|$DIL$@$L$|$>D$L$  D$PL$@T$4\$X9l$|A99\$8l$p$D$tD$L$|D$pL$4T$8\$dCl$<96$D$D$D$ L$T$D$ L$T$$$$DŽ$DŽ$ĄÍ 3 $l$|l$D$\$ T$ {l$\$D$PL$@T$4=nameD$t$D$@D$D$DD$YAD$L$ T$\$ $\$T$D$ fD$D$lL$L$0$L$T$D$ ݄D$@L$09)L$,!ȋL$lȉD$hL$PYl$X9 t$|\$$K9w9o=<{9TD3O9L$(Z\$`>\>\$`\>\$`\> \$L99l$\t$x1$D$T$|D$(L$,DL$\9T$x\$LÉЉʉ3$\$x\$\$L\$L$ D$6{T$D$L$@붍3$t$L$l$ \$ {t$l$D$hL$(T$,\$L8|$H3$t$|$l$ L$ʚ{t$D$l$HD$hT$,|$H3$t$L$l$ |$茚{t$D$l$xD$hT$,\$$nL$T3$t$\$l$ L$J{t$l$D$hL$TT$,\$$ 3$T$|T$L$l$ \$ {t$D$l$XD$hL$PT$,111MDŽ$DŽ$DŽ$$$ĄBz Az Az Az |e $@;A]@$1Z|DŽ$DŽ$ Ӳ $蛄x|$$ e $L|$$$DL$$HT$$\$ $\$۬D$L$T$T$ $$DL$$HT$`D$ L$T$\$$$T$$ HL$qCz$H$$$D$$D$2D$ $$41|$L|$L|Ƅ$L$tƄ$M$4$L|$d| $dDŽ$h$l$4R|$QYi΍K9VKN e <$d|$$|vt$$V|$ 1 |T$$D$$D$_xD$L$ $$$$$DD$$HD$|$ $|?2$$ j|$$$$ $ B|$$ /|$$$Iz@ÍS$|$$dD$x1S$T$\$l$ L$ݕ{D$L$T$$Se uCމˉ1\{|鋄$$4D$u $H$$|$$]|D$D$D$D$ "D$,L$$T$(e uk$Ku0L$$OD$%@zuGz@Í$5|$$Gz@Ë${ʼn|눐Gz@É$$5s|$$$JGz@É$$58|$$$Gz@ÍӲ$|$$LD$ x葿||e $$;Av \DŽ$DŽ$DŽ$$x|$$e  $h|$$$`L$$dT$$\$ $\$ND$L$T$$ $$`L$$dT$zD$L$ T$\$ $$T$$ AD$=z$$ rt$$ $|$H@$$$D$$D$D$ $ $$D1:|$\.|$\"|Ƅ$\$$]$^$_$`$D$\|$| $DŽ$ $$Dz|$Y$k֋Q ϋI(9KO$ e Nω$|JiBދZ9AB< e $|@lB,$$Hp$$ |T$$D$$D$YxD$L$ $$$$$`L$$dL$|$ $|V5$$$$$tT$$$@,$/DŽ$$$$$Bz\Ë$Z,2$$?$zrRT$t$|$ $D$l$\$ $D$$D$I`D$,L$(T$$$$$BBz\Ë$$D$u $@$$|$$|D$D$D$D$ D$,L$(T$$e u8$S,DŽ$$$Az\Ë${,ʼn|뻋H$L$D$@BD$ u|D$L$$$1`|$tT|Ƅ$t$,@|$$u ʈ$v ݕ$w ʈ$x$y$z${$|$,$t|$$,|$$q|$|$DŽ$ $$:|$H P$X(j9OZX$< e u$|S$|$$D$x$ӍS$L$T$\$ l$Ҍ{D$L$T$$S(e uC ʉe{ |S$|$$D$}x$$]S$\$L$D$ l$L{D$L$T$$Se uCڋ${!|S$L$$D$x1$$S$T$\$L$ l$迋{D$L$T$$S(e uC $߉ˉ1{ |⋔$e|$$|$`$$dD$$D$L$D$P$D$T$D$X$D$\$D$`D$dL$lT$h$$$=z\Ð=z\DŽ$$$=z\DŽ$$$f=z\Í$|$$hD$bx|ce $;A6d$$$D$$D$D$ $$$t$xL$T$ L$ D$$$|T$L$裻{D$ L$$$x$$t$$1|$v|Ƅ$$b| $$$$9t $T$l$"|$$|$$|$$|$ 1|$$ $$ k$DŽ$ ࿡ $sx e |$$5@5|e $y$%|$$DŽ$ DŽ$$÷$sx$T$$HDŽ$$$h$$lD$|$$ |D$`$D$d$D$h$D$l$D$pD$tD$xN$$T$|$$$dÍy$rx$@L$@Ae u$H,$z,|&$Frx$T$ e u$Q$yÉ|0$|$$D$vx0࿡$|$@D$Ux$$$0$$D$8JxD$ L$$$舱|e ;avh|e ;avH|e ;av(|e ;av|e ;av|e ;avȰ|e $;A DŽ$DŽ$DŽ$DŽ$DŽ$ $$$L$$T$$\$ $\$諘D$L$T$B$ $$L$$T$0lD$L$T$ \$$$L$$ BD$A/z$tLHLhT$<I  ,d (d $$ ct$$|T$$D$$D$iLxD$L$ $$$$$D$$D$|$ $}|^$$$$$$$$$$ 5zĬË$$lD$$ $|$$|D$D$D$D$ D$(L$$T$,$u0L$$OD$r-zu#5zĬDŽ$DŽ$DŽ$$$ 4zĬDŽ$DŽ$DŽ$$$ 4zĬÀ11h4zĬDŽ$DŽ$DŽ$$$ ,4zĬDŽ$DŽ$DŽ$$$ 3zĬ蔬|e ;aD$tmHLujt[@4tNH u6 ,d (d uD$ D$D$D$ T$L$Àtŀtt11D$뿀|]e $;ADŽ$$DŽ$(DŽ$,$$$L$$T$$\$ $\$ѓD$L$T$L$$^t$$|$ $$L$$T$7gD$L$T$ \$$$\$$ BD$H*z$T$$D$$D$GxD$L$ $$$$$D$$D$|$ $|Y$$$$$t`$t H(t&DŽ$$$($,(1zĴÉ$$$;$$봋$\$$L$T$$D$ $D$$D$$D$$ D$ ND$$L$(T$,t`$t X(t&DŽ$$$($,d0zĴÉ$$$w$$봉$$DŽ$(DŽ$,0zĴË$$辐D$$$|$$|D$D$D$D$ e D$,L$(T$$$DŽ$$$($,{/zĴÐn/zĴDŽ$$$($,H/zĴDŽ$$$($,"/zĴƧ|e $;A$t1|DŽ$DŽ$ b $Kgx|$$$ e $|$D$$L$$T$$H\$ $Ll$苏D$L$T$$$$Q4f$h$$lD$$pD$YD$ $L$$ T$$] XXCP $d1־|$ʾ|$达|Ƅ$tƄ$$d$q|$L艾| ۺ$LDŽ$P$T$d:|$$Q(Y$i,΍J9<JN( e <$L|$$dY$$ ;|$$H4$P0$$D$$ $|$$D$$$t$d$$Q4tB-$1d|$$L$$ $$L$$L$ D$D$$$|L$H$T$D$$|$t$|$$$+zË$$Z4K-J4 Y iY i$1舼|T$$ $$\$$l$ D$D$ $$|L$H$T$D$ $|$1| p9$,$|$$$,|$ $| p9E$4u5$t$ ?|$$$R*zÉ$sD$$D$$L$$T$$H\$ $L\$+D$L$t<$t$ 访|$$$$)zÉ$$$V$$ |$$H4$P0$$D$$ $ý|$$$G$$ |$81:| p $$L$;xL$ T$T$L$$ $$L$$$L$$L$ l $8${|L$H$T$D$d$8Y|$t$dF|$$$Y(zË$獴$ (|3D$ 1 p$$,.|;S$|$$LD$x1S$\$T$l$ L$t{D$L$T$$$S,e uC$މʉ1v{$跷|鋄$$S$$ ͻ|$4@$H $D$ L$T$$L$D$(D$L$ T$\$l$Y$($,$0$$(D$;xD$ L$ $D$%$$赼|$l1˷| $lDŽ$p $t$||$$Q,Y(i$s9WSQ(|e u$l.|$$ cS$|$$lD$.x1̍S$l$\$T$ t$ s{D$L$T$$$S,e uC$ˉ1$$V{$ߵ|䍼$t5 m|$$%zÍ$t5@||d xd $$N%zË$$Q$H$ 菹|$@`$Q$|1|$|$|Ƅ$tƄ$$|$謺|$ĵ| e-$DŽ$$$|u|$$Q,Y(i$΍K9^KN(| e u&$%|$$ $HS$|$$D$x1ōS$l$\$T$ L$p{D$L$T$$$S,e uC$މˉ1T{$Գ|鋄$$ $1w$$O$$ ɷ|$@K$ $+D$L$T$\$$$0$D$n{D$L$T$ $$1$  ΋$Љډ$ $$$$]}m,$|$\$$$D$L$T$\$l$ $@$D$H$$@L$J7xD$ L$ $D$ $$|$H$98$$,@<-e $з|$A$9$$$L1ò|$L58胷|$蛲| S@$DŽ$ $$LL|$$Q,Y(i$΍K9^KN(| e u&$|$$ $S$|$$D$x1ōS$l$\$T$ L$m{D$L$T$$$S,e uC$މˉ1T{$諰|鉜$4$$8$<${|Ƅ$ @ $$4L$1xL$ T$$$$L$ |1$$0$|$$D$x$$0$$l$D$T$ L$l{\$D$T$H$$$t5`;|$$$NzÉӉ‰$$t5 |$$$zÍ$t5|pd td $$zË$D$yD$u$$$o$`$|$$P蛴|D$D$D$D$ D$$L$(T$,e uy$$C4u0D$$OD$czuzÉ$$t5Ƴ|$$$zË$${4|뀉$$t5`z|$$$zÍ b$|$$D$艰x|Je $;A~$1D|DŽ$0DŽ$4 T $UxL$$$$aIt$ e $-|$ $$L$$T$QD$L$T$\$ tz$t4$5`=|$0$$4PzÉ$$5|$$0$4zÉ$$$H0 $ީD$f$$L$$ PT$z*$D1ɬ|$,$| T $$L$$L$}1xL$ T$$$$ $$L$$L$|$ $,葯|U$$D|$$$$ $$D貰|$ $$@L$V$$胰|$$0$ $4zÐzË$D$$D$$D$ $D$$D$$D$$ND$sz$5|0d 4d $0$4zÍ$pH| T$$D$$pL$ڬx`|[e ;aD$ $;zD$td$tU@tD$@Lu,t 1$Ë$$D$߀111赑|`e ;av D$$ z 膑|e $;A$ND$z$$L$$ PT$z$$跬|T$$D$$D$9.xD$ L$$$$$$D$$D$|$ $M|WzĨÐzĨÐzĨb|e ;av D$$z &|e $;A$ND$wz$$L$$ PT$Hz$$W|T$$D$$D$,xD$ L$$$$$$D$$D$|$ $|螨xzİÐkzİÐ^zİ|e ;av D$$/z Ǝ|e $;A$ND$z$$L$$ PT$ z$$|T$$D$$D$y+xD$ L$$$$$$D$$D$|$ $荩|zİÐ zİÐzİ袍|e ;av D$$z f|e $;A$ND$ z$$L$$ PT$ z$$藨|T$$D$$D$*xD$ L$$$$$$D$$D$|$ $-|>zİÐzİÐzİB|e ;av D$$oz |e $;A$ND$W z$$L$$ PT$( z$$7|T$$D$$D$(xD$ L$$$$$$D$$D$|$ $ͦ|NXzĨÐKzĨÐ>zĨ|e ;av D$$z 覊|e $;A$ND$ z$$L$$ PT$ z$$ץ|T$$D$$D$Y'xD$ L$$$$$$D$$D$|$ $m|^KzÐzÐz肉|e ;abe vuz e y݇e虹贮 0HYVѢ,貎%~Ӥ޽$D$1m|D$L$ xd e  |d $D$55|D$L$ pd e uT td $D$|D$L$ d e u d e Í=d 蛟|=td 茟|룍=|d }|]|~e ;av: D$$L$L$跧D$L$ $D$`wD$D$ 菇|e ;aD$T$9uxJX9ujH Xj r9t;1Ʉt1JRX@9t 1D$É$L$\$wD$ 1݉4$\$l$wL$ D$T$11ֆ|Qe ;avLYuID$t3H X@$\$D$L$ LD$L$D$ L$$tx m|뛍|$9;u#e ;avBD$$L$L$wD$L$ $D$D$xD$ D$|e ;avUD$HT$Z*09t1ɄtJ@9D$14$L$\$HwL$ D$T$脅|e ;av5 Yu2D$tP@ $T$D$ ;x 4|벍|$9;uƉ#e ;avBD$$L$L$wD$L$ $D$D$X xD$ D$DŽ|e ;avUD$HT$Z*09t1ɄtJ@9D$14$L$\$wL$ D$T$T|e ;av5 Yu2D$tP@ $T$D$ x |벍|$9;uƉ#e ;av.Yu+D$ t@ $D$;x 諃|빍|$ 9;u͉#e ;avaD$$L$L$D$ xD$ L$Q$D$D$ xD$ L$ $D$wD$D$|e ;avfD$T$8uMJX9u?HZ9u1JX@ R 9t 1D$É$L$\$[wD$ 111蓂|e ;av+D$$D$D$D$ xD$ D$N|e ;av,D$D$D$$D$wD$ D$|e ;avQ D$$L$L$wD$L$Q$D$wD$L$ $D$ D$D$ 舁|e ;aD$H\$k39tv1ɄtlH Shs 9t=1Ʉt3KP9u%HS8uK@8D$111,$L$t$wL$ D$\$1뢉$L$l${wL$ D$\$j贀|/e ;av)Yu&t$tɝ|Pgx `|뾍|$9;u҉#e ;av),Yu&t$0tG|@,x |뾍|$09;u҉#e ;av),Yu&t$0t|,x |뾍|$09;u҉#e ;av.L$T$ e u D$ BT$ÍzD$ |k|e ;avND$D$D$@L$D$$D$D$$xD$L$ D$ L$$~|e ;av.L$T$ e u D$ BT$ÍzD$ 2|~|e ;av*L$e u D$AL$ ÍyD$|_~|e ;av]D$D$D$D$ HL$@L$D$$D$D$xD$L$ D$$L$(}|e ;av.L$T$ e u D$ BT$ÍzD$ |}|e ;av*L$e u D$AL$ ÍyD$Ɣ|?}|e ;av]D$D$D$D$ HL$@L$D$$D$D$xD$L$ D$$L$(||e ;av/L$T$J e u D$ B T$Íz D$ |j||e ;av/L$T$J e u D$ BT$ÍzD$ 術|||e ;av&|$ e u D$|$ ËD$Z|{|e ;avA;$;xD$L$L$ e u AL$Íy|x{|e ;a(L$,Ytj|$賓|T$ \$$L$%L$,Q Y\$T$QIL$T$  $L$L$xL$ T$T$0L$4(ûz|_e ;av/L$T$J e u D$ B T$Íz D$ |zz|e ;av/L$T$J e u D$ BT$ÍzD$ 豑|*z|e ;a$9xD$L$HL$H e u2L$L$HL$ e u AL$ Íy-|NjD$ |Oω‹D$|y|`e ;av&|$ e u D$|$ ËD$ʐ|Cy|e ;avA;$8xD$L$L$ e u AL$Íyo|x|e ;ahL$lY|$|T$4\$8L$9L$lQ Y\$T$QY\$T$It A QY L$ \$$T$(D$,D$0|$Yaa\;sTu 9$HPtDŽ$DŽ$ĬÉD$L$T$,$l4xD$L$ e u)L$HL$,H $$ĬÍxD$|yD$,赋|ǸX@$3xD$ $9M|$<$:|D$8 e Ǎt$<| 9tL$;sT )$3xD$8H|$We O H PWe ubO e PuEHt e uG$$ĬÍO蛊|Չ莊|밍W׉ʼnz|닍W ׉ʼnd|\ @ $D$L$9t,$T$L$zk|$$$<;i|$$$(i|$ $i|$1-d|$$5P6h|$$L$l$T$p$$$\$wD$ L$ $D$a$$h|`$ xe |$$65g|$x e $ ,h|x( e $h| e xH^$g|L$\QT$t9$\$xS`‰T$L$l$ S$$T$L$L$`L$fx$ xe $\$bStT$HSxe 6$S|T$tST$xSe $S T$|S$S e $SK(e AC,Cpe Abe A,$S$e A,L$lKHL$pKL e $KDL$dKTL$hKX e $CP$$$D$$D$D$ gD$L$t DŽ$$$Ë$$DŽ$DŽ$Í{P$_|k{D$_|1_|_|{$$~_|n_|{,a_|l{$M_|{(C_|:{ $/_|{|$_|{t _| S $D$D$D$ T${\$D$L$\T$t0$|$$D$ax$0$|$$D$vax$?0$|$$ D$Max$`$|$D$%ax$T$|$$$$l^|Ƅ$l @ $$L$swL$ T$$|$$$lc|$$0$$D$wD$ L$$L$P0$$T$D$D$ L$,{T$\$D$TL$|0$|$$TD$_x0$|$$D$_x࿡$|$`D$_xDŽ$$$DŽ$$$DŽ$$$y y D|e $;A x$H( $$L$$L$UD$L$ T$\$l$g $T$P\$T$$$D$$D$YD$ $$Q(T$$D$D$x ‹$TJ|x|‹$ D$@@t$xD$L$L$D$ D$D$ -|e D$;A$H@r $$D$$L$@D$ $Q@r RZIl|$T1E| p9E|$tdJ||$Tt$tWJ| p9u(T$TQ-$H@Q IR$ $ҋD$D$P$ $$HD$@ JD$PT$T$H$\$ Ll$PL$5ɩ4$wD$D$DL$L$H  $qwD$L$  e L$HHD$8 pH e yL$DH `ɩ$"w|$|$4GGe 2D$8 $we L$P|$OL$XO e L$TOL$(OL$0OL$$O POe uLT$+| ֋QRT$SX$[,\$T$l$$p\$l$D$ $\$$\$$\$$\$$\$ $\$$$\$(t$,\$0ߍ$*|D$@$L$D$L$HT$L$L$P$L$X$L$\$L$`Ct$d$8)|$$$$$$8)| @ϲ $fwL$$$ 5)|$$$ $$$$$$$$$ $$$$$($$$,$0$$4 e uX$$ (|$$$D$8D$L$ $$$$dÍ@ϲ$$D$$ L$%xDŽ$$$dËnd ~|d xd DŽ$$$d赆y |e $;A$W$$$$Z,$$\$$\$1D$L$T$ \$l$ t$$|$$$$$$$$$L$D$$$$D$ D$ L$I$H$)ZLt1ɉ$PZRh@ $(5&|$0$4$8$<$-w|$$G$Ge }$$@DŽ$DDŽ$H$$X$$\$X$, ͪ $$L$L$zD$$L$$T$ $1Z$$ꋬ$9$$ $$%w|$e uw ^ O$$9$؍\ e u.| e $uVZ|F߉ƉF|ÍW׉ ^ ,|ύ ^ q$1 |$1n؋Y($Q$$$|$ Y[T$$ $$L$|$$(#|l$hT$l$L$p|$t$k$|$$$$$$$$$|$$$$$#|$ $$ $$l$\$L$ T$$L$zL$ T$\$t|$$ĩ$ wD$$ e u4$H$$$$$ĈÍx$N|DŽ$$$ĈË$|{1DŽ$$$ĈDŽ$$$ĈË nd y *|Ue $;A $W $$ $$'$T$T$zD$$L$ $T$$$$\$\$fzD$$L$$T$ $$$$1={$$$$$$$$930@$M, $t$D$D$L$T$ \$$l$ t$|$$$9$,[$LD ȋ e uL$9$,ډ}|-e u$$|lj|DŽ$$$Ëd d DŽ$$$Ë$$$L$ZD$$ $$D$D$ L$$Q$ wkL[G1QjRY I$$p5 |$x$|$$$$$$$$$$$ $$X$t$D1|$1VY($i$$|$ Y[T$$ $$L$|$$p|T$hl$l$L$p|$t$s|$$$$$$$$$D |$$$$0$D|$8~ f $D$D$YzD$ L$T$$4$87$1$ډ苬$Ή$$$$$kK$[ $X1V|$X$\$$`$dDŽ$hDŽ$l$Q$91$׋e ILύ$X|$A֋$9$@1DŽ$ DŽ$$DŽ$(DŽ$,$$$($,$ $$ D$wD$L$ $$é$荾w|$$G$Ge u3$$$$$$Ë$|ȉ$$$$@$w$T$ HXZe uGJH XhZje uJ $$$z 9|؍zÉ+|묉$$$f$L$$XD$x1$$$f$$l$L$\$ T$zl$D$\$P1$$ӉΉ$@s$0d 9t;$$D$ktD$ L$DŽ$$$É$$$D$ 4d L$/GwD$ u $돍é$?w|$$G$Ge u1$d d $$$Ë$|ʉ1DŽ$$$Ëxd |d DŽ$$$Ë nd Qwy Jwy s{Ne $;Ab$<$$$$Z,$$\$$\$D$L$T$\$ l$$$$$$D$wD$ L$ $D$賀t$$(|$1|$|fDŽ$  $1wD$$  $we |$$5`| e $x$(D| e x(Z$'|$GG e !$$$L$DD$$$$D$D$ L$$Q$kLye1QjRY I$$@5|$D$H$$L$P$$TDŽ$XDŽ$\$l$$t$X$p$1|$1VY(i$$|$ ؋Y[T$$ $$L$|$$@|T$hl$lD$p|$t$o|$$$$$$$<$$|$$$$$|$ $$$$\$l$L$ T$$L$w~L$ T$\$u DŽ$$$ĠÉ$$`é$wD$$H$$$$$ĠÉ1xDŽ$$$Ġ |0$|$$D$x$0$|$$(D$x$C$|$`D$xDŽ$$$ĠË nd {we $;AX$2$$$$Z,$$\$$\$QD$L$T$ \$l$$$$$$D$wwD$ L$ $D$#{t$$(G|$1_ |$S |Ƅ$  $裴wD$$  $芴we |$$5v| e $x$(| e x(R$|$GG e $$$L$D$$$$D$&D$L$ $Q$kLq]1QjRYI $$@5|$D$H$L$$P$$TDŽ$XDŽ$\$l$$t$X$p$1r |$1VY(i$$A|$ II$$ $$L$|$$@>|T$hl$l\$p|$t$|Ƅ$$$$$$$K7$$|$$$$$n|$ $$$$L$l$\$ $L$T$xL$ T$\$u DŽ$$$ĠÉ$$`é$awD$$H$$$$$ĠÉ1DŽ$$$Ġ|0$|$$D$R x$0$|$$(D$) x$K$|$D$ xDŽ$$$ĠË nd V{e $<;AjD$LD$P$P$L$T$ $X$$$\$($$ \$&wD$L$ $L$ut$$$\ |$`$$d$$h$$$D$踋wD$L$ $L$du$D$ |$,1|$,|Ƅ$,  $wD$$  ` $Ȯw|$$e 5@d | e $x$\ | e x(B$D | e xH$, |$ GG e $HQ$lkLq1QjRYI $$5 F |$$$$$$ $DŽ$DŽ$$$l$$HX$$1|$H1VY(i$$ |$H ؋Y[T$$L $$PL$|$$d |$$$$$@ |$$p$$t$$x$D$$ |$$$$$t$ |to0d 9t;$$D$cD$ L$DŽ$|$$DÉ$$D$ 4d L$6wD$ F$$ * $豫w$x$tT$$ B$$|JB $BB$$~*H XZe JJJ$$$$$L$D$T$ $D$$D$-rD$ L$T$u DŽ$|$$DË$$|$$DÍz,|D$Is1l|50$|$$,D$x$0$|$$DD$x$0$|$$\D$wx$[`$|$@D$Ox nd {oe ;a\D$dL$hD$dL$hT$`Z,$\$l\$\$p\$PD$L$ T$\$l$zD$@L$Tl$DD$`H, $L$tL$L$xL$ D$L$T$\$l$ T$L\$Hl$XEMr111ɅD$d$L$hL$`D$D$PL$`$D$D$ L$tDŽ$$$\ËD$`$D$dD$D$hD$D$TD$ D$@D$D$DD$D$XD$D$HD$D$LD$ D$PD$$D$|D$($D$,$D$0D$4L$8T$<$$$\DŽ$$$\Í$苧w|$G3e u!T$L\$Hl$Xp{ډ $D$D$N%wD$ T$L\$Hl$X`$ w|$G.e u!½T$L\$Hl$Xp(½i{DŽ$$$\DŽ$$$\Ë nd {e $ ;A`$h$l$l$h$dZ,$$p\$$t\$D$L$T$\$l$ Z$$$$dH, $$xL$$|L$踳D$L$T$\$ l$$$$jC #111Ʌ$$<$$@$$D$$<L$舁wD$L$ $L$4kt$$,$xQ|$$0$$4$$8$$0D$wD$ L$ $D$j$`$,|$H1{$H{fDŽ$H  $AwD$$( ` $(w|$$$e 65| e $$x$xT| e x($`7| e xH^$H|$(GG e %$h$$lL$7D$$ $d$D$觿D$ L$$dQ$ kL}i1QjRY I$$5\{$$$$$$($DŽ$DŽ$$$ $$dX$$1{$d1VY(i$${$d II$$h $$lL$|$${$$$$$_{Ƅ$$$$$$$:$${$$$$$${$ta0d 9t4 $T$XD$L$ DŽ$$$`É $T$4d D$+wD$ F$$ * $֠w$$T$$  B$$JB $BB$$~*H XZe JJJ$$$$$L$D$T$ $D$$D$RgD$ L$T$u DŽ$$$`Ë$ $$$`ÍzQ{D$$P{1tDŽ$$$`{0$|$$HD$w$$0$|$$`D$w$$?0$|$$xD$uw$$`$|$D$MwDŽ$$$`Í$芞w|$G3e u*$$$ p{щ $D$D$DwD$ $$$$w|$G.e u*½$$$ pe½M{DŽ$$$`DŽ$$$`Ë nd #u{e ;atD$|$$D$|T$xZ,$$\$$\$D$L$T$\$ l$\T$T\$ll$PD$xH, $$L$$L$跪D$L$T$\$l$ T$L\$Hl$d~EM1>D$|$$L$D$D$`L$x$D$葸D$ L$$D$$L$zD$L$ T$1 t$X^Љꋬ$9 \$XL$pT$DD$@$ L$h -$訛we L$h\$Se ACe AuzC L$@Ql$D9)D$p5e {$$D+{ P9$,7{$$,$$$0$4$$ $$8$<$@$,L$ p $`owL$ T$DŽ$$$ĸÉ$$D$LD$L$ DŽ$$$ĸÍ$[{$$@,$  $莔wD$$ `H e uS$H$H$D$LD$ L$$$$$ĸÍx${y${럋rd M͉щÇ1DŽ$$$ĸDŽ$$$ĸË nd u{2e $h;A$ a$$$$$ $0$$4T$$8T$D$ $$Q,$$(T$$,T$QD$L$T$\$ l$$$$$ $$$L$VD$$$$D$ƮD$ L$#$H$ZLt1ɉ$Xk[P H$$5 {$$$$$$$$$$$H$$$$$X$DŽ$$$0N$P X${II$@,D$p$ $$$D$|$${$D$P\$TT$X|$\$g{$D$l$D$tD$xD$|$$$$$$ $D$>HD$ L$$$<$$@$D$HÀ1DŽ$<DŽ$@$D$HDŽ$<DŽ$@$D$HË nd {Re $t;A5 $$$$$L$=D$$$$D$譫D$ L$$H$t ZLu1ɉ$PZRhH $$5{$$$$$  $轎wD$$DŽ$DŽ$$H$$$$$X$  $RwD$$ /DŽ$$$0N$P X${II$@,D$p$$$D$|$${$D$P\$TT$X|$\$1{$D$l$D$tD$xD$|.$$$$$$$L$ED$ L$$$($$,$0$4 É$y$w$ $DD$Q P e u$A}$yL{DŽ$(DŽ$,$0$4 Ë nd {e $d;A$$u$($($$$ Z,$$4\$$8\$D$L$T$ \$l$$$$$$$$(L$vD$$$ $D$D$ L$Q$ H$1ZLt1ɉ$Xk[P H$$5{$$$$$$,$$0$$$$$$$H$$$$$X$0N$P X${@@D$x$$$$(D$|$${$D$\\$`T$d|$h${$<D$|$@$$D$($$$$$tJ,$T$gAD$ L$DŽ$HDŽ$LDŽ$P$T$XÉ$H$L$PDŽ$TDŽ$XÀ1DŽ$HDŽ$LDŽ$P$T$XDŽ$HDŽ$LDŽ$P$T$XË nd {>e $P;A0$8$<$<$8$4Z,$$@\$$D\$1D$L$T$\$l$ I$$$$8$$<L$覹D$$$4$D$D$ L$$4H$ZLt1ɉ$Xk[P H$$5@{$$$$$$$$$$$H$ $$$$X$0N$P X$.{II$h,$$8,$$<l$|$$<{$L$`\$dT$h|$l${$L$|$H$$L$$P$8$$$$$4I,$$wD$$ `H e uS$H$H$D$:=D$ L$$$T$X$\0Íx${y${럋 rd M$L$<D$ L$DŽ$T$X$\0Àh1aDŽ$T$X$\0DŽ$T$X$\0Ë nd 4{e $0;A P$X$\$\$X$TZ,$$`\$$d\$!D$L$T$\$l$ t`$$)$݃wD$$ e u$H$tPÍx$={݉$$$$X$$\L$:D$$$T$D$誟D$ L$r$TH$RZL:t1ɉ$Xk[P H$$5{$$$$$$$$$ $$H$,$$0$$8X$4 @ $$lL$L$KzD$ $L$$T$$1Y苌$$$l9~$$h $÷$΁w$e |$- e PW e PW e P W e PzWHPWe GOHP O e W$ e P$W(H0P,W0e O4 e P4W8 e P8ZWowD$ p e u$H$Íx${ݍ6{뢉,$D$D$v\$ $$$~$$)$nwD$$ e u$H$Íx${݋ nd _{e $;A$$$$$Z,$$\$$\${D$L$T$\$ l$t`$$)$mwD$$ e u$H$Íx${݉$$$$H, $$L$$L${D$L$ T$\$l$;$$$A}111ۅt`$$)$lwD$$ e u$H$Íx${݋$$$L$ D$$$$D$yD$ L$$Q$kL1QjRYI $$d5`{$d$h$l$$p$$t$$x$$|$$$$$$$$$$X$$H1{$1VY($i$$$V{$kmTI,$$ $$L$L$ύ$d={T$l$L$p$L$t|$x${$$$$$$$$萟$$Hw{$$$$,$HO{$E$D$ $1L{$ $QY$$QYI $ $$$( ) $biw$T$$L$ p $lCwD$ L$$ e uB$Íz{)$hw$4$0$,\$KCe u2S $A, e uC$Í{?{{ 3{ʼn $T$E D$ $L$$)$ahwD$$ e u$H$Íx${݉D-1&$$)$gwD$$ e u$H$Íx$F{ݍ$gw|$G3e u*$$$p{щ$D$D$NvD$ $$$L$gw|$G.e u*½$$$p ½W{щ$$)$fwD$$ e u$H$Íx${݋ nd M_{ e ;avc,D$4$D$8D$D$0D$D${|$(Goe u D$4$É{|$ {@D$(H PI$ыD$L$T$(Je uCB u3B J@ $ЋD$L$!ȄD$4$D$4$Íz 获{붋L$T$(J e uD$B D$4$Íz D$[{|$(WO e u D$4$É3{ nd 蛟{Ve ;avJ D$$HPXD$\$T$ $D$(D$D$,D$D$L$D$0L$4 /{e ;avD$H @D$L$ {e ;av9D$H @IT$T$T$ T$$ыD$ L$D$$L$(蠞{e ;aDD$T$D$XD$D$\D$軻D$ L$H`s\h[\$,l$(d@;D$$ _ $]w|$e L$HT$PWe T$LWT$(W\$,_ \$$_|$0h e hG($D$0T$T$@\$\$ Ll$PL$5ɩ4$C]wD$D$D$ L$$$<$@$DÍx${y$ӡ{럋 rd M$L$D$ L$DŽ$<$@$DË$膡{1x $r{x$\{DŽ$<$@$DDŽ$<$@$DË nd {je ;av D$@ D$M{e ;av D$@D${e ;av D$@D${e ;avc,D$4$D$8D$D$0D$D$JH XhZje uJ \$(l$t$ z *{zÉ{뵉$$ļË$$Ϟ{L$<$L$DT$@$$L$HT$L\$P$$$L$TT$X$$ 0 $$L$wL$T$ $$ļÍ|$|8{$$D$ d L$NvD$ u $^td pd $$ļc{e ;a,D$LD$D$ D$$D$(0$L$HL$wD$ L$L$D$ 0$D$4D$_wD$L$ D$$L$(ݺ$D$D$D$D$ D$D$L$L$PD$T,ËD$4L$8D$PL$T,d{e ;avvD$0L$,t^D$L$T$D1C9}I,ًum9u\$,$D$@D$t$vD$ uD$L$T$D\$D$HD$HÃ{ne ;avD$ D$D$D$舃{e ;a`l $9CwD$D$8D$DD$H 0L$DT$H$D$\$D\$D$ D$D$tL$p1\$@ى‹D$tL$@T$(Yiq 9O|$\\$`l$dt$hD$TD$X$L$\L$_wD$ L$L$TD$X$L$8L$T$D$ \$T\$D$D$?D$(@L$t9?D$LD$P0D$LD$P$D$8D$L$LL$D$ D$D$8tQH X@9$)ȉ!ЉD$)ˉ\$l$ zD$L$D$|$lù귺\$4l$%wD$$h$81}{$}{$}{Ƅ$tƄ$$8$K{$c}{ !$DŽ$ $$8{ S $\$D$D$ D$9z|$$L$$T$e $袁{$A$$hk}L$($tm$1|{$|{$|{Ƅ$$$$$$${$/|{ /$DŽ$$${L$(i9s$t$ߋe ύ$芀{$ދ[T$,$$pKL$$${{$0}{{Ƅ$0$ i{{L$$P$1׍$1+$29t$\$L$,{$ $0{$H$ {$$H{$1z{ $DŽ$$${$Q\$,9F$p| e $<{$h΋I  L$#$Oz{$@Cz{$@7z{Ƅ$@L$#tƄ$A$$@~{$`y{ ٺ$`DŽ$d$h$~{J9L$(|e $`j~{L$(T$$l֋$hϋJR$hQ{$$Ty{$Hy{$u9ks;$ $3$D$D$H zD$ L$T$$$D$L$T$ $D$$ L$;ED$ L$T$\$(l$$q$L$D$D$ L$T$\$l$D$|L$PT$X'$vD$$L$| $T$PT$\$X\$- l$ D$`D$D$<$1Q{L$<T$P9'l$|4)$yV{KS$D$XH L$\$T$ l$\$D$Uwe |$|$V{D$XL$PT$|D$XL$P$3$D$D$ zD$ L$L$@獴$U{D$D$D$@D$ yD$$L$(T$,\$0l$4t$8L$t1P{$L$tL$T$\$ $L$ @L$$L$`L$ T$$tLDŽ$DŽ$DŽ$DŽ$DŽ$ $$$(Ë$@$$T$P$T$X$$$ DŽ$$DŽ$(DŽ$DŽ$DŽ$DŽ$DŽ$ $$$(ÍS$D$|D$$L$HQw~*|$h5T{|$\t$h(T{$1"O{$O{$ O{Ƅ$$T$\9t $T$D$ U{$$S{$1N{ $DŽ$$$kS{L$PQ\$X9l$|l$|T$P\$X| e 5S{S$C D$BD$L$ l$T$\$SRwe u!|$|$R{D$XL$PT$|S$D$|D$$L$Ow̍S$|$D$Ow1T$P\$Xl$|BS$l$|l$L$\$ T$d zl$D$\$P1L$PDŽ$DŽ$DŽ$DŽ$DŽ$ $$$(DŽ$DŽ$DŽ$DŽ$$$$ $$$P$$D$/vD$ L$DŽ$DŽ$DŽ$DŽ$DŽ$ $$$(É$t$Ll$TS$t$t$zD$D$DL$ L$xT$T$HS$L$D$T$ $l$l$Ll$l$Tl$PwD$x$D$D$D$H$$$D$/v\$ L$t$$$I$$D$v\$ L$?$ $ d d DŽ$DŽ$DŽ$DŽ$DŽ$ $$$(vjD$Ax x x 2{e ;a`D$dL$hd9>T$ljr9ojrD$d.T$lL$h3$D$D$izD$ L$T$d$D$D$L$ D$hD$L$lL$ew࿡$|$ D$>wt0$|$$D$g>wD$\0$|$$D$A>wD$\$|$D$>w@0$|$$D$=w࿡$|$D$=wOL$ D$d\${L$ ؉\$PT$80$|$$D$;wT$8\$Pč0$l$dl$D$T$ L$y\$D$T$HD$ j0$|$$@D$w;w࿡$|$D$V;wL$4 L$(S$1@9{$X49{Ƅ$X$( 9{L$($Y ʈ$Z 눜$[ ш$\$]$^$_$`$($X|={$$(i={$$V={ ࿡ $v|$|$L e a5={e L$Ly$={D$L$DŽ$DŽ$$$L$ػvD$ L$ $D$脥$t$l<{D$@HT$$9h\$DL$@,@|-e u $t<{L$@؉Ӌ$po\$HT$00$|$$D$W9wT$0\$H뽍0$\$D\$\$4\$T$ L$'y\$D$T$HD$@^0$|$$D$8w࿡$|$D$8w\$$D$D0$|$$0D$8wD$@g0$|$$HD$|8w࿡$|$D$[8wEDŽ$tDŽ$xDŽ$|$$`{e ;ah$15{$î$D$L$HyL$T$\$ \$lT$pL$t$$T$$1 \$(ȉىL$(D$ |$Tb:{|$,t$TU:{|$@1g5{L$0\$,\$@L$DL$8\$4\$HL$LL$$t$H6{獴$6{YD$$pBB D$<$L$(L$T$,T$*>$t$HH6{$D$<$D$(D$D$,D$=$t$H 6{獴$5{MD$L$T$$L$D$D$ 6D$ILt$BzÉ$L$L$L$ L$D${e ;aD$ IL d d t T$0L$4@L$$ $L$(L$L$,L$H{D$ D$D$D$L$HL$@D$D$ $D$D$zD$L$ D$0L$4Àa11d{"e ;a4D$8QL5d d L$0A,FD$8HT$$L$L$< $L$@L$L$0L$D$ D$D$\$T$ FD$8L$,T$(XLu}d t $L$芊D$L$ D$DL$H4@L@*@,@+e u@8@4@0믍x81*{{41*{{01*{덀u d yu d i1b\$DT$H4Àud d ud d 11{ae ;a4D$DD$HD$8QLd -d uS@HLu, d d tT$DL$Hx4@L11u d d 11XuuA*L$0QL`DD$8HT$$L$L$< $L$@L$L$0L$D$ D$D$\$T$ )D$,L$(uSD$8HLu, d d tT$DL$H x4@L11ud d 11lj $D$'D$ L$L$DD$Hx4A+D$$NT$ߏxu萗x4Él$D\$H~x4Àud -d K11B{e ;avD$HP@T$L$ D${e ;av=D$$D$ D$D$$D$D$(D$ sD$L$D$,L$0l{e ;avD$@$D$;{e ;aL$ Q)td d L$ D$ËQ$y$tHD$*9ve u A$11I&{uXR9ve uA$'&{ыe u D$A$11뎋D$&{~{Ie ;avX{e ;av[D$@ 7L$ @e L$L$ $ЋD$L$ 9ut9t D$ ËD$ 1 {e ;a D$0D$4D$$HHPXh t\D$(t:l$\$T$ $D$D$,D$&TD$L$L$0D$4萔x D$0D$4vx ËH 2D$$HT$$L$\$ T$$ NL$rxD$$Hnd $ L$T$wjD$ tWD$(t5L$$I $D$D$,D$lD$L$ L$0D$4œx D$0D$4諓x ËD$$@H@ tL$0D$4舓x Ëd d D$0L$4jx Ð`x Ëd d L$0D$4Bx Ë@d Dd D$0L$4$x ÉT$0L$4x {e ;aD$$D$(D$,D$0D$4D$ HPX ZH`D$ H$\$L$T$ \$$ NL$蠊xD$ Hnd $ L$T$hD$ uqD$ @H@ t*D$$D$(D$,L$0D$4xD$$D$(D$,d d D$0L$4近xËD$ @P@L$$T$(D$,D$0D$4芑xÐ耑xD$$D$(D$,d d L$0D$4JxÉ\$$L$(T$,D$0D$4$xD$$D$(D$,HD$0L$4x {e ;avD$HD$L$ g {e ;av D$@+> {e ;ae vuPx e sny.~RϝzF!_$w]x"賥莗i'褂|评8嬇ɀ \Y$D$Dk{D$ L$ d e d R$D$ j{D$ L$ d e d x$D$j{D$L$ d e S d $D$]j{D$L$ pd e   td \y$D$%j{D$L$ d e  d ս$D$0i{D$L$ xd e u |d ʻ$D$i{D$L$ d e + d f$D$}i{D$L$ d e  d $D$!Ei{D$L$ d e  d L$D$& i{D$L$ d e uT Ăd $D$h{D$L$ d e u d e Í=d s{=Ăd d{룍=d U{]=d C{=d 1{=|d {=d {5=td {=d {=d {Y=d {?{ e ;avD$D$p {e ;avD$D$D$D$ n{e ;avD$D$D$D$ m{e ;avD$D$D$D$ jJ{e ;avD$D$}v{e ;avD$D$D$Zj{e ;avD$D$D$i{e ;avD$D$D$i{e ;avD$D$D$ZiU{e ;avD$D$D$D$ ?h{e ;av@Yu=D$HI@ T$T$T$ T$$ыD$ L$D$$L$({맍|$9;u#e ;avHYuED$HI@ T$ T$T$$T$T$(T$ $ыD$L$D$,L$0A{럍|$9;u#e ;av8Yu5D$H@ IT$T$$ыD$L$ D$L$ {믍|$9;uÉ#e ;av8Yu5D$H@ I$ыD$L$T$ D$L$T$ {믍|$9;uÉ#e ;av@Yu=D$HI @ T$T$T$ T$$ыD$ L$D$$L$({맍|$9;u#e ;avlHYul|$P1T{|$ K{L$LIR $ҍt$|$ {L$L$|$4t$ {|$Pt$4{L$L$dH}{x|$L9;u#e ;av'Yu$D$ @I$ыD$D$"{|$ 9;uԉ#e ;av0 Yu-D$HI$@ T$T$T$T$$у z뷍|$9;uˉ#e ;av/ Yu,D$@I$ыD$L$D$L$ jz븍|$9;ủ#e ;av(Yu%D$ H@ I($ыD$D$z뿍|$ 9;uӉ#e ;avHYuED$HI,@ T$ T$T$$T$T$(T$ $ыD$L$D$,L$0z럍|$9;u#e ;av?YuvD$D$wze ;avVD$T$9u?JX9u1H @Z R9t 1D$É$D$\$;vD$ 11ze ;avLYuID$t3HX@ $L$\$D$ yD$L$D$ L$$~v z뛍|$9;u#e ;av: D$$L$L$D$L$ $D$@vD$D$ /ze ;aD$T$9uxJX9ujH Xj r9t;1Ʉt1JRX@9t 1D$É$L$\$]FvD$ 1݉4$\$l$9vL$ D$T$11vzQe ;av9 Yu6t$$t {pD$L$L$(D$, '}v z뮍|$$9;u‰#e ;av9 Yu6t$$t 9{ {D$L$L$(D$, |v z뮍|$$9;u‰#e ;avLYuID$t3H X@$\$D$L$ D$L$D$ L$$T|v Mz뛍|$9;u#e ;aD$$L$L$D${vD$ L$Q$D$:vD$L$Q $D$D$ EvD$ L$Q$D$n=vD$L$Q $D$W=vD$L$( $D$D$vD$ D$gz2e ;aD$T$9HZjp91Ʉ1ɄJZhp9tV1ɄtLJ$Z h$p 9t1Ʉt@(J(9D$1$L$l$hCvL$ D$T$1‰$L$t$ECvL$ D$T$1뉍H L$J $D$ h6vL$ D$T$C,$t$\$F6vL$ D$T$1(ze ;avBD$$L$L$8vD$L$ $D$D$ XvD$ D$ze ;avwD$HT$Z*09t?1Ʉt5HZ9Z h 9!˄t@J8D$11,$t$\$F5vL$ D$T$2zme ;aD$$L$L$D$kvD$ L$Q$D$7vD$L$Q$D$D$ 5vD$ L$Q$D$^:vD$L$Q$$D$G:vD$L$, $D$D$~vD$ D$Wz2e ;a2D$T$9JX9H Z jp91Ʉ1ɄJ X hr9tV1ɄtLJ(Z$h$p(9t1Ʉt@,J,9D$1$L$t$J@vL$ D$T$1‰4$L$\$'@vL$ D$T$1뉍HL$J $D$ J3vL$ D$T$C,$t$\$(3vL$ D$T$11 ze ;a8YD$Yu;D$ @L$$T$(T$T$,T$ $ЋD$L$ L$0D$4kz멍|$9;u#e ;avFYuCD$$@L$(T$,T$T$0T$T$4T$ $ЋD$L$L$8D$<z롍|$9;u#e ;av6Yu3D$@L$ T$$T$ $ЋD$ L$L$(D$,z뱍|$9;uʼn#e ;av6Yu3D$@L$ $ЋD$L$ T$T$$D$(L$,3z뱍|$9;uʼn#e ;av>Yu;D$ @ L$$T$(T$T$,T$ $ЋD$L$ L$0D$4z멍|$9;u#e ;avkHYuk|$\1z|$ zL$LT$PI$эt$|$ {L$L$|$4t$ {|$\t$4{L$L$pH.zy|$L9;u#e ;av&Yu#D$ @L$ $ЋD$D$z|$ 9;uՉ#e ;av. Yu+D$@$L$T$ T$T$$T$ $Ѓ {z빍|$9;u͉#e ;av. Yu+D$@L$ $ЋD$L$L$ D$$ z빍|$9;u͉#e ;av&Yu#D$@(L$ $ЋD$D$z|$ 9;uՉ#e ;avFYuCD$$@,L$(T$,T$T$0T$T$4T$ $ЋD$L$L$8D$<Sz롍|$9;u#e ;av>Yu;D$@L$T$(T$T$,T$ $ЋD$L$ L$0D$4z멍|$9;u#e ;avYuD$@0L$ $Ѓzɍ|$9;u݉#e ;av+D$$D$D$D$ hvD$ D$>ze ;av,D$D$D$$D$ vD$ D$ze ;avYuD$$(Kz͍|$9;u#e ;av* Yu'D$$ID$L$L$D$ _z뽍|$9;uщ#e ;av* Yu'D$$XHD$L$L$D$ z뽍|$9;uщ#e ;av* Yu'D$$xED$L$L$D$ z뽍|$9;uщ#e ;avYuD$$P}zˍ|$9;u߉#e ;av#Yu D$ $DD$D$&zč|$ 9;u؉#e ;av#Yu D$ $CD$D$zč|$ 9;u؉#e ;av#Yu D$ $CD$D$zč|$ 9;u؉#e ;av#Yu D$ $HCD$D$6zč|$ 9;u؉#e ;av* Yu'D$$BD$L$L$D$ z뽍|$9;uщ#e ;av;1L$#D$ @\$Ӊ$L$L$D$ @|؉L$~ze ;avO1L$ A}3D$ @T$ʉ$\$ ˉL$ڢD$uD$D$ ze ;av81L$ D$ T$‰$L$vL$D$ @|ۉL$ze ;avjD$L$1\$S\$l$؉}:Ћk4ы~69uT$$l$|$%vD$ uD$ D$ zze ;av;1L$#D$ @\$$L$yL$D$ @|؉L$ze ;aD$$L$ 1B}oRltt$<49t u l\9tD$(ÉT$\$4$l$D$D$#vl$ D$$L$ T$\$D$(zSe ;av8`ڥ$od D$D$D$ vD$ HD$L$ ze ;av(D$ D$vze ;aB8"D$ $L$0D$4š$vD$D$, 0 $L$0L$qvD$L$ T$,e JD$HHL$$w9T$(\$ KщL$D$l$ ' $L$DL$D$D$LD$EvD$(D$PD$$D$TD$ D$X8Í'$T$D$D$ L$賬y\$T$D$HL$$Kzz'Tx ze ;avD$ D$ze ;avD$ D$ze ;aB8RD$ $L$0D$4š$EvD$D$, 0 $L$0L$ovD$L$ T$,e JD$HHL$$w9T$(\$ KщL$D$l$ ' $L$DL$D$D$LD$uvD$(D$PD$$D$TD$ D$X8Í'$T$D$D$ L$y\$T$D$HL$$Kzz'Sx Cze ;a 8$K[vD$L$T$\$ D$$\$ъD$L$ D$ L$$D$(D$,D$0D$40$D$ D$,nvD$L$ D$(L$,`&$D$D$&mvD$L$ D$0L$4Ⱥ$D$D$(D$D$ D$x e RÊhz8|~~š$~vD$ `&e |dP 1 $D$D$D$ D$%D$D$@L$L$(š$ ~vD$ `&e =dP 1 $D$D$D$ D$C%D$D$vD$L$ D$L$D$`$D$L$ L$lD$p\D$lD$p\Á\ 09, Z $\$t$|$4zD$L$L$ |$$t$4zL$ t_tID$TD$XL$TD$X$D$D$TD$D$ D$ D$L$L$lD$p\Ë|$`t$$0zD$lD$p\D$DD$HD$DT$H@$D$&D$DD$D$ D$i D$L$L$lD$p\ûT$hT$hD$lD$p\ zWe ;av] t$$Hz D$L$D$L$0$D$D$E\91,΍ ^ ,) ݗÉD$u$1[v|$Ge u5ʻ$t$$芸z p$$ĸÍʻ|z1u$t$$KzDŽ$DŽ$ĸÃ$$-Q-a Q -KQ-5Q-$|$T5 8z$1 D$B\$T,]9\ 9l ΍ ^ ,) ݗtyÄt rG$Yv|$Ge u5ʻ$t$$z p$$ĸÍʻz1뉍$t$$ĶzDŽ$DŽ$ĸÍ$Yv|$Ge u5ʻ$t$$jz p$$ĸÍʻ\zDŽ$DŽ$ `& $D$b0vD$L$ $$$D$$D$D$ D$kD$L$$$t$$贵z$$$ĸÃ&u $J$ HU-($$D$ $L$D$D$ L$ $T$T$\$4$\$D$ wy$$D$D$D$ D$XuD$t$J $B$$DŽ$ $$DŽ$DŽ$$$D$ 0vD$ L$$$$D$$D$D$ D$D$L$$$t$$z$$$ĸYx Rx Kx Dx mze ;avSD$$D$(D$,D$0D$u|$$t$ ~zt@$D$ D$ x ze ;avo@|$1GzL$ $D$$D$$|$ t$Dz$L$L$D$$D$ $yL$T$L$TT$X@jzue ;aLD$|$ 1詭zL$ $T$D$ 薴zL$( $D$$D$$|$ t$PZzM$L$L$D$-D$ -IyL$T$T$`L$dL谔zKe ;aD$ $L$$L$T$(T$\$,\$ D$D$C.D$$lL$ A-T$( PA $D$BD$D$0D$ D$D$ -D$$  L$ A -T$(A$D$BD$D$2D$ D$D$ -D$$L$ A-T$(A$D$BD$D$4D$ D$D$G-D$$vJL$ A-T$(щ $D$\$D$6D$ D$D$,x x x x x x x Βz)e ;av4D$ ttuD$D$D$D$uze ;av D$ D$Lze ;a,D$0vkD$$D$( +L$$ _ ȉD$(#]$D$D$$D$D$ D$D$L$D$4L$8,D$D$ +L$ _ ȉD$ $D$ D$D$D$ D$D$L$D$4L$8,Bze ;a $D$(w0uD$,D$0$ÍD$,D$0$ÀuʺD$,D$0$D$D$ `& $D$;(vD$L$ D$L$ :$D$ D$D$D$ D$D$L$D$,L$0$Í{ D$,D$0 $ÍnD$,D$0$ze ;aLD$PD$TD$XD$\|$<zD$L$L$|$,t$<zD$D$ D$$D$(L$u|$t$,Ѭz|$Pt$ĬzLtI $D$x @z;e ;a(D$,D$0D$4D$8`F$NvD$D$$ d}d `}d $L$D$D$ D${D$L$t#L$ |$,5e zD$t$ t(轥z@D$L$T$T$$D$(L$,/ v (z릍|$ 9;u#e ;av9Yu6t$t MzD$L$L$ D$$ v z뮍|$9;u‰#e ;av9Yu6t$t zD$L$D$ L$$g v `z뮍|$9;u‰#e ;av9Yu6t$t 荤zD$L$L$ D$$ v z뮍|$9;u‰#e ;avI YuFt$$t0-zD$L$T$\$\$(L$,T$0D$4 v 萆z랍|$$9;u#e ;av2Yu/t$t轣zD$D$>v 7z뵍|$9;uɉ#e ;av2Yu/t$t]zD$D$v ׅz뵍|$9;uɉ#e ;av8 Yu5D$t$aD$L$L$D$ xv qz믍|$9;uÉ#e ;av8 Yu5D$t$D$L$L$D$ v z믍|$9;uÉ#e ;a$3$D$D$WyD$L$T$ $3$L$L$WyT$ D$L$T$ L$D$$L$D$D$ wD$L$9}|L$ L$(D$,D$D$0$x Bz=e ;av9e vuZx e ~z$蒩}~e ze ;a_$D$0Mtrt3t$ËD$L@L$,T$(T$L$L$4L$ L$P $ҋD$L@L$,T$(T$L$L$4T$8 ʈT$ L$P $똋D$L@0L$,T$(T$L$L$@T$ D$,xtJtD$HD$L ËD$4L$0;T$H  _ ȉD$L Í0$D$8D$!vD$ L$L$HD$L ÃtYu*D$0 & $D$ vD$ L$L$HD$L ËD$0 3 $D$vD$ L$L$HD$L ËD$0 `& $D$vD$ L$L$HD$L Ãtmu2D$4L$0`3$L$D$vD$L$ L$HD$L ËD$0D$D$`B$D$>vD$ L$L$HD$L ËD$4L$0 '$L$D$lvD$L$ L$HD$L Ãt9Hv FD$HD$L ËD$@L$DD$HL$L ËD$4L$0L$D$D$B$D$vD$L$ L$HD$L }ze ;aLt$PҚzwD$(D$0L$$L$,|$41z0$L$PL$vD$L$ D$4L$80D$<D$@D$,D$DD$0D$HD$4$D$D$D$L$ L$tD$xL|z8e ;av*e vuw e <e |ze ;avpD$$L$L$guD$L$Q$D$D$ vD$ L$Q$D$1uD$L$ $D$ uD$D$|zte ;aD$HT$(r91ɄHZ9H Xj 9j9!˄tjHXjr9t;1Ʉt1J RX @9t 1D$É$L$\$uD$ 1݉4$\$l$NuL$ D$T$111뜉$l$t$#uL$ D$T$6 {ze ;av9,Yu6t$0t zD$(L$$L$4D$8,u zz뮍|$09;u‰#e ;av9,Yu6t$0t 諗zD$4D$$D$8D$(,Wu Pzz뮍|$09;u‰#e ;av9,Yu6t$0t KzPD$(L$$L$4D$8,u yz뮍|$09;u‰#e ;av9,Yu6t$0t zD$(L$$L$4D$8,u yz뮍|$09;u‰#e ;avS c c @T$$T$T$(T$T$,T$ T$0T$T$4T$ $ЋD$L$L$8D$< yze ;avV D$,t@L$$ $L$(L$ `.L$ @e L$ D$D$0D$|dD$L$D$4L$8 xze ;avvD$@ `.L$ @e L$L$ $ЋD$ L$@ߴ$D$L$ivD$L$ T$t L$$T$(D$$D$(xzne ;avw4c c T$8$T$0v|$|$ e u&t$lyzD$D$`D$dD$h"q$|$D$lD$|vB}|$8Xz11T$,l$0ˉdoze ;a L$(t@T$0Zj2ȍM9:MJLmT$$De |u D$,D ËD$,z@b$t$l$\$ L$CyD$L$T$|$0We u͉ƋD$(z菆zoz3e ;aD$(H tR@ D$$D$D$D$D$ wvD$L$  e u L$$HÍxD$$ zE9ve $u D$(H 듋T$(z zXnzSe ;av7D$0@D$t(D$$D$D$D$ L$L$ D$$u ez릍|$9;u#e ;av1Yu.D$ t$L$D$L$Ou Hez붍|$ 9;uʉ#e ;avYuD$tju dzˍ|$9;u܉#e ;av-,Yu*D$0tt$4Ӂz,,u dz뺍|$09;uΉ#e ;av-$Yu*D$(tt$,臁z$Cu D$t(D$$D$D$D$ D$D$$D$ ou hcz릍|$9;u#e ;av9 Yu6D$t D$$D$D$D$D$0 u cz뮍|$9;u‰#e ;av9 Yu6D$t D$$D$D$D$D$ u bz뮍|$9;u‰#e ;avQYuND$t8D$ $D$$D$D$(D$D$,D$ D$L$D$0L$4/u (bz떍|$9;u#e ;avAYu>D$t(D$$D$D$xD$ L$L$ D$$u az릍|$9;u#e ;avQYuND$t8D$ $D$$D$D$(D$D$,D$ HD$L$D$0L$4?u 8az떍|$9;u#e ;av1Yu.D$ t$L$D$L$u `z붍|$ 9;uʉ#e ;av)Yu&D$tD$ $u `z뾍|$9;u҉#e ;avBD$$L$L$uD$L$ $D$D$uD$ D$`ze ;avWD$HT$Z*09t1ɄtJ@8D$14$L$\$fuL$ D$T$_ze ;av;1L$#D$ \$$L$L$D$ @|؉L$N_ze ;avO1L$ A}3D$ T$$\$ L$D$uD$D$^ze ;av;1L$#D$ \$$L$L$D$ @|؉L$~^ze ;avO1L$ A}3D$ T$$\$ L$D$uD$D$ ^ze ;ave(D$Zzie ;a$D$,1ɄtLL$( $D$D$0D$D$4D$ t D$L$ T$\$l$l$8\$vD$@$ыTc D$L$\$$$\$(\$D$L$ ЋD$L$D$,D$0D$4L$8ËL$(F]4ze ;aJ< 9$D$DD$D$ yD$ D$0L$L$$T$T$(1 XT$(l$D9\$,D$@ Q)q IL$t$ ,$T$D$L$T$\$l$ um\$,l$$9T$84[l$0D؋e TT$4TuLL$8L]|$4ƉJz׋D$8Jz:D$LD$PD$T\$Xl$\<ÉD$LL$PT$TD$XD$\<®w 2ze ;aoLD$DD$HD$T 0 $D$D$yD$D$ L$L$T$ T$(\$Tl$P1)D$DD$Hr|$TD$PD$ ىl$P9t$$vLTD $T$D$D$ L$D$DD$HD$DL$H$D$L$DL$D$ D$D$L$T$$\$9Ql$(t e |u!Iz$L$D$ĝD$ D$,D$L$D$4L$8D$<D$@0$D$4D$uD$L$ D$5z$ue |$|$uD$L$Q$D$@>uD$L$ $D$D$豅uD$ D$ ye ;aD$HT$Z*09tc1ɄtYH Z jp9t*1Ʉt H@Z9R9!ȈD$1,$t$\$:uL$ D$T$1뵉,$t$\$n:uL$ D$T$ZyEe ;av9 Yu6t$$t yzpD$L$L$(D$, ~u y뮍|$$9;u‰#e ;av9 Yu6t$$t zD$L$D$(L$, }u y뮍|$$9;u‰#e ;av>Yu;D$t%@ $D$苠D$L$ D$L$B}u ;y멍|$9;u#e ;av: D$$L$L$;uD$L$ $D$?uD$D$ ye ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$DuD$ 1݉4$T$l$J8uL$ D$\$6yqe ;av4e vuZyw e Ge ye ;ave$D$D$D$  $聹ue |$uD$ D$GGD$G |$ËD$ zdye ;a\ $uD$D$0D$<D$@D$DD$H `& $T$hT$諐uD$L$ D$D$tՋD$@D$D$D$D$y6e ;avYD$$L$L$WD$t D$ ËD$@T$)‰T$ $L$D$ ND$ 0ye ;av. D$T$+PT$ $"MD$D$ ye ;av,D$T$+PT$ $L$D$ Mye ;avQD$D$ Vye ;a,D$D$ D$$D$(D$0D$ 0 $菌uD$ L$L$D$ D$0D$0$fuD$L$ D$$L$(ͺ$D$D$D$D$ D$ZD$L$L$4D$8,y*e ;av~D$D$ Fye ;a,D$D$ D$$D$(D$0D$ 0 $uD$ L$L$D$ D$0D$0$VuD$L$ D$$L$(>»$D$D$D$D$ D$YD$L$L$4D$8,oy*e ;a0D$8L$4T$D\$@111D$@L$4T$D\$@l$t$|$,D$D$8L$9}ZˋPT$D$(n<$ՋD$L$T$9u$D$(D$/uD$ tD$D$LD$,D$PD$T0EL$49}'l$4~|$,6t$D$ 1D$D$ nt$L|$PD$T0_ye ;avKD$D$ D$P D$D$D$ L$L$$D$D$:{ye ;av}D$HD $*uD$u0D$$D$D$D$ D$D$L$ L$$D$(ËD$$D$D$D$ D$D$ L$D$$L$(Lyge ;a,$uD$D$  $uD$D$$D$( L$$D$(D$0$D$D$ D$D$$D$ D$D$+D$L$L$4D$8,yMe D$;A|$dz$$$L$$T$MD$L$ Q$@$ $D$$D$TI8L$`DŽ$DŽ$$1.zD$0D$4fDŽ$$L$T$fDŽ$L$`$$$L$0L$$ $D$oxL$ T${$$D$$L$P$$1Et$$94~6t@D$|$D$|OD$@D$D$@t$ tvt$t|$xt$tD$8D$D$8t$H|$L|$t$9pl$,<$D$D$HD$ 8uD$ uL$P$$l$,4L$ tId s d e KD$Ld L$lD$pL$l"QӃ uʀ $D$T$?D$L$T$ \$$t[T$\D$(L$X-d d -e l$P-d \$dl$h\$dt_s u΀$l$t$>D$\$D$XD$D$(D$bDŽ$DŽ$ļ111믍=d ŋD$P\zl$Pml$Pd111111=d D$L&zD$L11111t$111D$1c $$ļË|c $$ļËD$Tt $$ļË|c $$ļDŽ$DŽ$ļÉ$$ļ y+e ;aD$ 9ut%$KuD$H@T$f L$J e u4L$ J @4$DD$T$TD$L$ L$$D$(Íz D$ z|c L$$D$(yCe $;AA %$$D$$L$YuD$L$T$ $$$1zJ$$эt$$zL$t$T$x$\$p$$$z$i$4$Ջ$Q4\$f\$~RtB$ % $訨u$H@T$$f  $$L$$L$uD$L$ $J e PB $H4 $ DL$T$SD$L$  $ u$H@T$f L$~fJ$JJ z e $dzH4 $ DL$T$RD$L$ =$$$1$$>$$9999$$$u$H@T$f $$)ىJ$)ىJ =e !ˋ$˅uAZH4 $ pDL$T$QD$L$ $$$ĀÍz#y$믉$$$ĀÉ$$ĀÉ$`$|$$D$v$$N$$ĀÍz y$%%$ԥu$H@T$f $J e u0$J @4$DD$T$kPD$L$ z $ yTbw }ye D$;A$'H5겊u9$_ `9$ 5 @9$z$$$P$$z7{$Hh$@d$17$$L$$=u$P$$9|ŋ$$q7{É$$$$@8$$D$=uŹ$$H $ $:){1$茣uD$$ $T$D$$$<,{$H$P$$=9=7$$uD$$$H e u8$H$H @ $Q4$L$D$`x$=y=8u l=9u [1T="=u <=uڻ+=u =u M5N$$H$ $4{$H\$PX$1>$$ D$ $p;u$X$$$9|$$4{`$puD$$ $ $ L$D$=?y `rb9J$ @9$$$H$ $3{$Ht$Pp$1>$$ D$ $::u$X$$$9|$$3{$@<$IT$L$$bu3$$$ L$T$x$@<$IT$L$$w/ouy@9$ub$yJt"@|J$T$L$D$ 8O@|J$T$L$D$ 7-/( 9uo$$Qt"@|Q $L$T$D$ @8@|Q $L$T$D$ .7둺y>e ;a_$L$,6QuD9D$0uMpD9uCL$(e u \ND$4D$8$Í\Nyف.D9L$(e u \ND$4D$8$Í\N(yىD$ HP  %$L$T$F|uD$L$T$ L$T$3$D$D$;xD$L$T$ \$(e ufL$ e u*D$XND$4D$8$ÍD$RyXNAyʍ2y둋D$ H @D$L$D$($"D$( e u \ND$4D$8$Í\Nyٸ0$D$fw &ye D$;A$YQuED9u;$$L$$D$D$L$ $$ÁuYpD9uO$e u)\NDŽ$DŽ$Í\NyЁ.D9$$e PPX Å!ӄuFe u)TNDŽ$DŽ$ÍTN"yЋRp|$|y$L$pl$tD$x|$t$|y$ҋ$T$L$  $wuD$ L$D$L$$$e u0\N$DŽ$DŽ$Ë$\N4yɍ'yy0$D$0dw yyTe D$;A$pQuED9u;$$L$$D$nD$L$ $ $ÁpD9$$X,$@99$$  $D$\$y$$$e ~$j 9׋R9!9 ʄuF e u)TNDŽ$ DŽ$ÍTNyuxD$<+y?x D$DyxD$4yD$TL$X,iyde ;a_,D$L$KDD$L$4 $uD$L$8H e L$4HL$HH e L$DH D$ L$@H e L$UD$\D$ D$`D$,D$d<ËD$0D$\D$`D$d<ÍxD$XZyx ‹D$LGyЋT$LxD$D.yRND$ $ D$\D$`L$d<}ye ;ag,D$H$[>D$L$<`$ uD$L$8H e L$4HL$@H e L$D$L$L$LD$P,ÍxD$Hyux D$< y#xD$4yD$LL$P,^yye ;a,$$ |uD$L$8H e L$4HD$ L$u$D$` ) $D$T$D$ 2uD$ 0e upЦP)$L$`L$"T$D$ uD$ 0 e u ئHD$`$xئnyxЦ^y1rye ;a,$y2u|$|$ D$@L$DO e @$H2uD$D$$D$( L$$D$(D$0$ L$L$ L$L$$L$ D$D$D$uBL$DD$@T$0Jl e uBh$TD$L$D$lL$p,ÍzhHyڋc L$lD$p,)y.qye ;a$D$(H P$T$L$uD$L$T$ uPD$(HpL$$Owe L$uD$(H4D$,D$0$ËT$(z4xy܍|$JL$ 5>y$D$ py;e ;av?d d v%I$L$*D$L$ D$L$Av jpye ;aDe $D$D$艞tD$ L$$L$D$ mfzD$$$D$D$uxD$L$LD=~E k$T$D$L$ D$ vxD$L$ D$PL$TDÉȋL$Hoy%e $<;AD$PD$$ HVL$v$HD$$ WL$vD$T111ҋ$Lt$,l$LD$H\$($HQ D$Xu$越y|$\1yD$0D$4D$8fD$dT$\fD$|L$HL$tT$XT$xfDŽ$$P$$$\$0\$\$\$D$owL$ T$D$XtvL$,Q\$(9(l$L|֋e u DD$HXyD$D`$l$Ll$L$\$ T$ Bxl$D$\$PD$DL$,띋\$(t$,l$L1L$(YT$L,T$,rˋD$HbvDÉlj؉D$$L$PT$ \$<$L,$t$Tt$tD$D$TD$TL$ Q\$$9(l$P|֋e u DD$T$$D$$dL$;~u'cye ;avqD$L$ tD@$$T$\$$T$ $ЋD$L$$$Ëd d $$(cyse ;avqD$L$ tD@$$T$\$$T$ $ЋD$L$$$Ëd d $$byse ;av}D$ L$tPI$$T$\$$T$ $T$ $ыD$L$$$Ëd d $$ayge ;a4`*$!uD$D$0L$8Q$T$D$D$ D$踾zD$L$kD$0PX Xhp  h ݀et(c D$<D$@ L$DD$H4ËD$8$fT$l$D$L$T$\$ T$,\$(D$8H$L$D$0D$D$ D$ԽzD$L$uPT$0t(c D$<D$@ L$DD$H4ËT$(T$}D$L$ L$T VFADFt7c DŽ$DŽ$ $$ĤË$$$D$ D$L$ T$)$$$$ĤË$$$D$D$D$4L$L$,T$ \$-,$\$T$otD$ L$$$D$,$D$4$ĤË$$$D$ D$L$T$ \$\$,l$l$4L$pT$tD$x@ӟ$D$pD$tD$ L$$$D$,$D$4$ĤÀSiISX$$$D$D$L$L$4T$T$,\$ D$\\$`0$D$\D$tD$L$ $$D$,$D$4$ĤÍ&$uD$D$8$ $$L$ L$ @e L$ L$D$zD$L$t+DŽ$DŽ$$$ĤËD$8 & $D$tD$L$ $$DŽ$DŽ$ĤÀTtD$L$T$ \$l$(UDe u,]@u L$0D$XD$\L$`D$dHÍ}@‰U\yNjD$LH$L$D$L$T$ \$l$(U<e u,]8u L$0D$XD$\L$`D$dHÍ}8‰[yNjD$LH$L$ZD$L$T$ \$l$(U4e u,]0u L$0D$XD$\L$`D$dHÍ}0‰q[yNjD$LH$L$D$ L$T$\$l$(E,e u,M(u L$0D$XD$\\$`T$dHÍ}([yˋD$LH$L$ L$ @e L$ L$L$(Q%T$gD$L$u L$0D$XD$\L$`D$dHËD$LH$L$ L$@e T$ \$l$(u$t$fD$L$u L$0wD$XD$\L$`D$dHËD$LH$L$]D$L$ D$($L$,L$D$ e T$ \$L$$AD$($L$,L$}D$L$ T$\$l$$M e uqEu^D$($D$,D$AD$L$ T$\$l$$M e uEt T$0\$4 ÉT$0\$4 Í} PyډT$0\$4 Í}Oy눉T$0\$4 ËL$$yOy+D$0L$4 ÉL$0D$4 78y"e ;avfD$ fD$ 8ye ;avD$7ye ;aD$L$L$ $T$$T$D$ L$D$HPT$L$ L$ $T$$T$D$L$D$HP T$L$ L$ $T$$T$D$L$uJD$H@D$L$ D$ $D$$D$D$L$t D$(L$,ÉD$(L$,ÉD$(L$,ÉD$(L$,ÉD$(L$,6ye ;ajD$ $L$$L$3|$D$L$T$ e )D$ $L$$L$UD$L$T$ \$l$Ue ]D$ $L$$L$qD$L$ T$\$l$M e uqE u^D$ $D$$D$D$L$ T$\$l$M e uEt T$(\$,ÉT$(\$,Í}LyډT$(\$,Í} Ly눉L$(D$,Í}‰Ly)T$(L$,Ly+5yve ;avfD$ fD$ 4ye ;avD$4ye ;avLD$@L$D$ D$ $D$$D$&D$L$t D$(L$,ÉD$(L$,m4ye ;av]D$ $D$$D$D$L$ T$\$|$O e ut T$(\$,ÉT$(\$,sKy3ye ;avfD$ fD$ 3ye ;avD$3ye ;avLD$@L$D$ D$ $D$$D$D$L$t D$(L$,ÉD$(L$,-3ye ;av]D$ $D$$D$gD$L$ T$\$|$O e ut T$(\$,ÉT$(\$,3Jy2ye ;avfD$ fD$ z2ye ;avD$S2ye ;aQ D$$fL$ 2 $]tD$ L$L$D$D$($L$,L$T$@e \$ fD$L$D$$HL$ 3 $ltD$L$ D$L$D$($L$,L$T$@e \$ TfD$L$uwD$$@fD$2$tD$L$ D$L$D$($D$,D$D$@e D$ eD$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉD$0L$4 0ye ;a D$$L$( $T$,T$\$-@e l$ 5t$D$KTD$L$D$($L$,L$T$@e \$ -@l$l$$ut$SD$L$uaD$($D$,D$D$@e D$ D$D$$D$SD$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉL$0D$4 /ye ;avfD$ fD$ j/ye ;avD$C/ye ;aQ D$$fL$ 2 $MtD$ L$L$D$D$($L$,L$T$@e \$ cD$L$D$$HL$ 3 $\tD$L$ D$L$D$($L$,L$T$@e \$ DcD$L$uwD$$@fD$2$tD$L$ D$L$D$($D$,D$D$@e D$ bD$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉD$0L$4 -ye ;a D$$L$( $T$,T$\$-@e l$ 5t$D$;QD$L$D$($L$,L$T$@e \$ -@l$l$$ut$PD$L$uaD$($D$,D$D$@e D$ D$D$$D$PD$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉL$0D$4 ,ye ;avfD$ fD$ (Z,ye ;avD$3,ye ;a D$$HT$L$ L$( $T$,T$rD$L$D$$H PT$L$ L$( $T$,T$<D$L$ujD$$@L$( $L$,L$ L$ @e L$ 3L$ _ ȉD$:`D$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉL$0D$4 )+ye ;aC$3$tD$D$ L$, $T$0T$D$L$T$ \$|$(We D$,$L$0L$D$L$ T$\$l$(M e EurD$,$D$0D$D$@e D$ D$D$ D$ND$L$t D$4L$8$ËT$ ‹\$(SD$4L$8$ÉT$4\$8$Í}hAyqL$4D$8$ɉNAy)ye ;avfD$ fD$ ))ye ;avD$c)ye ;avLD$@L$D$ D$ $D$$D$D$L$t D$(L$,ÉD$(L$,(ye ;av]D$ $D$$D$D$L$ T$\$|$O e ut T$(\$,ÉT$(\$,@y|(ye ;avfD$ fD$ 2J(ye ;avD$#(ye ;a D$$fL$ 2 $-tD$ L$L$D$D$($L$,L$T$@e \$ \D$L$$D$$HPT$L$ L$( $T$,T$D$L$D$$H fL$ 2 $蔾tD$L$ D$L$D$($L$,L$T$@e \$ [D$L$uwD$$@fD$2$5tD$L$ D$L$D$($D$,D$D$@e D$ [D$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉD$0L$4 ÉL$0D$4 p&yKe ;aj D$$L$( $T$,T$\$-@e l$ 5t$D$ID$L$D$($L$,L$D$L$ T$\$l$$M e ED$($L$,L$T$@e \$ 5t$} |$NID$L$uaD$($D$,D$D$@e D$ D$D$$D$ID$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉT$0\$4 Í}qe ;a$3$ytD$D$ L$, $T$0T$qD$ L$T$\$|$(Ge oD$,$L$0L$T$@e \$ -l$ol$D$L$D$,$L$0L$T$@e T$ T$T$ T$D$L$D$ L$(AD$,$T$0T$pD$L$ T$\$l$(M e uqEu^D$,$D$0D$gpD$L$ T$\$l$(M e uEt T$4\$8$ÉT$4\$8$Í}xډT$4\$8$Í}yx눉D$4L$8$ÉL$4D$8$É\$4T$8$ÉLxqxe ;avfD$<fD$ Fxe ;avD$cxe ;a D$$fL$ 2 $metD$ L$L$D$D$($L$,L$T$@e \$ D$L$D$$HPT$L$ L$( $T$,T$?fD$L$ujD$$@ L$( $L$,L$ L$ @e L$ 3L$ _ ȉD$=D$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉL$0D$4 ,xe ;a<$3$ٌtD$(L$L$ T$,$\$0\$-l$5@e t$ =|$D$D$L$D$,$L$0L$mD$L$ T$\$l$(M e EurD$,$D$0D$D$@e D$ D$D$ D$D$L$t D$4L$8$ËT$ ‹\$(S D$4L$8$ÉT$4\$8$Í}_xqL$4D$8$xe ;avfD$<fD$ Gxe ;avD$sxe ;av@|$1xL$q |$xL$L$t\$xT$|xe ;a L$e y uVt$]x$T$$ e u$ Í$x`$|$D$D$tmxXe ;a D$$HT$L$ `3 $8btD$L$ L$D$D$($L$,L$T$@e \$ D$L$WD$$HT$($\$,\$-l$5@e t$ =3|$=_ L$jD$L$D$$HP T$L$ L$( $T$,T$aD$L$D$$HPT$L$ L$( $T$,T$aD$L$uuD$$@D$ 3$`tD$L$ D$L$D$($D$,D$D$@e D$ D$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 ÉD$0L$4 ÉD$0L$4 ÉD$0L$4 xxe ;a$3$)tD$(L$L$ T$,$\$0\$-l$5@e t$ =|$D$D$L$vD$,$L$0L$T$@e \$ -l$l$ l$D$L$ D$ L$(AD$,$T$0T$hD$L$ T$\$l$(M e E D$,$L$0L$OhD$L$ T$\$l$(M e upEu]D$,$D$0D$D$@e D$ @D$ED$D$L$t D$4L$8$ÉD$4L$8$ÉT$4\$8$Í}&x뉉T$4\$8$Í} x0D$4L$8$ÉL$4D$8$nxe ;avfD$<fD$ H:xe ;avD$xe ;avLD$@L$D$ D$ $D$$D$V^D$L$t D$(L$,ÉD$(L$,xe ;av]D$ $D$$D$fD$L$ T$\$|$O e ut T$(\$,ÉT$(\$,x,xe ;avfD$<fD$ Pxe ;avD$xe ;a D$$HT$L$ `3 $\tD$ L$D$L$D$($L$,L$T$@e \$ 0D$L$ujD$$@L$( $L$,L$ L$ @e L$ 3L$ _ ȉD$D$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 xe ;a$3$艃tD$(L$L$ T$,$\$0\$-l$5@e t$ =|$D$5D$L$urD$,$D$0D$D$@e D$ D$D$ D$D$L$t D$4L$8$ËT$ ‹\$(SD$4L$8$ÉD$4L$8$xe ;avfD$<fD$ Zxe ;avD$xe ;a D$$HT$L$ `3 $XZtD$ L$D$L$D$($L$,L$T$@e \$ D$L$ujD$$@L$( $L$,L$ L$ @e L$ 3L$ _ ȉD$D$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 xe ;a$3$9tD$(L$L$ T$,$\$0\$-l$5@e t$ =|$D$D$L$urD$,$D$0D$D$@e D$ D$D$ D$D$L$t D$4L$8$ËT$ ‹\$(SD$4L$8$ÉD$4L$8$xe ;avfD$<fD$ dZxe ;avD$3xe ;avl D$$L$( $L$,L$ L$ @e L$ 3L$ _ ȉD$D$L$t D$0L$4 ÉD$0L$4 譿xxe ;a$3$YtD$D$ L$, $L$0L$ L$ @e L$ L$D$ D$L$t D$4L$8$ËT$ ‹\$(D$4L$8$xZe ;avfD$<fD$ nʾxe ;avD$裾xe ;avl D$$L$( $L$,L$ L$ @e L$ 3L$ _ ȉD$D$L$t D$0L$4 ÉD$0L$4 xxe ;a$3$}tD$D$ L$, $L$0L$ L$ @e L$ L$D${D$L$t D$4L$8$ËT$ ‹\$(D$4L$8$oxZe ;avfD$<fD$ o:xe ;avD$xe ;avD$D$xe ;avD$D$踼xe ;avfD$<fD$ x芼xe ;avD$cxe ;a D$$HT$L$ `3 $8TtD$L$ L$D$D$($L$,L$T$@e \$ D$L$uxD$$H@ tD$($D$,D$D$@e D$ 3D$ _ ȉD$`D$L$t D$0L$4 ÉD$0L$4 ÉD$0L$4 [xe ;a$3$ {tD$(L$L$ T$,$\$0\$-l$5@e t$ =|$D$ހD$L$u~D$,$D$0D$D$@e D$ D$D$ D$oހD$L$t D$4L$8$ËT$ Ël$(]ˆU D$4L$8$ÉL$4D$8$Jxe ;avfD$ZfD$ xe ;avD$xe ;avD$D$ȹxe ;avD$D$蘹xe ;avfD$ZfD$ jxe ;avD$Cxe ;avD$D$xe ;avD$D$xe ;avfD$ZfD$ 躸xe ;avD$蓸xe ;avD$D$hxe ;avD$D$8xe ;avfD$ZfD$  xe ;avD$xe ;avD$D$踷xe ;avD$D$舷xe ;avfD$ZfD$ Zxe ;avD$3xe ;avD$D$xe ;avD$D$ضxe ;avfD$ZfD$ 誶xe ;avD$胶xe ;avD$D$Xxe ;avD$D$(xe ;avfD$UfD$ xe ;avD$ӵxe ;avl D$$L$( $L$,L$ L$ @e L$ 3L$ _ ȉD$FD$L$t D$0L$4 ÉD$0L$4 Mxxe ;a$3$ttD$D$ L$, $L$0L$ L$ @e L$ L$D$؀D$L$t D$4L$8$ËT$ ‹\$(D$4L$8$蟴xZe ;avfD$UfD$ jxe ;avD$Cxe ;avD$D$xe ;avD$D$xe $0;A-P%$stD$D$ $Xf$TQ$T$T$@e \$ -l$pt$/׀D$L$c,$TH$L$ L$ @e L$ L$L$ QT$րD$L$+D$ H $Pf(Kf PfGf*f f fDŽ$@DŽ$DDŽ$HDŽ$LHfL$ 2 $ItD$L$ $@$DD$ @fD$2$nItD$L$ $H$LϽ$D$0$@D$D$ D$D$L$DŽ$`DŽ$d$h$lPÍ$qtD$$$TQ L$T$$}D$L$ ug T$ J e u;$B D$`$dDŽ$hDŽ$lPË$$xDŽ$`DŽ$d$h$lPÍ#$ptD$$$TQ L$T$$yD$L$ u> `T$ J e u$B ($$xDŽ$`DŽ$d$h$lPÍ$ ptD$D$`$TQ L$T$$uD$L$ u8 @T$ J e u D$`B $D$`FxoDŽ$`DŽ$d$h$lPf_ff$JotD$$$TQ L$T$$胁D$L$ u> T$ J e u$B $$~xDŽ$`DŽ$d$h$lPÍ $ntD$D$($TQ L$T$$}D$L$ u8 T$ J e u D$(B $D$(xDŽ$`DŽ$d$h$lPÍ$mtD$$$TQ L$T$$zD$L$ u> T$ J e u$B t$$3x\DŽ$`DŽ$d$h$lPf2f(hf)f2 #$-mtD$$$TIT$L$$ƆD$ L$u> T$ J e u$B $$axDŽ$`DŽ$d$h$lPÍ@$ltD$$$TIT$L$$范D$ L$u> T$ J e u$B $$xDŽ$`DŽ$d$h$lPÍ$ktD$$$TIT$L$$貀D$L$ u> T$ J e u$B N$$ x6DŽ$`DŽ$d$h$lPf3f `T$ J e u$B H$$x0DŽ$`DŽ$d$h$lPÍ`2$)jtD$ T$ J e uB $xfPf f Vf fDŽ$0DŽ$4DŽ$8DŽ$<HfL$ 2 $@tD$ L$$0$4D$ @fD$2$@tD$ L$$8$<Ͻ$D$0$0D$D$ D$$D$L$DŽ$`DŽ$d$h$lPÍ$htD$$$TQ L$T$$D$L$ u> T$ J e u$B 8$$x DŽ$`DŽ$d$h$lPÍ $htD$$$TIT$L$$D$L$ u> T$ J e u$B $$MxvDŽ$`DŽ$d$h$lPÍ$ogtD$$$TQ L$T$$D$ L$u> T$ J e u$B $$裾xDŽ$`DŽ$d$h$lPff(tLf)1$ftD$ T$ J e uB V$xE"$iftD$$$TQ L$T$$D$L$ u> `T$ J e u$B $$蝽xDŽ$`DŽ$d$h$lPÍ`$etD$$$TQ L$T$$xD$L$ u> T$ J e u$B 4$$xDŽ$`DŽ$d$h$lPf(Pff f :f DŽ$ DŽ$$DŽ$(DŽ$,HfL$ 2 $ T$ J e u$B $$$x DŽ$`DŽ$d$h$lPftLf`3$btD$ T$ J e uB $fx$$btD$$$TQ L$T$$lD$L$ u> `T$ J e u$B ($$xDŽ$`DŽ$d$h$lPfftLf2$atD$ T$ J e uB $`x ̲$atD$D$|$TQ L$T$$D$L$ u8 T$ J e u D$|B ($D$|xDŽ$`DŽ$d$h$lPf(tLf33$`tD$ T$ J e uB $mx̲$`tD$$$TQ L$T$$sD$L$ u> T$ J e u$B /$$xDŽ$`DŽ$d$h$lPDŽ$DŽ$@fD$2$Q7tD$L$ $$9$D$"$D$D$ D$D$L$DŽ$`DŽ$d$h$lPf<f2Pf f Vf f DŽ$DŽ$DŽ$DŽ$HfL$ 2 $T6tD$ L$$$D$ @fD$2$#6tD$L$ $$Ͻ$D$0$D$D$ D$D$L$DŽ$`DŽ$d$h$lPÍ $;^tD$$$TQ L$T$$负D$L$ u> @T$ J e u$B $$oxDŽ$`DŽ$d$h$lPÍ[$]tD$$$TQ L$T$$zD$L$ u> T$ J e u$B $$ŴxDŽ$`DŽ$d$h$lPfff$\tD$D$p$TQ L$T$$5D$L$ u8 T$ J e u D$pB D$D$px/DŽ$`DŽ$d$h$lPÍ3$(\tD$ T$ J e uB $虳x`Ͳ$[tD$$$TQ L$T$$D$L$ u> T$ J e u$B [$$xCDŽ$`DŽ$d$h$lPf(Vff($[tD$D$h$TQ L$T$$D$L$ u8 `T$ J e u D$hB $D$h[xDŽ$`DŽ$d$h$lPÍ $}ZtD$D$l$TQ L$T$$9D$L$ u8 T$ J e u D$lB $D$l躱xDŽ$`DŽ$d$h$lPf)f2tLf3 4$YtD$ T$ J e uB m$3x\ $YtD$D$x$TQ L$T$$謣D$L$ u8 T$ J e u D$xB $D$x轰xDŽ$`DŽ$d$h$lPÍ$XtD$D$d$TIT$L$$KD$L$ u8 T$ J e u D$dB Z$D$dxEDŽ$`DŽ$d$h$lPf<$Pf<fNf f :f DŽ$DŽ$DŽ$DŽ$ HfL$ 2 $)/tD$ L$$$D$ @fD$2$.tD$ L$$$ Ͻ$D$0$D$D$ D$q~D$L$DŽ$`DŽ$d$h$lPÍ`1$WtD$ T$ J e uB $聮x $VtD$$$TIT$L$$wD$ L$u> T$ J e u$B C$$x+DŽ$`DŽ$d$h$lPff$VtD$D$T$TQ L$T$$ D$L$ u8 T$ J e u D$TB $D$TMxvDŽ$`DŽ$d$h$lPÍ@[$oUtD$D$X$TQ L$T$$kD$L$ u8 T$ J e u D$XB $D$X謬xDŽ$`DŽ$d$h$lPfVff $TtD$D$L$TIT$L$$,D$L$ u8 `T$ J e u D$LB +$D$LxDŽ$`DŽ$d$h$lPÍ $TtD$D$P$TQ L$T$$軴D$L$ u8 @T$ J e u D$PB $D$PLxuDŽ$`DŽ$d$h$lPf(Vf2f<R $PStD$D$@$TIT$L$$D$ L$u8 T$ J e u D$@B $D$@荪xDŽ$`DŽ$d$h$lPÍ˲$RtD$D$D$TIT$L$$+D$L$ u8 @T$ J e u D$DB *$D$DxDŽ$`DŽ$d$h$lPÍ`$RtD$D$H$TIT$L$$D$L$ u8 `T$ J e u D$HB $D$HKxtDŽ$`DŽ$d$h$lPfPfGVfFfGG$EQtD$D$8$TQ L$T$$D$L$ u8 T$ J e u D$8B $D$8肨xDŽ$`DŽ$d$h$lPÍ $PtD$D$<$TQ L$T$$D$L$ u8 T$ J e u D$ T$ J e u$B $$åxDŽ$`DŽ$d$h$lPÍ$MtD$D$,$TQ L$T$$aD$L$ u8 T$ J e u D$,B `$D$,"xKDŽ$`DŽ$d$h$lPfnfofx($&MtD$D$t$TQ L$T$$D$L$ u8 @T$ J e u D$tB $D$tcxDŽ$`DŽ$d$h$lPÍ1$LtD$ T$ J e uB 0$x@$CLtD$D$4$TQ L$T$$/D$L$ u8 T$ J e u D$4B $D$4耣xDŽ$`DŽ$d$h$lPfUPf 6f uB 2$KtD$ @T$ J e uB /$xDŽ$DŽ$DŽ$DŽ$HfL$ 2 $m"tD$ L$$$D$ @fD$2$<"tD$ L$$$Ͻ$D$0$D$D$ D$~D$L$DŽ$`DŽ$d$h$lPÍ$TJtD$D$$$TQ L$T$$D$L$ u8 T$ J e u D$$B $D$$葡xDŽ$`DŽ$d$h$lPfZPff f :fDŽ$DŽ$DŽ$DŽ$HfL$ 2 $ tD$ L$$$D$ @fD$2$w tD$ L$$$Ͻ$D$0$D$D$ D$~D$L$DŽ$`DŽ$d$h$lPÍ`4$HtD$ T$ J e uB :$x)5$MHtD$ T$ J e uB $辟x`5$ HtD$ T$ J e uB $|xfftLf2 5$GtD$ T$ J e uB Z$ xI4$mGtD$ `T$ J e uB $ޞx4$+GtD$ @T$ J e uB $蜞xDŽ$`DŽ$d$h$lPDŽ$`DŽ$d$h$lP輆xe ;a,D$D$ D$$D$(`&$D$0D$tD$ L$L$D$ 0$D$4D$tD$ L$L$$D$(;$D$D$D$D$ D$M~D$L$L$@D$D,x/e D$;A$t-Q?Wp/u';9uDŽ$DŽ$ĐÁ.B9t́p/e@ӟ9A$X\$ T$41L$$AT$4\$ 9D$$ ‹Y $\$D$ L$ttID$HD$LL$HD$L3$D$ D$HD$D$ D$~D$L$$$ĐDŽ$DŽ$ĐD$8D$<L$8D$<$$D$D$8D$D$ D$~D$L$$$ĐË$${p/~Yew@~.8u09'Yeu9$0Ye܁_B>fu&39?u΍ '9뾁?DwV>°u`B9Au0&9Du9}$D܁\P&)9k$t\u09$륉D$,|$`1x$L$,L$L$`L$#^t D$`$`tD$`L$dPT$D$(I$L$gD$L$ tL$0T$(T$@T$T$Dt@D$4D$PD$TD$XD$\ 0 $L$@L$htD$ L$L$PD$TD$4D$XD$0D$\$D$D$PD$D$ D$~D$L$$$ĐDŽ$DŽ$Đø\΀u&9qS$`&9x,e ;av-)$D$D$D$ L$L$D$謀xe ;av^1$]@tL$QD$ @L$D$D$ L$$ $ЋD$L$L$(D$,+xe ;av0$D$ v xe ;av D$fD$xe ;av D$fD$xe ;av D$fD$\xe ;av D$fD$,xe ;a`|$l1qx|$45@c xL$d $T$hT$\$D$ wgL$D$d$D$hD$ D$L$ T$RD$,PL$T$  $ qd L$詋tD$L$D$(D$,HT$4L$8$yBD$D$ L$L$0T$,$BD$L$T$ t \$0\$f39$+ub݈Xݹ B?A '9uv S,lPX݈X݈X وH ވX ߇߈X߇݈Xݹ 냋$°`B9$u?fD$,\$,X݈X݉X݈Xݹ A&9~u5IX݈X݉X݈Xݹ D$1vx $9${x$${x9oT$$^{x$$ ى ȁ׃ nZBZB J ޖB BZ к $$녍$uxzD$W$8\P&)9$\09$Q SPXPXT$D$L$\$>ewD$HL$0T$ wE\$| 9\$ll$4K $T$D${xL$0D$lT$4cD$8T$t3$D$|D$D$D$ L$S0w\$l$D$8L$0T$ty\$h ʡ$tcL$$PL$D$D$ $ $ҋD$L$t$$ļË$$$D$D$hD$D$ L$$$ļû6\7΀&9$+u"sf݈X݈X qS`&9u9 IHX݈X݈X ‹$u$V u u Zxe ;axt $tD$D$@|$D1Jrx)$$D$D$DD$e5t D$D$7tD$DL$HP\$IL$<-,$t$@t$D$T$ D$L$uH$L$@L$T$T$T$sD$D$H< $cD$HPL$PLT$01"\$ $NsD$ XD$L$T$09|ڋH\L$PXT$,1"\$ $sD$ XD$L$T$,9|ڋHhL$PdT$(1"\$ $޷sD$ XD$L$T$(9|ڋHtL$PpT$$1"\$ $覷sD$ XD$L$T$$9|@\@` e @X@P@T e @L@h@l e uk@d@t@x e u<@pH|u $sD$@Hu@É $ܯD$ҍxp1*mx뻍xd1mx댍xL1 mxZxX1lx$D$D$ $L$L$sL$u@Ðu@Txe ;a$D$($L$L$ssD$tcD$L$ T$T$ D$L$D$D$D$ D$tD$,$L$ L$?s떋D$0$L$ L$)s뀋D$,$蛵sD$0L$,9u$É$胵s\Tx7e ;aKlBD$4JL$0T$p$T$tT$T$xT$T$|T$ L$D$}gD$L$T$ \$$D$8L$@%{|$X+qxt$X qxD$0D$D$4D${t$|$Dpx|$D$8H L$PXh @ $T$\$D$ D$ 2D$L$D$ L$$s Mx됍|$9;u#e ;av+Yu(D$tg$fD$ us nMx뼍|$9;uЉ#e ;avAYu>D$t(D$$D$D$D$ L$L$ D$$s Mx릍|$9;u#e ;av: D$$L$L$跍sD$L$ $D$蠍sD$D$ Lxe ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$5sD$ 1݉4$T$l$sL$ D$\$Lxqe ;avBD$$L$L$D$OsD$ L$ $D$訌sD$D$Kxe ;avJD$T$8u1H@ZR9t 1D$É$D$\$OsD$ 1?Kxe ;avLYuID$t3HX@ $L$\$D$ QD$L$D$ L$$s Jx뛍|$9;u#e ;av7 Yu4D$t$D$L$L$D$ is bJx밍|$9;uĉ#e D$;Av]YuW$t>fx$$W$$$$Ĭs Ix농$9;u#e D$;AvlYui$tMex$$$$$$$$Ĭ@s 9Ixt$9;u#e D$;Av]YuW$t>dx$$$$$$Ĭs Hx농$9;u#e ;avaD$$L$L$D$sD$ L$Q$D$8sD$L$ $D$D$sD$ D$Hxe ;avuD$T$9u^JZhp9t/1Ʉt%H Z 8u@ J 8D$11$t$L$蜅sL$ D$T$1Gxoe ;av+D$$D$D$D$ sD$ D$.Gxe ;av8D$P\$k9‹+9!ʄtK@8D$ 1Fxe ;avBD$$L$L$臇sD$L$ $D$D$sD$ D$gFxe ;avcD$H\$k39t+1Ʉt!KP9uK @ 9D$11$t$L$sL$ D$\$Exe ;avD$D$鏛yExe ;avD$D$韜yExe ;avD$D$܊yWExe ;avD$D$y'Exe ;avD$D$OyDxe ;avJD$$L$L$D$?sD$ L$ $D$D$ sD$ D$Dxe ;av&D$T$8uJ@9D$ 1CDxe ;av: D$$L$L$sD$L$ $D$sD$D$ Cxe ;avsD$H\$k39t;1Ʉt1H @S[ 9t 1D$É$D$\$腁sD$ 1݉4$T$l$jsL$ D$\$VCxqe ;aD$$L$L$sD$L$Q$D$sD$L$Q$D$D$msD$ L$Q$D$ƃsD$L$Q$D$诃sD$L$$ $D$蘃sD$D$BxBe ;aRD$H\$k391ɄH S kp91ɄHS9HSkp9tt1ɄtjH S kp9t;1Ʉt1K(S$X(@$9t 1D$É$D$L$sD$ 1݉,$t$T$sL$ D$\$1뤉,$t$T$sL$ D$\$l1e1^,$t$T$csL$ D$\$1 4$T$l$:sL$ D$\$#Axe ;av10Yu.t$4t^xD$,D$80s @x붍|$49;uʉ#e ;av10Yu.t$4t]xD$,D$80os h@x붍|$49;uʉ#e ;av94Yu6t$8t G]x@D$0L$,L$xe ;avWD$HT$Z*09t1Ʉt@J8D$1,$t$\$|sL$ D$T$r>xe ;avaD$$L$L$D$sD$ L$Q$D$sD$L$ $D$D$sD$ D$=xe ;avhD$T$f9uNHZjp9t1Ʉt@ J 8D$1,$t$\${sL$ D$T$1q=x|e ;av+D$$D$D$D$ sD$ D$=xe ;av,D$D$D$$D$ zsD$ D$tD$@$L$L$QT$D$ )>tD$@$L$L$޹T$D$ =tD$@$L$L$T$D$ =tD$@$L$L$ߺT$D$ ~=tD$@$L$L$T$D$ E=tD$@$L$L$ T$D$ =tD$@$D$D$ nL$D$ x|$H6'$$QT$T$vD$ D$\L$L$8T$T$D\$T\$d\$0\$h0$\$d\$sD$L$ T$8\$\-e K$D$`&$ǽsD$L$ T$8\$\C-e t$DۇޅuRK '$t$BD$|$ $D$$D$$D$YBtD$\L$8T$DM|$Hk tD$4L$$T$(\$P[$-ߺl$D$D$ L$T$D$T$ӋD$L$L$dD$hHÉ|$,k]9x|$,d'$L$\QT$T$vD$D$(L$L$$T$ T$4\$0\$8\$ \$<0$\$8\$ sD$L$ T$$\$4-e KD$LD$`&$sD$L$ T$$\$4C-e t$(ۇޅuIK '$t$BD$|$ D$XD$D$\D$D$`D$=tD$4L$$T$(|$,k 8x|$,뤍{8x=Vu Ou Hu q x,e ;aHD$LHL$0PT$ 7'$L$\QT$T$vD$D$(L$L$$T$ T$4\$0\$@\$ \$D0$\$@\$`sD$L$ T$$\$4-e t$(NۇޅK'$t$BD$|$ D$XD$D$\D$D$`D$Yu;D$t%H$L$+D$L$ D$L$Қs x멍|$9;u#e ;avYD$$L$L$D$sD$ L$Q$D$XYsD$L$ $D$AYsD$D$@xe ;aD$T$9ujHXjr9t;1Ʉt1H@ Z R9t 1D$É$D$T$UsD$ 1݉4$\$l$UsL$ D$T$1x_e ;a(xD$|$$D$$D$$D$ D$L$T$\$vD$HL$L$>$1111T$,\$Dl$4t$0 $D$gD$ L$tID$XD$\L$XD$\V$D$.D$XD$D$ D$|~~D$L$T$H$T$L$T$D$T$,$T$0$T$4$DŽ$DŽ$$$xÍ$D$msD$L$L $D$FD$D$T | $D$bmsD$L$H $D$zD$L$H$L$L$L$D$L$,$L$0$L$4$L$T$$DŽ$DŽ$xÉ $$D$\$$D$ $D$ fD$$D$HD$ L$T$\$l$(t$$FD$hD$lD$hl$le$D$D$hD$D$ D$|~D$L$T$H$T$L$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$$xÉAD$@L$)1{ e B xe ;avfe vuju e <",}<dy1{^4YZSPe  xe ;avHe vuu e 輇+;H>e a xe ;avae vuzu e L2+;(cy0{.DXjRe  xe ;a&e vuu &e r`by#0{?ż$D$mxD$L$ yd e  yd $D$D$je L$ uR od $cD$D$fe L$ u od &e Í=od J!x=od ;!x륍=yd ,!xa xe ;avke vu躈u e 茅r)9hay.{N\ VPPe  xye ;a,,e v,u u ,e =93чYd0y?.{A5Iqo!|!x$D$e L$ od nsD$D$ $L$(`$se |$|$$50*d%xL$ |$$O e upD$(!$D$ I޺D$D$ |$D$D$ e L$u 0c ,e ,Í=0c xD$(x닍`$|$0*D$!tO=od xHxCe ;av/=e vuju =e /#=e xe ;avk5e vuu 5e &772"H,{CGmYĂ诀y|?{5e nxye ;avW.e vu芅u .e "G&6"+{F~io.e xe ;avH/e vuu /e %W+{?MFol/e xe ;avu4e vu誄u 4e 5跩·H|*{~>E$n% 軠fle4e xoe ;ava0e vu u 0e ܀$"5~y|;)w *{Em0e hxe ;avMKe vu芃u Ke ){w=}mxkIKe xe ;avR1e vuu 1e <4|R){4NG*9@;֯e 9xte ;av*e vuZu e e we ;avD$D$ we ;a(D$<D$@D$DD$,QI0L$ D$$$\$T$D$L$T$L$ D$$D$L$ $DT$~uuyD$$$D$ D$D$0D$D$4D$ %D$L$tD$<D$@D$Du(Ë@L$89D$sD$ e $P@d$D$$L$D$ L$ui獴$xƄ$B$$9e $D$$$D$ D$D$0D$D$4D$ D$L$L$8D$wYx4l%z{xvd  $D$~|D$ L$ zd e Nzd $D$D|D$L$ zd e  zd e$D$ |D$L$ xzd e  |zd  $pD$Х|D$L$ zd e uq zd |$1w  $L$L$AmsL$T$ $T$}|L$D$ zd e uzd Ge $Í=zd w=zd w농=|zd w>=zd yw=zd iwwe ;avJYuGD$t1H$L$;D$L$D$D$ L$(D$,vWs ow띍|$9;u#e ;avNYuKD$t5H$L$+D$L$T$ \$\$ T$$L$(D$,Ws w뙍|$9;u#e ;av>Yu;D$t%H$L$D$L$ D$L$Vs w멍|$9;u#e ;avNYuKD$t5H$L$D$L$T$ \$\$ T$$L$(D$,Vs w뙍|$9;u#e ;av4He vuSu He  ;He we ;avae vuRu e zR-#! oJEe (we ;avMe vuJRu e Ob*y# 虼e we ;aVLe vuQu Le BNLyvxTo*yzŦ$D$4xD$ L$ zd e zd $D$#4xD$L$ zd e u zd D$D$o4xD$L$ zd e + zd x$D$74xD$L$ zd e  zd J$D$!3xD$L$ zd e  zd '$D$93xD$L$ zd e uT zd >$D$,3xD$L$ zd e u zd Le Í=zd -w=zd w룍=zd w]=zd w=zd w=zd w=zd w7?we ;avRe vuZOu e ,Lz8^詹$e we ;avke vuNu e 荐}xz>4*U 9e >wye ;avae vuZNu e ,Kr~ 'yz.T蟸Ee we ;aN4$D$u e }=zhcl$D$-!xD$L$ yd e uT yd Bu$D$ xD$L$ yd e u yd e Í=yd w=yd wwe ;avBD$$L$L$D$?FsD$ L$ $D$hsD$D$藽we ;avVD$T$9u?JX9u1J XR@ 9t 1D$É$L$D$sD$ 11#we D$;A]c @ bc \$_ ىL$ L$ $L$$ЋD$ D$8L$T$\$\$,D$DD$HL$DT$H  $L$DL$VsD$ D$0L$L$$$6|sD$D$@L$$ e L$0HP$@c D$+VsD$ L$T$@J e 7B $$$D$T$D$ D$MBD$D$4L$L$(T$,|$Lw|$pw L$pD$tD$x B$D$8$|$Lt$pw$*{se |$|$we ;av"|$ e uD$ËD$~wwe ;av&L$e uD$AÍyD$:w賣we ;a@|$1w  $L$HL$T$T$s D$$萁sL$t-D$H$L$D$ L$tˉL$LD$P@ËL$De u5D$HA $D$DH@ I$$D$LD$P@ÍyD$HZwӢwe ;aD$$$L$(L$SD$L$ D$HL$  $L$L$L$ L$ sD$L$$ e u9L$(HD$$D$H@ I$$D$,D$0ÍxD$(聹wD$,L$0w)e ;av9D$@D$$D$ D$D$$D$ sD$D$(萡we ;a,D$0@D$$D$4D$L$8L$ ~sD$L$@tT$wD$dL$htE  ȉ׉D$l׃ T$pL$d?L$dD$hD$t|$Pt$d賚w$A@ʚ;D$iʚ;ډT$t$P肚wDzt$ e '|$|$x;w$D$wMߋ]$$M] $$L$8Y0i(Q,J9eJ\$8K, RLe uω$譑wM$L$$D$觎s1$\$8l$,$l$T$\$ L$sHvD$L$T$\$8S0e uC(t$,$ʉ1G{(Ew$$L$nD$,pD$0$$$l$PȉT$0$$9}t$,ϋ P8uL$81rHP $+uvx$m|$ L$T$,$֋$HT$\$l$T$<CD$XD$tD$xD$|DŽ$L$ 0 $K sD$ L$L$tD$xD$XD$|D$<$vĽ$D$/D$tD$D$ D$j}D$L$$$tÉL|L$L$k5@9X\ Y[Dh pIt$l$ $ӋD$L$ T$T$asD$@09@D$L$$$T$dT$pT$D$ `sD$@09u}@upL$4|$85 twL$0L$@L$ L$DL$(L$HL$L$LL$$L$PL$L$TL$,L$XL$L$\L$4L$8D$<|$ht$8sw`11늸y11(1111T?11Vwce ;a(D$D$D$ D$$D$0D$D$4D$D$,H @D$ L$$D$$D$D$IBD$L$ $D$%[{D$L$T$\$ u%B$ЋD$t D$8(D$8(tI $D$t $Uwe ;a4D$D$D$D$ D$D$ D$L$L$D$ D$$D$(D$,T$PT$ T$TT$$T$DZ RT$(\$,T$ $D$D$}>D$ L$T$$T$T$D$L$ 9D$L$D$`L$d@Qwe ;a!@D$D$L$pL$T$tT$+D$0D$4D$8D$<D$pD$0L$tL$4T$\\$X\$8T$e vut e 3w\{肛xhzXaye KCwe ;av+B$ D$ L$T$T$L$D$nBwe ;av+B$0D$ L$T$T$L$D$Bwe ;avBD$$L$L$grD$L$ $D$D$rD$ D$GBwe ;aviD$HT$Z*09t11Ʉu 1D$ÃD$B$D$rD$ ׉,$t$\$rL$ D$T$Aw{e ;avHe vut e q~7C}Z{h]胙xfze QAwe ;awGe ;aIsD$,]W9Fw%Oω‹D$` FwD$XFw1Ҹ dC$D$T$5D$ D$S4vT$D$ $5D$\$0lrL$ D$XT$\D$XT$\1ڪt .w>e ;av?d d v%I$L$j)D$L$ D$L$qt -we ;av D$L$n-we ;av+L$T$J e uD$ BÍzD$ Dw-we ;avND$T$Z9|&H@IT$$ыD$ L$L$D$ D$D$ ,we ;a $YrD$D$ ^  c c Pe ufH`$re |$u.#w4xNzZr$D$ ޥ $D$D$s|$ Ge ޥ$L$L$D$s|$ Ge Tޥ$L$L$D$fs|$ Ge ޥ$L$L$D$'s|$ Ge ˺ޥ$L$L$D$s|$ Ge gޥ$D$D$D$s|$ Ge  D$Dqd 9r$D$ `ޥ $D$D$XsD$ #`ޥ$L$L$D$0sD$ `ޥ$L$L$D$sD$ !`ޥ$L$L$D$sD$ `ޥ$L$L$D$sD$ %`ޥ$D$D$D$sD$ $e D$@qd |ud 0  $D$e L$ Hqd c CD$ L$ }d e uQ}d ud 0  $D$Xe L$u Lqd ?e Í=Lqd G=w=}d :=w먍=Hqd +=w=c =wc=@qd D$ =w rD$ D$4cD$4ov*e D$;A$vJZ R-P$9$T$wD$L$ pyd e  tyd ʻ$D$=wD$ L$ yd e yd (ۻ$D$=wD$ L$ yd e jyd [\$D$=wD$L$ xyd e   |yd 6f$D$(J=wD$L$ yd e  yd 3r$D$ pyd L$tyd T$$D$-*ѽl$D$ 0rD$L$ e cL$Hyd D$ yd L$$\$ \$-$0l$D$ %rD$L$ e L$Hyd D$ yd L$$\$ \$-l$D$ ,>rD$L$ e L$Hxyd D$ |yd L$$\$ \$-l$D$ 4rD$L$ e L$Hyd D$ yd L$$T$ T$A\$D$ >rD$L$ e L$HD$ od $$qre |$|$uU5 vD$$D$D$X~e L$ u od e $Í=od v$$|$ D$~r똍xD$v=od D$ qvMxD$`vxD$OvkxD$>vxD$-v=yd v=|yd v=yd v=yd vD=tyd vMvHe ;avQ D$$L$L$rD$L$Q$D$rD$L$ $D$rD$D$ ve ;aD$H\$k39tt1ɄtjH Pks 9t;1Ʉt1H@S[9t 1D$É$D$\$[rD$ 1݉,$T$t$@rL$ D$\$1뤉4$T$l$rL$ D$\$lv1e ;av: D$$L$L$rD$L$ $D$rD$D$ ve ;avsD$H\$k39t;1Ʉt1K SX @9t 1D$É$L$\$rD$ 1݉4$T$l$*rL$ D$\$vqe ;av7 Yu4D$t$RD$L$L$D$ Vr v밍|$9;uĉ#e ;av D$$L$L$wrD$L$Q$D$`rD$L$Q$D$IrD$L$Q$D$2rD$L$ $D$rD$D$ vee ;a=D$H\$k391ɄH Pk s91ɄHPks9tt1ɄtjHPks9t;1Ʉt1K$S X$@ 9t 1D$É$L$\$rD$ 1݉4$T$l$DrL$ D$\$1뤉4$T$l$!rL$ D$\$l1e4$T$l$rL$ D$\$)1"4$T$l$rL$ D$\$ve ;a8D$D$D$ D$$D$DXL$@Y1҄D$(D$,D$0D$4D$D$X$L$`T$\T$L$L$dT$hL$ T$ ԺL$D$D$X$L$dT$hL$T$d'D$ L$@ $ЋD$L$$dT$D$(D$ L$uD$L$D$,L$0D$4D$80$D$,D$SrD$L$ D$4L$8D$X$D$4D$D$D$ =QD$LD$P0D$LpD$PD$X$D$LD$D$D$ 3=ٺve ;a,D$0I XL$ " $TT$D$ rD$L$@tu=docku Bf=ertD$4D$rD$ L$$ $$$$ D$D$D$ 'DŽ$$\$$$],tĐÍOzvaW gv%$TvxlË$>vdË$#vxxË$ vË$v‹$ջvЋ$<DŽ$$$x+tĐË$TP$hL$\$$ L$ D$ީuD$L$D$L$$$$hы$DŽ$$$*tĐ脣ve $p;AO$nv7uy$vD$ $L$$$ʚ;D$uty$Jv$I $:$T$Y L$\$$4[$$%v$Wf._Y1$$ u"stopuZfpeu Zdu stop$H $$$T$L$;D$L$ T$A<$|DŽ$DŽ$0$ $$$$T$D$D$ #DŽ$DŽ$0$ ($$$$T$D$D$ |#$ $$8L$$<L$uD$L$ t DŽ$H$L$PDŽ$DŽ$0$0$$ $$L$D$D$ "$$|$$製v|$$$׺vN$|@H$HDŽ$LDŽ$PËJ$ыD$L$$$DŽ$DŽ$0$$D$c8rD$ L$$$$$$D$D$D$ !DŽ$HDŽ$LDŽ$PË$ $D$tD$L$ T$$H$L$PÉ獴$|v$$ivhyD$($lL$,$p$L$D$ʚ;D$ DnvD$$\L$$`$l$$pT$D$ʚ;D$ TovD$$hL$$d$\$$`T$$jvD$$t$d$$hD$iv$L$@^$tXf.Wve D$;A|$P15v$L$P$L$T$L$X$L$\$L$`$L$d$I $|$t$PYv L$DT$H\$Lt+DŽ$DŽ$$$ĐËI$$DŽ$DŽ$Đve ;aH|$016vL$PL$8L$TL$Gy$|莒v獴$|耒vm\D$D$kx$\L$ T$4'\$D$ T$ L$$ $DŽ$DŽ$0$ $$  $$T$D$D$ $ H DŽ$lDŽ$pDŽ$tDŽ$x$l$p$$$t$x$l $D$D$$ HT$\$ Q,e Y(H$$Y<e Q8$\5vHQ,I($\$`$\ $D$D$~D$$DL$ $$L5莐v$$L$P$L$D$D$"D$ $L$$`$L$D$nzD$L$ $<5v$$<$D$@$<$D$D$蛙D$$dL$ $ $D$D$mzD$ L$E$,5 臏v$$,$D$0$,$D$D$D$$HL$ $ $D$D$lzD$L$ $ Q$`Ze s$Zy$dWe =$Q$HZ e $B$2AH @$ $D$U:zDŽ$DŽ$$ӻD$D$$$D$ L$ȺD$D$$D$$DL$ \wuD$$L$($$DŽ$DŽ$0$$D$rD$L$ $$$ $$L$D$D$ g$50mv$$$D$ $$D$D$$ HT$ \$Y$e ZQ HQ I$$L$D$7zD$ L$ e$I/r$$|$O e  O, e $ G0HQ I$$L$D$|$ D$L$T$T$4H xd |d 1҅$$4$0 $D$t$$tv$1v$v$$tv$$$D$kD$L$ u $ $$É$$É$$-re L$u4$QZ Be uA11y2vy$!vÉ$$ÍO0ω‹$ vIv$$Íy vz$諄v$蚄vz$膄v$$É$$É$$Íy86vy(#vz@$ vISs |lve ;a(D$4H$D$0D$L$D$8D$ suD$L$D$L$D$ D$$0$D$D$rD$L$ D$ L$$D$,$D$ D$D$D$ D$4D$v`&96t։t$\$$&r|$G e u2nμD$D$(D$ D$,D$D$0pD$4|$8Ínμ#~vɉ\$(T$,D$0D$4D$8ÍH9s6L$DH09uQ뷉$T$'D$rq s <$T$'D$Sq $l$'D$;q fve ;avH@$%rD$ P e uL$ HD$ÍxD$ }veve ;avH@$=%rD$  e uL$ HD$ÍxD$ |v!eve ;avH@$$rD$  e uL$ HD$ÍxD$ :|vdve ;av_ `$]$rD$D$L$( $L$,L$L$0L$ L$ D$fD$P@L$4T$8D$< *dve ;av_ |$412|v  $#rL$L$T$($T$,T$T$0T$¸T$ L$@f|$4t$7~v cve $;A| $O#rD$$@$ $$L$t$e $@}v$$D$D$D$ lrD$@09u0@u#$@$$$|11׸ɍ$D*}v $$@D$$DL$|rQxbve $;AS$1qzv 0 $D$D$5uL$$T$$\$ $t-0,$D$D$4uL$$T$$\$ $P-0,$D$D$4uL$L$@T$T$<\$ $ -,$$t$ L$D$ =krL$Q @ӟ9J$$$$$t1#G$$$@ӟ$9S 09^J91$\ e u땉ωƉxv낉$$$$ 0 $D$t$l$ \$4uD$L$l$Y$$$$e$$$  $$T$+2\$D$ irD$H@ӟ9=Y $$$P$$1%G$$$@ӟË$9J090PY 90$TTe u 뒉׉Évv끉$$$$ 0 $l$D$t$ T$Z3ul$D$t$P$$$$f$$$  $$T$ٺ\$D$ ZhrD$H@ӟ9Y $$l$@t$<$ 1&G$$\$<э@ӟ$t$<9J09VY 9.T$$$$$$L$8T$D$ IZrD$H09mA YD$x$H$$T$8ĺT$D$ YrD$H09A $$5ZZjv$$$$H$D$x$$ $D$P$$$D$8$$$D$<$D$@$$`$$$$\$$$$$D$ $$8$D$h$$h$$$$<$D$l$$$$$$$$0$D$`$$$$dD$T$h$$D$L$$$D$0$$$,D$,$0$$<D$($@$x$4$$8$D$D$t$ $L$$D$|$($d$t$$x$$|D$4$$X$$$$@$D$p$$$DD$H$H$$lD$$$p$4$ D$d$$($LD$X$P$l$T$$X$$$$$$$$$$$$$p$\$$`$,$D$\$$$$$fv1111$$$T1111W/W!1111T?1111q\1111y11 1111;&1111[1111|11 1111>)1111[FD$ $11t_1111|11! 1111A,1111aL11$ t$[vCve ;avD$HP @T$L$ D$Cve ;aklš$)rD$ 0e )PL$tQ D$D$D$ D$x$ҋD$pHL$$PT$417D$tH T$D$D$ T$x$ыD$,XD$pL$$T$49\$,ڋ@$-ʝl$D$L$ D${HuD$L$D$dL$hš$=rD$D$P 0 $T$dT$qD$ L$T$P e uB3zYv&š$rD$ 0e șPL$tQ D$D$D$ D$x$ҋD$pL$8PT$(17D$tH T$D$D$ T$x$ыD$,XD$pL$8T$(9\$,ً@$-ʝl$D$T$ D$7GuD$L$D$\L$`š$rD$D$L 0 $T$\T$qD$L$ T$Le uJ3zQXv$š$rD$ 0e pЙPL$tQ D$D$D$ D$x$ҋD$pH(L$P$T$<17D$tH T$D$D$ T$x$ыD$,XD$pL$T$<9\$,ڋH$-ʝl$D$D$ L$EuD$L$L$TD$Xš$qD$D$H 0 $T$TT$DqD$ L$T$H e uB3z Wv&š$YqD$ 0e ؙPL$tQ D$D$D$ D$x$ҋD$pHL$ @ D$01\$,SD$0L$ 9T$, ЋY $\$ L$D$ 3~D$L$~L$@š$qD$D$DL$@L$ 0 $/qD$L$ T$De u,JD$tH T$D$D$ T$x$?zUv˃lÍxؙUvxЙUvxșUv%xvUv=vue ;a{8$qD$D$,  $q|$D$@GD$DGe L$<GG e D$,G<$D$L$D$0D$4$WT$D$ D$ L$ CuD$L$L$0D$4`ȡ$q|$ Ge D0$|$D$D$ D$uD$L$:D$(L$ PT$D$QT$ 0$T$0T$D$D$ Yr`ȡ$q |$|$$Ge $q|$GD$ Ge uML$(GG  e uD$$GD$H|$L8ÍOω‹D$$$Sv؋D$(Sv뮉SvrSvOω‹D$,Rv D$v111뭹$h$$@L$T$D$ zD$L$$$\$L$D$ G0rD$H09uCA $|$$\$$`l$L$ D$|{0붋$h$$@L$T$D$ YzD$L$$$\$L$D$ /rD$@`&9uC$| $$T$$`\$D$ D$U{`&븍$$AvĐ111=d (v PL$$L$HL$(L$LL$,L$@L$0T$DT$4T$T$8 $L$$L$L$PL$L$TL$ bL$tD$XD$\<$D$L$T$ D$L$T$ uD$L$D$XL$\<ve ;ai@D$L$L$PL$D$ zD$0D$4D$8D$<D$LD$0D$PD$4D$D@L$D$$D$ D$|uD$L$D$8L$u3.u褦ue ;a(೹$Ifq|$Ge Q |$$G$ e  _G MGD@$eqD$ “ e L$,HL$$ $JD$D$ $ L$D$D$ D$ @L$D$>x܃D$ $еD$D$D$ D$@D$D$>8܃D$$D$0(ÍxD$,込uT$$譼uBO ω_蒼uzDM脼utuuUe ;aG(೹$dq|$Ge   g|$$G$ e a_G MGD@$?dqD$ ʓ e ulL$,HL$$ $@ID$$úD$D$LD$ D$D$=D$D$ D$$D$0(ÍxD$,OuT$$>u낍O ωa_&uzDMu&gu~ue ;a$D$ʆD$D$ ೹ $ cq|$Ge  |$ G$ e upG D$GD@$bqD$ ϓ e uL$HL$ L$ÍxD$uT$ uՍO ωuzDD$u{׹uFMue ;a$D$ȆD$D$ ೹ $aq|$Ge  |$ G$ e uptG D$GD@$aqD$ pѓ e uL$HL$ L$ÍxD$uT$ ۸uՍO ωtøuzDD$跸u{觸uFue $T;A,BD$lL$\ $oպT$D$D$D$XL$ L$pT$\$IκT$D$D$L$ T$p$T$XT$L$D$ D$lD$̞D$D$hL$L$P`$.`qD$D$t ) $`qe L$KD$t$_qD$D$xjqe $ D$x$0$DD$$D$D$ԃD$L$ T$\$t]CSD$LL$d$0$DD$$еD$D$8ԃD$L$T$\$ t@L$L*$1薷uL$PT$xT$T$h$эt$$uL$@L$TT$D$$ܻuL$T$$D$HL$`DŽ$DŽ$0$ ؓ$$ $D$D$ |$ D$D$ D$`D$ L$HL$#T$D$tD$L$ $$DŽ$DŽ$0$$L$j6qD$L$ $$$$D$D$|DŽ$DŽ$0$ $$ $D$D$|$iD$D$D$`D$ D$HD$(tD$L$D$L$$0$vD$ L$$$DŽ$DŽ$DŽ$DŽ$0$ $$$L$*5qD$L$ $$$$D$D$|D$|DŽ$0D$|$D$|$D$D$_|,tAj$T$謣D$ L$T$\$l$t\ER $D$T$D$ D$tD$D$L$tID$t$D$be L$u T$x :|$xu(D$d$L$D$L$T$ \$l$t@$T$l$|D$ D$xD$肝D$L$t|Iw|$x`u|$tPu獴$uo0$ГD$P%s $T$B%s $D$4%s ,$\$&%s $D$%s $L$ %s $L$$s $T$$s 觙u"e ;av]BHT$9sCkp\TTPl$9s0kplPDTl$D$ $\$pD$D$ s ,ue $0;A^P$uBD$L @{ $GYqD$D$`L$LT$@$oպ\$D$D$ D$\L$L$D$($ еL$D$D$ D$ @L$D$>D$($ ٺL$D$D$ D$ L$D$hD$($ TL$D$D$ D$<T$D$ (D$($ ٺL$D$ NL$ D$D$D$ ^ L$D$ 6fD$($ 6L$D$ AL$ D$D$D$ L$D$ .D$($ L$D$ OL$ D$ eL$D$ L1L$D$ %D$($ 쿺L$D$ FL$ D$D$D$ L$D$ 6nD$($ L$D$ JL$ D$D$D$ ŽL$D$ /D$($ sGL$D$ +L$ D$ TL$D$ L$D$ $ȿD$($ FRL$D$ L$ D$ P L$D$ @L$D$ &tD$($ kXL$D$ ,L$ D$D$D$ L$D$ 3"D$($ úL$D$ *L$ D$ 5L$D$ST$D$ 'ξD$($ úL$D$ LL$ D$D$D$ #L$D$ |D$($ 0L$D$ !L$ D$ 5L$D$ 8L$D$ <(D$($D$D$D$ D$D$D$5XD$,D$80ÍxD$4ޝuT$,͝uO ωt貝uzDM褝u蔝uW ue ;aG(೹$Eq|$Ge   g|$$G$ e G MGD$_EqD$  e ulL$,HL$$ $`*D$$úD$D$LD$ D$D$=D$D$ D$$D$0(ÍxD$,ouT$$^u낍O ωFuzDM8u&g(u螄ue ;a$D$#D$D$ ೹ $-Dq|$Ge  OY|$ G$ e upGOG D$GD$CqD$  e uL$HL$ L$ÍxD$ L$  $\$<\$D$ uq|$D$$GG e L$@G11ۅtC$1|u $DŽ$ Gк$DŽ$  $&$qL$`$$.q $$ .q $$.q $$.q $$.q $$.q $$ .q $$$Ƅ$(DŽ$ е$L$8 T$ L$$ $^T$D$զL$0Q4I07T$(L$D$$L$T$ަD$ L$L$buD$lD$p0D$l L$pL$l $D$D$YJD$`$ $T$ r &r r Iu#e D$;A$buBD$L z $ qD$D$`L$LT$@$oպ\$D$D$D$B}=Wylz e 6ue ;a D$$L$L$wpD$L$Q$D$wpD$L$Q$D$wpD$L$Q$D$nwpD$L$Q $D$WwpD$L$Q($D$@wpD$L$Q0$D$)wpD$L$8 $D$wpD$D$ 6ue ;aD$H\$k391ɄH Pks 91Ʉ{HPks9E1Ʉ4HSkp91ɄH$S$k p 91ɄH,S,k(p(9tt1ɄtjH4S4k0p09t;1Ʉt1H8S<[8@<9t 1D$É$L$T$rpD$ 1݉,$t$T$rpL$ D$\$1뤉,$t$T$rpL$ D$\$l1e,$t$T$rpL$ D$\$)1",$t$T$erpL$ D$\$1,$T$t$D$ D$D$D$D$ ZD$(D$4,ÍxD$0DuT$(Du4O ωMDuzDMDugDu,uGe ;a$D$SD$D$ ೹ $p|$Ge  iY|$ G$ e upG D$GD$9pD$ N e uL$HL$ L$ÍxD$CuT$ CuՍO ωsCuzDD$gCu{iYWCuF+ue ;a,$D$SRD$D$( ೹ $]p|$G*e M q|$$G$ e G D$(GD$pD$ O e L$0HL$$ $ІD$D$ $ L$D$D$ D$ @L$D$>aD$ $еD$D$D$ D$@D$D$>NaD$$D$4,ÍxD$0AuT$$AuBO ωAuzDD$(AuqAu*u=e D$;ABD$hL$` $oպT$D$qD$ D$lL$L$XT$`$IκT$D$qD$L$ T$l$T$XT$L$D$ D$hD$'D$L$$L$P$Rt{$1AuL$P8\$T$,$эt$ $EuL$DL$TT$H|$x$EuL$Tut$xEuthAaD$d\$\T$LD$pD$t0D$pD$tD$p$D$D$=(D$dL$PT$L\$\$ $T$r r 'u9e $L;AR4BD$pL$\ $oպT$D$&pD$D$XL$ L$xT$\$IκT$D$oD$L$ T$x$T$XT$L$D$ D$pD$%D$L$$@D$hL$T$<kl$P΋ L$dwST$`[ \$LD$|DŽ$0D$|$D$|$D$D$&$14?uL$ L$tT$L*\$`+taskupipeu Slinet011Ʌu獴$oCuV4@$>uL$T@T$dT$T$PT$T$h$э$t$tCuL$HL$lD$D$$BuL$lm$P>uL$TDT$dT$T$PT$T$h$э$t$tBuL$HL$lD$D$$BuL$l\$`*pipeTjlineE*taskv DŽ$DŽ$0$ $$ $D$D$$D$hL$d$@$<l$Pt$T$L$qr 芠r 胠r $ue $l;AB$ $k3l$P{k D$|L$ht$p|$ll$LCD$dST$H $oպ\$D$UlD$ $L$L$`T$h$IκT$D$$lD$L$ $$T$`T$L$D$ D$|D$"D$D$tL$L$TPp$D$x$ jD$l$D$L$0$$L$ڻpD$D$\L$ $$\$x\$-l$D$ 3qD$L$\ e $HD$d$D$H$0$$L$NpD$D$\L$ $$\$x\$-ƺl$D$ C3qD$L$\ e 4$HD$p$D$P$0$$D$ºpD$D$\L$ $$T$xT$p\$D$ 2qD$L$\ e $H$19:uL$THT$xT$T$t$эt$$>uL$@L$XT$D$$>uL$Xu獴$k>uRAx$8ubx$8ux$8u"DŽ$DŽ$0$ Ȗ$$ $D$D$ B $T$_r xr qr jr  ue $;A $8uBD$x | $pD$$L$xT$\$oպ\$D$XhD$ $L$L$PT$\$IκT$D$'hD$ L$$$T$PT$D$L$ D$xD$Pc L$L$HT$T$t@0Tc -l$D$$Ѝ|$D$ L$$T$HRT17u\$$D$D$$D$L$t $ҋD$(L$$tE I= $$ ĆD$$úD$D${zD$ L$T$tBD$.$$ÆD$$)D$D$)zD$ L$T$L$.$@D$P1$@ى‰$T$L$l;u$$l;uDŽ$DŽ$0$$L$rpD$L$ $$$$D$D${D$L@L$P9QË$ID$/L$P1111$@݉D$/l$@t$<$$\$L$,":u$$,:u$  PL$Tt$0$}=P|$4=P|$X`0$pD$$$Pe #$$H e P$$H e P$$H e P$$ H$ e PP L$0H, e #L$TH(L$4H4 e L$XH0$($$H< e P8L$D$P@L$<9|D$h$UÍxTU1uD1u$@$$l$L$\$ T$sl$D$\$P$L$ m|$G$ e TrG D$P$*D$D$,L$P $FD$D$(L$P $bD$D$$L$P $D$D$ L$P $jD$D$L$P $D$D$L$P $RD$D$|$01XuD$,D$0D$(D$4D$$D$8D$ D$D$L$ T$h$T$PT$L$D$ D$dD$D$L$L$\$1uL$XL$L$LL$L$\ $Ѝt$ $-uD$DL$HL$`|$t$uut$tuʦtN@ID$lD$p0D$lD$pD$l$D$D$L$T$D$`D$Br [qr t?e ;aTBD$<L$, $oպT$D$=D$D$(L$ L$@T$,$IκT$D$R=D$ L$T$@$T$(T$D$L$ D$l$\ IDD|֋e  DD$8@L$<9t$,l$\ud 0  $D$D$D$D|$|5) u$L$|L$D$D$ D$Dǀ@X e uj UHTL$,~FT$\1 l$TU ËD$DT$T\$< jr$L$l$t$ nD$<@L$,9|‹D$D$腕ÍxTUuuD$P@$l$\l$L$\$ T$sl$D$\$PD$PL$,xuZxu%lju11jtee D$;ABD$xL$h $oպT$D$6D$ D$|L$L$dT$h$IκT$D$6D$ L$T$|$T$dT$D$L$ D$xD$D$L$$G$k3+l$Tt$lD$tL$\S T$X[\$pDŽ$DŽ$0$8$$$D$D$$1uL$\T$lT$T$TT$T$pT$ T$XT$T$t$эt$$a uL$LL$`T$P$$B uL$`u獴$, u¦tA X $T$wr hr hr Ute D$;A_BD$L @ $苬pD$L$L$$D$\T$@$kl$,\$D$oպD$D$4D$D$D$DL$4|$,l$@t$$ST$<[\$(D$LD$P0D$LPD$PD$L$D$D$wD$4$ oպL$D$0D$D$0L$ L$HT$4$IκT$D$0D$L$ T$H$T$0T$L$D$ D$DD$D$L$ T$8T$T$$T$T$@T$ T$,T$T$|$ G$ e upG D$GD@$IpD$  e uL$HL$ L$ÍxD$tT$ tՍO ωtzDD$wt{>gtFte ;a$D$c D$D$ ೹ $mp|$Ge  -|$ G$ e upAG D$GD@$pD$ 0 e uL$HL$ L$ÍxD$|tT$ ktՍO ωAStzDD$Gt{-7tFte ;aJ|೹$Yp|$Ge  6|$G$ e {<G $$D$D$D$ $D$D$@$ $)D$D$<$ $B D$D$8$ $D$D$4$ $D$D$0$ $D$D$,$ $FD$D$($ $_D$D$$$ $xD$D$ $ $D$D$$ $D$D$$ $D$D$|$H1stD$DD$HD$@D$LD$tȋL$ Fte ;ab0೹$Yp|$Ge ( |$,G$ e G MGD@$pD$ 0 e L$4HL$, ${D$D$($ L$D$D$ D$ @L$D$> D$($ еL$D$D$ D$ @L$D$>H D$($ ٺL$D$D$ D$ L$D$ D$($ TL$D$D$ D$<T$D$ D$($ ٺL$D$ NL$ D$D$D$ ^ L$D$ 6 D$($ 6L$D$ AL$ D$D$D$ L$D$ . D$($ TL$D$ OL$ D$ eL$D$ L1L$D$ %` D$($ L$D$D$ D$ L$D$ uL$D$  D$($ 쿺L$D$ FL$ D$D$D$ L$D$ 6 D$($ L$D$ JL$ D$D$D$ ŽL$D$ /j D$($ sGL$D$ +L$ D$ TL$D$ L$D$ $ D$($ FRL$D$ L$ D$ P L$D$ @L$D$ & D$($ kXL$D$ ,L$ D$D$D$ L$D$ 3p D$($ úL$D$ *L$ D$ 5L$D$ST$D$ ' D$($ úL$D$ LL$ D$D$D$ #L$D$  D$($ ܟL$D$D$ D$ PL$D$AD$($ L$D$D$ HAL$D$>e/D$($0D$D$ !D$ D$5D$D$8D$D$ < D$,D$80ÍxD$4tT$,tkO ωtzDMt t#t~e ;a$D$D$D$ ೹ $譐p|$G$e  $|$ G$ e upG D$GD@$YpD$  e uL$HL$ L$ÍxD$tT$ tՍO ωtzDD$t{$wtFte ;a$D$sD$D$ ೹ $}p|$Ge  R|$ G$ e upBG D$GD@$)pD$  e uL$HL$ L$ÍxD$tT$ {tՍO ωBctzDD$Wt{RGtFte ;aG(೹$ip|$Ge   g|$$G$ e G MGD@$pD$ Ô e ulL$,HL$$ $sD$$úD$D$LD$ D$D$=D$D$ +D$$D$0(ÍxD$,tT$$t낍O ωtzDMt&gtNte ;a$D$D$D$ ೹ $݌p|$Ge  |$ G$ e upG D$GD@$艌pD$ ˔ e uL$HL$ L$ÍxD$tT$ tՍO ωtzDD$t{ tFte ;a ೹$ɋp|$Ge  |$G$' e uigSG @$|pD$ ͔ e uL$HL$L$ ÍxD$tT$tՍO ύgSt뎍t`#te ;a$D$D$D$ ೹ $譊p|$Ge  G|$ G$ e upTOG D$GD@$YpD$ PΔ e uL$HL$ L$ÍxD$tT$ tՍO ωTOtzDD$t{GwtFte ;a$D$sD$D$ ೹ $}p|$Ge  U!|$ G$ e up-G D$GD@$)pD$ Д e uL$HL$ L$ÍxD$tT$ {tՍO ω-ctzDD$Wt{U!GtFte ;a$D$CD$D$ ೹ $Mp|$Ge  u5|$ G$ e up>G D$GD@$pD$ Ԕ e uL$HL$ L$ÍxD$\tT$ KtՍO ω>3tzDD$'t{u5tFte ;a$D$D$D$ ೹ $p|$Ge  "|$ G$ e up-G D$GD@$ɆpD$ Ք e uL$HL$ L$ÍxD$,tT$ tՍO ω-tzDD$t{"tF]te D$;ABD$HL$<@$pD$$D$T$Q ZL$hT$lD$xD$|DŽ$DŽ$0D$x L$|$L$hL$(^pD$L$ $$D$x$D$D$0{D$<$ oպL$D$ D$ D$PL$L$8T$<$IκT$D$j D$ L$T$P$T$8T$D$L$ D$HD$NPc L$L$DT$T$0@$Tc -9Rl$D$ $Ѝ|$D$ L$L$PT$0RT1t\$D$PD$D$D$TD$L$D $ҋD$$L$(D$TL$L@D$81T$4ы@$-ʝl$D$\$ D$sD$L$D$XL$\D$`D$d0$L$XL$q\pD$L$ D$`L$dD$`$D$D$.{D$4PD$8L$L9UĈtZ@UT$,L$@D$pD$t0D$p L$tL$p $D$D$(ÆL$@T$,Q$L$Mr >r te ;a BD$ ` $L$$L$L$(L$2`pD$ D$L$L$ $蔂pD$L$ e u5L$H$¸D$D$D$/LJD$ L$D$,L$0 ÍxD$tt?e D$;ABD$PL$D $oպT$D$I D$ D$\L$L$@T$D$IκT$D$ D$ L$T$\$T$@T$D$L$ D$PD$D$L$$D$8L$L$Z\$4T$HCl$l$X1\$<,$\$T$dD$tBD$XL$L $oպT$D$5D$ D$tL$L$HT$L$IκT$D$D$L$ T$t$T$HT$L$D$ D$XD$D$D$TL$L$4{$M_pPc L$L$x@$Tc \$D$$Ѝ|$D$L$ L$DT$4RT1藷tL$DL$\$ L$L$xL$\$T$ҋD$$L$(t@D$xHP$$$DŽ$DŽ$ ”$$ { $$L$7pD$ L$ $D$$D$[|$$\CD$$úD$D$D$ L$T$D$xHL$H1\$p8‰؉D$pT$@$Xt$0$EtD$|DŽ$ 0 $$0\$%6pD$ L$L$|$D$|$D$D${D$@@L$H9]ËL$xQ T$H\$\$l1111T$p8ȉщ݉L$pD$@l$0t$,|$t$wt$h$dt$1Mt m\ $D$$L$Hl$T$ v$t$lt$$t$1t m\ $D$$\$X\$T$ 9v$t$l藹t$$脹t獴$vtvL$L$hT$T$<獴$StvL$L$dT$T$8 6$[pD$$h$lPe @$p$tP e  H$$Pe H$$Pe H$$P$e mH L$HD$H@L$,9|D$P$U?ÍxTUްtMҰtD$\@$l$tl$L$\$ T$msl$D$\$PD$\L$,yx@‰tOx8‰ltx0D$dWtx(D$hBtx ‰/tx‰tNx‰ tx‰tljt11tA $T$"r $L$"r 螗te ;a_@BT$LDD$0L$(T$HZ\$ T$, $oպD$D$ D$ D$4L$L$$T$($IκT$D$ߥD$L$ T$4$T$$T$L$D$ D$0D$D$L$T$,T$T$ T$ $ЋD$ L$T$\$l$u$L$T$6k@tPCID$8D$<0D$8D$e vur e l'}蒨IxIze [te ;avQ D$$L$L$oD$L$Q$D$oD$L$ $D$oD$D$ te ;aD$H\$k39tt1ɄtjH Pks 9t;1Ʉt1H@S[9t 1D$É$D$\$koD$ 1݉,$T$t$PoL$ D$\$1뤉4$T$l$-oL$ D$\$lt1e ;a (೹$Fp|$Ge  ?J|$G$ e 6NG D$,$D$D$L$, $D$D$L$, $D$D$D$ D$$L$L$L$L$ D$$D$$L$L$D$D$ .D$D$0(ÍO ύ6N肝tW?Jrt%te ;a ೹$Ep|$Ge  |$G$ e urG MGD$CEpD$  e uL$HL$L$ ÍxD$覜tT$蕜tՍO ω}tzDMoty_tBՄte ;aG(೹$Dp|$Ge   g|$$G$ e =,G MGD$/DpD$  e ulL$,HL$$ $0)D$$úD$D$LD$ D$D$=D$D$ D$$D$0(ÍxD$,?tT$$.t낍O ω=,tzDMt&gtnte ;a$D$D$D$ ೹ $Bp|$Ge  k|$ G$ e upKaG D$GD$BpD$  e uL$HL$ L$ÍxD$ tT$ tՍO ωKatzDD$יt{kǙtF=te D$;ABD$TL$H $oպT$D$9ʥD$ D$XL$L$DT$H$IκT$D$ ʥD$ L$T$X$T$DT$D$L$ D$TD$D$L$L$L$1tL$L $Ѝt$$XtD${莒xA|*{e ]yte ;ahD$D$D$lD$D$pD$sD$ D$dL$L$T$T$ \$$$\$t\$\$x\$跁sD$d$D$D$D$ D$[D$D$|hxt_e ;aIe vuq Ie {$D$D$D$ D$4zD$L$Hd e ul Ld %$D$D$D$ D$zD$L$Pd e u Td Ie Í=Td 2t=Ld #twte ;avM$@D$ D$D$$D$D$(D$ D$L$T$ \$,D$0L$4T$8,wte ;avM$0D$ D$D$$D$D$(D$ D$L$T$ \$,D$0L$4T$8vte ;avM$ D$ D$D$$D$D$(D$ D$L$T$ \$,D$0L$4T$8Lvte ;avMD$ $D$$D$D$(D$D$,D$ 7D$L$T$ \$0D$4L$8T$<ute ;aLD$H?L$ @$l5p|$|$ D$GPD$ XL$T$9t $T$D$єt|$ 5@^ 2tD$ HPX 3h 1hǀ@@@D@H@LX~xTt$ tǀD$(D$,D$0Ëd d D$(D$,L$0Ëxd |d D$(D$,L$0itte ;a?v|$ t$ $\$D$, D$ hL$\$D$T$@}rpjDr@t$ l$ $\$D$ D$L$T$\$@kHsLl$ t$$L$D$ D$L$T$Zl$@uP9\$$ވލUTt$099D$4L$(  $T$D$NtD$$T$@\$(9+l$4(l$DL$H\$LD$PD$T<ÉT$,3$D$4D$D$0D$\$ L$Fsl$D$\$HD$$T$,떉T$83$D$\$L$ t$FsD$L$T$8\$$l$@t$0T$$t$0-3,$D$T$L$ \$OFsD$L$T$Yl$@t$0ыT$$\$$T$0-3,$L$T$D$ \$FsD$L$T$0\$$$T1p|$G#e u2D$DD$HD$LpD$P|$T<Í袈tq q q qte ;a0D$<L$8fb2 Qb=T$@\$414>FEt$Ft$$|$ D$$T$ ʉT$$y|$ Q y|$ y|$ ׋T$t$  t$ Q 1AI   ƃHT$L$(iq il$  il$ 1AQIk@l$  |$    ƉsDD$HT$(, t$~l$,| t l D D$  lj  , l$l l$l L sHT$    D$ D$ KLD$HT$,, t$~E KPKTPT$89t $T$D$tD$HoD$o%L$8L$4D$DD$H0Í$-p|$G'e uWpD$D|$H0ÍW@t$-p|$G-e upD$D|$H0Ít?q 8q 1q *q #q q q q 7mt2e ;av D$mte ;av D$@PD$lte ;a|$5@^ 蛉tD$HPX 3h 1hǀ@@@D@H@LX~xT臈tǀ'ltRe ;ag0D$4#Qڋ\$<9qhTE,!эLT9~Hډ\$$l$89t $l$\$'tD$$L$4D$ \OJH d d vD e u `OBLÍzL`OctzH\Oct뻍zDXOctq q q /Lt*e ;av3$D$D$?D$ L$D$ L$$Kte ;av3$D$D$D$ L$D$ L$$Kte ;av3$D$D$D$ L$D$ L$$6Kte ;ae vuPq e 2| u3?$D$}tD$L$ d e uY d Q$D$ItD$L$ xd e u |d ve Í=|d at=d atHJte ;aP$D$TD$D$XD$D$\D$ D$`D$D$dD$D$hD$D$D$ D$$D$(D$,D$0D$lD$4D$pD$8D$tD$?\T$ \$(T$ \$(B L$,L$D$@D$ @$ЋD$ @L$4L$D$L$3}v3u9q@=}=r1D$DT$< $l$t$|$ \$$pL$$lL$$hL$$dL$ $`L$$$\L$($XL$,$TL$0$PL$4$LL$8@D$D$|$=LLhlTpt\x|dX\lPTt$pPwT|$lP]Ą$hP9Č$dP Ĕ$`P Ĝ$\P Ĥ$XP Ĭ$TP Ĵ$PPļ$LPb1D$@T$< $l$t$|$ \$$pL$$lL$$hL$$dL$ $`L$$$\L$($XL$,$TL$0$PL$4$LL$8D$@$|$=LLhlTppxZX =LP!'T$pP0 $lP1$hP@L$dPAT$`PP$\PQr$XP`NL$TPa1T$PPp$LPq$$x1],ȉ$p4ʉ$l<ˉ$h3~tL3~3}|$H$h?$l3}3>$p1}t$HuA} r_tË$x14,ȉ$p4ʍ<ˋo3n?3>tL3>3n$p>nA}r=q 6q /q (q !q q q q q q q 2te $t;A $D$\$ \$H݉$Ivt$L$0ml$,$@ml$l$\l$\щ$T$1ʉT$D$,≄$艄$؉$$0I$@?$1ڋ$$l$,щ$T$L1ʉT$L\$H1É ډ$Ɖ$މt$\L$L ͉$$ꋜ$ˋ$щ$1ω$T$\\$1Ӊ\$ ߉$$牔$$lj$$|$,$UT$X$$>|$@牄$$L$Xȋmvt$D$4\$($D[ы$$|$X鉌$1ˉ\$T$(lj㉄$؉$艄$$4I$D61ꋬ$$\$(щ$T$D1ʉT$D\$@1É ډ$lj$߉|$XL$D ͉$$ꋜ$ˋ$щ$1Ή$T$X\$1Ӊ\$ މt$|$T$xD$tƉt$p$Ήt$($3t$T$(/l$8D$lD$ht$T[|$<$8 L$$$HIt$lt$hl$TډT$d1щL$ \$$ƉD$lȉD$hD$`$8[$H?1l$ll$hL$$Ӊ$L$<1ىL${#6u^*|~$D$D$D$ D$0vzD$L$ hd e ld %$D$D$D$ D$uzD$L$`d e O dd ý$D$.D$D$ D$uzD$L$d e  d $D$2D$D$ D$@uzD$L$d e  d N$D$ D$D$ D$tzD$L$d e ) d Oü$D$D$D$ D$tzD$L$pd e  td +$D$D$D$ D$PtzD$L$d e ul d )$D$$D$D$ D$tzD$L$xd e u |d Ke Í=|d N#t=d ?#t닍=td 0#t-=d #t=d #ti=d "t=dd "t=ld "tEN te ;avS$oD$@@  Xd e u \d Í=\d ]"t te ;av*D$L$D$ AD$AD$D$ te ;av;D$ } 1D$ ËD$$D$D$ :HoD$ . te ;aLD$P$D$L$T$ \$tD$\D$`T$d\$hLËT$P$T$TT$T$XT$L$ D$D$ L$$T$D\$HD$\L$`T$d\$hL~ tYe ;aTD$X$D$\D$D$`D$D$dD$ L$hL$+D$ L$$T$D\$Ht T$l\$pTÉT$L\$PT$d$T$hT$D$L$ 藏D$t T$L\$P뽋Hd Ld tLe ;a8D$@$D$DD$D$ L$$T$(\$,l$ t$0uH} D$H8Ã}D$<(9sۋH9sH8D$H8t[e ;adD$t$D$xD$3D$4D$`L$0T$\$ \$Tl$$t$(|$,D$;D$\$|$|$P|$ |$L|$\$|$$DŽ$DŽ$$D$L$D$P$D$T$$$D$;$$D$`$dÉT$Hl$Dt$@D$<\$\|$XD$l$D$pD$l$t$D$;D$D$ L$$T$\T$|T$<$T$H$$$D$X$D$L$D$P$D$T$D$@$D$D$D$;$DŽ$DŽ$d&t!e ;a\3$D$D$rD$D$ L$L$T$ T$($L$D$RD$L$tD$dD$hD$lL$p\Ënd $D$(D$D$D$D$ D$ |D$L$L$,D$0D$`HL$$|$41t`&D$4܈D$8BD$ 3$ќoD$ L$L$Je te ;av+D$$D$D$D$ oD$ D$te ;av,D$D$D$$D$ O@oD$ D$=te ;av>D$T$\$11E}9s< A9|1t$}q te ;a(D$0L$,11;E}9]< C9|1l$8E4|1|B}11111T؉͉щ}CD$$$L$D$8D$D$8L$ T$\$$ kr1TL؉͉щ=}JD$$L$D$8D$D$8L$ T$\$aLHkrM1L؉͉щ=}MD$$L$D$8D$+D$8L$ T$\$Hkr1L؉͉щ=}JD$$L$D$8D$D$8L$ T$\$Hkrn1L ؉͉щ=}FD$ $L$D$8D$ZD$8L$ T$\$ sH kr(3{q ,{q %{q {q {q {q {q 2s]e ;aTD$1 1ˉJȃ}@D$(D$X$L$\L$T$`T$\$\$ D$pL$T$(rKD$111 T؃D$$T$L$D$d$L$hL$T$lT$\$\$ 'D$D$PL$d $T$hT$\$l\$l$l$ D$L$P1ȋL$$D$1ȉD$D$pD$D$pL$ T$\$$ k@o1 TL=D$,T$LL$HD$d$L$hL$T$lT$\$\$ \D$D$PL$d $T$hT$\$l\$l$l$ 0D$HL$P1ȋL$$D$L1ȉD$D$pD$D$pL$ T$\$,LHk71 L=D$4T$DL$@D$d$L$hL$T$lT$\$\$ D$D$PL$d $T$hT$\$l\$l$l$ [D$@L$P1ȋL$$D$D1ȉD$D$pD$#D$pL$ T$\$4Hk11 L=D$ T$vq 7vq 0vq )vq Rs-e ;aD$L$ 3DHҋHЉۋH1‹H 3A\$1؉DHۋH؉H1ËH 3A1ЉDHҋHЉH1‹H 3A 1؉DHۋH؉H1ËH 3A1ЉDHҋHЉH1‹H 3A1؉DHۋH؉H1ËH 3A1ЉDHҋHЉH1‹H 3A1؉DHۋH؉H1ËH 3A 1ЉDHҋHЉH1‹H 3A$1؉DHۋH؉H1ËH 3A(1ЉDHҋHЉH1‹H 3A,1؉DHۋH؉H1ËH 3A01ЉDHҋHЉH1‹H 3A41؉DHۋH؉H1ËH 3A81ЉDHҋHЉH1‹H 3A<1؉DHۋH؉H1ËH 3A@ID1ىL$1ЉD$+se ;aD$L$ 3ADDHҋHЉۋH1‹H 3A@\$1؉DHۋH؉H1ËH 3A<1ЉDHҋHЉH1‹H 3A81؉DHۋH؉H1ËH 3A41ЉDHҋHЉH1‹H 3A01؉DHۋH؉H1ËH 3A,1ЉDHҋHЉH1‹H 3A(1؉DHۋH؉H1ËH 3A$1ЉDHҋHЉH1‹H 3A 1؉DHۋH؉H1ËH 3A1ЉDHҋHЉH1‹H 3A1؉DHۋH؉H1ËH 3A1ЉDHҋHЉH1‹H 3A1؉DHۋH؉H1ËH 3A 1ЉDHҋHЉH1‹H 3A1؉DHۋH؉H1ËH 3A 1ىL$1ЉD$ se ;avQD$ $otD$L$$T$D$"D$ L$rD$L$D$$L$(se ;aR$IoD$L$Q7D$^ 9t$T$D$HtD$HH_ 9t $T$D$tD$H_ 9t $T$D$ftD$H_ 9t $T$D$>tD$H _ 9t $T$D$tD$D$ L$ $L$L$L$ L$D$D$$D$(D$,Í$L$4oD$ L$D$$L$(D$,#se ;a D$4d$软oD$L$(D$^ 9t$T$D$H*tD$HH_ 9t $T$D$tD$H_ 9t $T$D$tD$H_ 9t $T$D$tD$H _ 9t $T$D$tD$D$L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$D$D$sIe ;avs$D$D$ 3D$D$( _ ȉD$ w{$D$TD$D$D$ D$NzD$L$D$,L$0$sqe ;a4|$1s `& $T$8T$~oL$ T$T$L$ `&L$$T$(L$, L$0 d $D$7L$L$D$ D$VMzL$T$T$\$,9~09t$D$\$gsD$ D$4D$8D$<$É̉É>s뷍s .sD$,|$0D$4T$8L$<$D$4l$8T$<$Q2v=_ >-PQ$tP11ld hd D$4L$8D$<$Zq Zq Zq Zq se ;a<c 3 $D$D$蛰rD$L$ T$c -c 9uL$4T$09t $l$\$sD$@$D$DD$D$HD$D$LD$ D$PD$D$TD$D$XD$CD$$L$ T$T$8D$0L$41l$($)؉!ȉD$D$t$ D$D$t$D$(hD$8L$,T$4\$0؉ыT$8\$,@}s99v}\$,1σrk $D$D$D$ L$T$D$\L$`T$dD$hD$l-q 7-q 0-q )-q "-q -q -q -q -q ,q ,q ,q ,q ,q ,q ,q ,q ,q ,q ,q ,q ,q ԰se ;a4D$8L$TYt$@9|$D)߉ۇ!|$<L$(9t$l$D$@sD$(L$HT$L\$8l$Pt$@|$DD$,1D$D$,uT$8$D$L$t$ D$P)؉!NjD$Hlj|$)l$\$D$L$(T$H\$Ll$8t$P|$@щډ|$DD$D$(L$99))ω|$$D$ۇ!|$<|$9L$ $D$t$D$$D$ )ۇ݋t$!l$Ht$)T$L$D$ L$@9w:)\$D)É!؋\$<؋|$T\$<ߋl$L94+q +q +q +q 诮se D$;AV|$l1s$$9#)ˉ\$4$)͉l$8ۇ!ꋬ$ꉔ$D$d1D$(1D$$D$d0|C$$$\$(T$$$\$4\$(9}GT$$$9z9yz9nz9c$<:9rPL$P$D$\1D$,D$\D$l$$L$T$4T$\$8\$ $l$$t$$|$$\$]D$,$$\$P$$$ً$$$$$D$,$T$,$9:ы$9UT$L)!ڋ$ڋ\$L)ޅ'99t$l$L$sD$l$$L$$T$$\$ $l$t$4t$|$8|$$\$?D$,HT$Pʋ$9$)͉ۇ!鋬$)|$89V9~)Ӌ$9+ $l$T$sڋ\$Pщˉ $D$T1D$0D$TT$L$L$t$8t$$)׉|$Hۇ!׋$׉|$ |$L)l$l$Hl$\$rD$l$$L$T$4T$\$8\$ $l$$t$$|$$\$D$0$$$$t$P$$$$D$0$\$09;O|$L9|$ \$L\$L\G9Nt$H!ً$9|$D\$@,$D$T$$)߉|$<ۇ!ߋ$߉|$ |$@)t$t$e ;avV $[oD$@@@  d e u d Í=d :s賛se ;av)D$L$D$ AD$AD$D$pse ;av;D$} 1D$ ËD$$D$D$nD$ se ;aHsd $D$D$D$L$D$L$T$ \$tD$XD$\T$`\$dHËT$L$T$PT$T$TT$L$ D$D$ L$$T$@\$DD$XL$\T$`\$dH@s;e ;aPsd $D$D$D$T$D$XD$D$\D$D$`D$ L$dL$ D$ L$$T$@\$Dt T$h\$lPÉT$H\$LT$`$T$dT$D$L$ 9 D$t T$H\$L뽋Hd Ld cs.e ;avs4D$<$D$@D$D$ L$$T$(\$,l$ u;} D$D4Ë\$8+9}C9}ًK9D$D4Ƙsqe ;a\D$l$D$pD$SD$0D$XL$,T$\$l$t$ |$$D$(D$LD$D$HD$ D$DD$tnl$t\$xT$|DŽ$DŽ$$D$D$D$H$$$D$L$$D$X$\ÉT$@\$T$D$ @WD9D7D$ʃ @O(9D7G )9m1N1-$L$\$T$ 7rD$L$T$0Ÿ))@|9w L$8D$<(Bq ; q 4 q - q & q  q  q  q :se ;aDD$L}Ed d D$PD$TD$XD$\D$`D$dD$hL$lDËL$H$uQ$uQ6 T$#ȉ$\$D$D$ {D$L$A 111111҉T$01҉L$@D$,l$s e ;a$D$($D$,D$D$0D$D$4D$ D$8D$4AD$dQD$D$L$ $|T$D$D$ L$詒rD$L$D$ D$'y>?D$&A*y?QYAAD$%AD$$AD$#AD$"AD$!A D$ A D$A D$A D$A D$AD$AD$AD$AD$AD$AD$AD$AD$AD$AD$AD$AD$AD$AD$AD$ AD$ AD$ AD$ A D$ A!D$A"D$A#D$A$D$A%D$A&D$A'D$A(D$;A)D$:A*D$9A+D$8A,D$7A-D$6A.D$5A/D$4A0D$3A1D$2A2D$1A3D$0A4D$/A5D$.A6D$-A7D$,A8D$+A9D$*A:D$)A;D$(A<D$'A=D$&A>A?kj$D$e L$ td $D$ʫe L$uq td U$D$D$D$ D$XyD$L$Јd e u Ԉd UPe Í=Ԉd 蝃s=td 莃s농=td sJkse ;avJD$$L$L$D$?nD$ L$ $D$D$ nD$ D$kse ;av&D$T$8uJ@9D$ 1Ckse ;a<e $te D$$WD$pD$@HT$D$ыD$L$\D$L$ $sd \$L$D$ woD$u{$sd D$D$ D$D$D$ 0{oD$L$@e u%T$DP $T$D$!p<ÍxD$D諁sҐqp<ËD$ D$,D$D$0D$4D$80$L$,L$woD$L$ D$4L$8$D$2D$4D$D$ D$yD$L$D$$L$(0$D$$D$oD$L$ $L$p 0$D$p 0$D$p 4ise ;a@e $te D$$WD$iput sd L$ |$14s  $L$ L$L$L$RDo-D$D$D$L$HL$\$L\$*ՍD$$FoD$uːp@Ðp@Rhs-e ;aHe vu`p He "t}z2oe $u8 sd 2oe $u sd He Í=sd 5s=sd &sgsZe ;avD$HD$L$ ggse ;av( D$$ʕnD$L$D$L$ !gse ;av# D$$D$L$D$L$ fse ;av(D$$D$D$D$ D$nfse ;av# D$$D$D$ Ffse ;av D$rtnC fse ;avY ,$%o|$D$Ge u(D$|$L$|$|D$D$ ËD$'}sese ;av*Ge vup Ge Ge Oese ;avBD$$L$L$nD$L$ $D$D$xnD$ D$dse ;avbD$HT$Z*09t*1Ʉt HZ9R @ 9!ȈD$1,$t$\${nL$ D$T$gdse ;av<c c c d d e ud Í=d {s dse ;aod $D$D$D$ @tEvOI@T$$T$T$(T$ $ЋD$ L$T$\$D$,L$0T$4\$8Ë d d 4p ]csXe ;avX(D$,$D$0D$D$4D$D$8D$ D$`sT$$-`sO ω.L`szDM`sY_sgjHse ;a(೹$o|$Ge  e|$$G$ e IV+G MGD $oD$ `' e L$,HL$$ $D$D$ $ \L$D$D$ D$ L$D$H~D$ $ L$D$D$ D$ @L$D$~D$ $D$D$D$ D$@׻D$D$}D$$D$0(ÍxD$,N^sT$$=^sO ωV+"^szDM^se^sgzFse ;aG(೹$)o|$Ge   g|$$G$ e  G MGD $oD$ , e ulL$,HL$$ $D$$úD$D$LD$ D$D$=D$D$ iD$$D$0(ÍxD$,\sT$$\s낍O ω \szDM\s&g\sEse ;a$D$kD$D$ ೹ $o|$Ge  k|$ G$ e upaOG D$GD $IoD$ 1 e uL$HL$ L$ÍxD$[sT$ [sՍO ωaO[szDD$w[s{kg[sFCse ;aB$೹$o|$G e  W|$ G$ e puG MGD $/oD$ 3 e ugL$(HL$ $0D$$TD$D$OD$ D$FD$D$?yD$ D$,$ÍxD$(DZsT$ 3Zs뇍O ωpuZszDM Zs+WYssBse ;aB$೹$o|$G e  |$ G$ e (G MGD $oD$ 8 e ugL$(HL$ $D$$TD$D$OD$ D$FD$D$?NxD$ D$,$ÍxD$(XsT$ Xs뇍O ω(XszDMXs+XsAse $t;Ad BD$|L$\ $oպT$D$D$D$XL$ $T$\$IκT$D$ňD$L$ $$T$XT$L$D$ D$|D$>D$D$PL$L$l o $oD$D$`$ $D$$D$D$tD$L$ T$\$tWKML$hT$L$$D$$\D$D$etD$L$T$ \$tIT$t\$T$$lD$$D$D$tD$L$ T$\$tCD$HL$dT$L\$T|$`We T$h_ e T$tWGe O<$sD$D$x$1VsD$P$L$xL$L$l $Ѝt$$f[sD$@L$DL$p$$G[su獴$5[s t@lW׉ÉUsUW׉ŋD$tnUs&‹D$hZUsDŽ$DŽ$0$x$$$D$D$d=D$HL$dT$L\$T}DŽ$DŽ$0$ X$$ $D$D$=D$HL$dT$L\$TDŽ$DŽ$0$ P$$ $D$D$I6$h$;ۄD$$úD$D$譑D$ L$T$D$`@D$<1 \$X4ى‰L$XT$8$0Rs$$0RsD$dD$h0$$L$ nD$L$ D$dL$hD$d$D$D$莠yD$8@L$<9fdËD$`HL$<1111L$X4‰ȉ߉D$XT$8\$,l$\t$0$Qs$$Qs  $nD$$$H e n$$H e :P$$H e P$$Pe H$$P$e H L$,Q\$09Cl$\ IDD|֋e DD$8@L$<9t$,l$\ud 0  $D$3D$ǀ@X e  UHTD$D|$l5Ps$L$lL$D$D$ D$,~HL$\1 \$T ى‰L$TT$<Yit$D4$D$\$l$ D$<@L$,9|D$D$dÍxTUQJsSEJsD$P@$l$\l$L$\$ T$ rl$D$\$PD$PL$,x ‰IsUx‰Is xIsxIsljIs11VtB‰$L$趼p $D$証p a1sLe D$;ABD$hL$\ $oպT$D$yD$ D$lL$L$XT$\$IκT$D$yD$L$ T$l$T$XT$L$D$ D$hD$/D$L$$L$P$Rt{$1vIsL$P(\$T$,$эt$ $MsL$DL$TT$H|$x$MsL$Tut$xMsthAaD$d\$`T$LD$pD$t0D$pD$tD$p$D$D$-0D$dL$PT$L\$`$ $T$ܺp p /s9e $;AJL$x$1JHsL$xT$h$$ԄL$ $ TL$D$qdL$L$tT$ T$l\$\$`l$l$T$$0t$p@D$X0D$h$ oպL$D$wD$D$dL$ $T$h$IκT$D$QwD$L$ $$T$dT$L$D$ D$xD$2-D$D$|L$T$\$Tl$l΋Madmiu MnuMuserMmanaMfgeMrt4D$`L$tu獴$=Ks$Ĭ@$1Fs,T$pT$T$XT$0T$ D$4$э$t$|JsL$PL$tD$L$$JsL$taD$`L$tTD$`L$tGD$`L$t:$T$\$<1Es0\$p\$l$Xl$-l$ D$4$э$<t$|3Js$$< Js$1EsL$\0T$pT$T$XT$0T$ D$$$э$t$|IsD$LL$PL$t$$IsL$tS$t1Es,T$pT$T$XT$T$ D$4$э$tt$|WIsL$PL$tD$L$$t8IsL$tl$lDŽ$DŽ$0$$$$D$D$+|DŽ$DŽ$0$ $$ $D$D$]+$L$tT$l\$`l$T$L$p p *s0e D$;AmBD$PL$D$>$Z\$,T$H} $oպD$D$sD$D$@L$ L$\T$D$IκT$D$rD$L$ T$\$T$@T$L$D$ D$PD$(D$D$0L$L$LR$0nPc L$L$`@,Tc \\$D$$ЋD$L$ L$<$1~BsD$<$$n$D$X " $D$ XL$D$ :o|$D$,Ge 8D$HD$X$$D$`$|$L$0ITL$<$FsL$L $L$<ыD$$L$(txt@DŽ$DŽ$DŽ$DŽ$0$h$$$$$D$D$(D$` R $D$D$D$ XD$D$蜠D$D$TL$L$4T$ T$8\$$l$(txt[DŽ$DŽ$DŽ$DŽ$0$ p$$$$ $D$D$'$D$TD$D$4D$D$8D$ \/rD$L$D$dL$hD$lD$p0$D$dD$6nD$L$ D$lL$pD$l$D$D$躒yËD$H>sD$tD$x0D$t `L$xL$t $D$D$'L$D:D$|DŽ$0D$| $L$| $D$D$&$D$PL$D苢p $&soe ;avfe vuʥp e 7"( ~VzT?w_(E\PFe #&se ;aS,L$0BD e "NB@LHT$$D$($D$$D$D$D$  zD$0 $ oպL$D$ 0L$ (T$)D$0 $ L$D$ 0L$ 0T$D$0 $ GкL$D$ 0L$ 8T$D$0 $ W2L$D$  b;T$ _ щL$脕D$0AHA, e UQ(A4e A0 $ L$D$ TD$D$ 0D$@D$ $D$D$D$D$ D$pyD$0T$\$ $T$\$rTD$0@p,Íy01h;sSy(UQ;s z@N<;s#se D$;A$$1τD$D$,$T$($oպ\$D$-Il$ D$-l$D$-l$D$ |ZD$,$ IκL$D$HT$ D$T$D$bT$D$ (ZD$,$D$D$ KL$ D$D$D$ L$D$ "Y$$΄D$$oպD$D$YD$($ oպL$D$t$$̈́D$$IκD$D$D$($ IκL$D$s$$̈́D$$D$D$øD$($D$D$s$$=D$D$\$ $QD$D$X$ $8D$D$T$ $!(D$D$P$ $躓D$D$L$ $蓵D$D$H$ $D$D$D$ $D$D$@$ $D$D$<$ $xD$D$8$ $D$D$4$ $D$D$0|$`18sD$\D$`D$XD$dD$TD$hD$PD$lD$LD$pD$HD$tD$DD$xD$@D$|D$<$D$8$D$4$D$0$$$D$`D$D$ D$ 㳄Đs"e ;a($kD$D$$k೹$]nD$@$^ e  ΅H @p e m hHl@4 e * H0 MHDD$ƀ e  ,DH| 0D $nD$ F e u{L$HT$Bt$L$ D$$辢D$L$tEtID$ D$$L$ D$$D$ $D$D$虉y$#w(ÍxD$5sT$ztÉ5snx|,D5s0D5sx0n5syDM`5sxlhI5sx ΅25sPse ;av) D$t ËD$$}$"w`se ;av8se ;alD$LD$PD$TD$XBL$ $A{D$ $ ^L$D$S]D$ ulËD$p$ oպL$D$΄D$ @(uҍ$onD$D$(L$ $߭T$D$D$ D$D$jD$L$tbtID$\D$`D$dD$h0T$\PT$`L$dD$hD$\$D$D$,yD$ $ L$D$dD$D$ $ L$D$cD$ L$$an|$G e <1D$$HT$DL$H 0 $T$DT$迳nD$L$ D$ L$D$ $ oպL$D$1D$$H 'D$p$IκD$D$̄D$ @(D$$H @D$d p:m /@hP.P/  /  !/ep 0(P2 p' `K ?h@2` P[O? ?p @ 0102 2P J*OP+O+O('JO c# b#[`   .!! %л%%%P#####   p`@RSSSXSTSVSUSTSZSpWS@p!'=+=&=1=2=)=<0@;k@nnnГnn`nPnn0cd@bbbpbpbb`@`۔ -*> 00@Pdfin2v3v8uPn@nn}sPssvsps zsns@uuupuu0uv hyPjymyoyrykynyy`syyyyy0yyy yyyyyyy y`yyy y@yyy@yyyy@yyypyyytyypyy`y@yy0vyyyyyyypyy`yyyzyy`|y`yy}yzyyy yyy@yPzzpzy{{{{{{ {@!{#{%{'{0({P){@,{-{.{1{3{6{7{:{;{`B{P?{@E{0G{@I{@@P??PJJ@JpJ JJpJJJpJJJJJ0JJ J0 J J JJ\? 6MMMM Mp M!M"M#M$M&Mp.M5M9M2M ;M@>@@m:p:@l:n:q: s:u:Pw:pEUFUE?  @`+;p/;SSQQQ0 @`0! $$%&P''()+0,--./01!k@61@cP5`4 }}Pi{m{j{q{ONgpm`jl@uvrvpxy@{sPfp}0Ҋ0ӊ0ЊPԊpՊ֊؊ڊ ފP{fCVp*Z|`]|@܌݌ߌ@PnCEDLp P ` p  t0vplпlll@lllll`lplrlwQO07Q8Q9Q;Q0Q^0^^p^^^`^p^^^ ^0^^^^^^^P^`^^^^^^^^*_+_,_p/_._lfPxfzfpf |f0rf@f~fЃfee ehhhh h]lpd`5ejPlj@njpjPqjPhj@rjpoj@gjij`mjd0ddDiDiEicefehedeiejele g g`gggff ddg0f0f`f ff f@MpM@MPMPMPMM`M M0MMM@a@@W0WPiW bpbbbbbbbpbPb bb S`T /`/`P0`2`p#NS@S ZTWЂNЄN0NN#Y0%Y0X@XPX@XX0XX0XXX7V8V@CVPBVP;V=VEV0DVGVIV0:V`KVLVMVNVOVPEWpFWJWJWZW@GZ HZQZ0|Z }Z@YY`8Z7Z9Z@_PZYYNPNP55522`2@O-P@ 9    Puv`}&`|&`&%&/46078APBK3?:....Я..0...`..p. ...@..`.`....P.@..0. ....p.///. /P. /..//X'>>@(5&-10Ѓ `    `;Х;@cJ@eJE G`(P0 0*0Џ p       ` p      P Ф  0  p  0     Ќ   @ ppS^p^P^ `^pMMPpL?0IpZO 1`5!/0д   ` P  p gJ   Ј ;JW70PP@   .0/1p(@(((л(j(n'P/2  -02wN   P8m` 9mP?Ф6@ z  GU@^0(m@Rmgd@N PV  Ц 1bb` @160 `4=w@x:ຓb@ ` zxM tp2;P0HUp2 `:m"b0=&:3/ n'0y:  K?L?pSm@IU6&`+(tt0JU\W >pd 9m/Ph-P@/ /0   / e н(2 o' K @?Ph2 ZO0?  ?  о122 P `J)O*O+O`('IOb#a#p[P P ` p.!0!%p%P% %####@#P p  @QSRS@XSTS@VSPUSSSYSVS`!0'=+=@&= 1=1=`)=@;00?; kn nPnpnnnnpn@c db0bbbPbbP@৓p۔p,*>Хd0fhn2vP3v7unnn}srsPvsPosys`nsu@uuuuupvgyjylyoyqypky0nyysy0yy0ypyyPyyЛy0y0ypyyPyyбyyPyyжyypyyyPy`yyy0ypy yy0yptyy yyyyyuy@yPyy0yyy yyyPyyzyy|yy`y}y@z0ypyyy@yPyyzz zy`{p{{@{@{{{ {`#{`%{&{'{ ){+{`-{.{0{2{`6{7{P:{;{B{?{E{G{I{@@??J@J JJJ0JJ0J JJ@J@JPJ JJJ@ J J JpJ@J\?` 6`MM`MPM`M M!MP"M0#M $M &M-MP5M9M@2M:M;M@=M7M+MiM>M@M6M3MPDM/M@GMpHM@IMJMAM`)M,MiMjMkMlMmMnMoMppM0M NMPM SMTMUM@VM WMPXMYMpZM`[M\Mp1M]M`MaM%M cMeMgMqMsM@??{0I I0III@IIPCpCC`CеCCPCKp{j`mlF6PH6 I6I660+6.6666bNNpNtt0t__P___?@ DB08p188 7c[;];Z;>>P l:p:k:n:q:r:u:v:EUEUE?0@`@+;.;@SSPQ@QQP0p #$P%`&''P(p)*+,`-.`/@0`1 !`j501b44}}h{`m{`j{p{`OM@gliktu`rvw yz0se}@ъҊ@ϊӊԊ ֊׊ي܊`@{e CpV*Z|]|یp݌ތ00@0p`m0C E0D Lp   pptuPplpl`l0ll@lPll`lllPrlwQPO6Q7Q9Q:Q;Q>QН^Р^p^^P^^^Ъ^0^^^в^@^0^0^ ^^^^^p^^^`^p^^^p*_+_,_/_-_plfwfyfPpf{fqff@~fpfpeeehphhphh@]ld5djkjmj pjpjgjqjnjfj`ijmjdddCipDiPEiceee@he0de`ie@jeke`gggg0g0ffdd`gfЍfff`ffMMMMMMpMM`MM`MPM` WЇWhW0 bp bb`bbbb@bbbb bST.``/`/`1`"N0SSYTWPNpNNN #Y`$YXXXXXXXXX@X07V@8VBVAV:V =V0EVCVFVpIV9VKVLVMV`NVPOVDWFWIWpJWYWFZGZQZ{Z|Z YY8Z 7Z8Z_ZPY@YNN5@552 22OP-P@P P9  `  t0v|&|&&@%0&P/@4@60007 8@AJP2`?:`.P. ..`.P..... ....p.. ...`.........`.0...@//0. /./.@./p/W'>`>(@5&p-0/@  0   ;p;bJdJEF(p00@*00  @ @   p P   @ 0    ` ` P    0    0  `  @   S`^^^^0MML?HYO0`P5!/     и  fJp 0  p ;J0W70` `  ` @.@0/01(( (0(p(i( n'ABCDEFGHIJKLMNPQRSTVXYZ_abcdefghijklmnopqrstuvwxyioos.FAtCbCcCrDBDoDpDqDxDyEqFDFdFnFsGoGxGyHiIDIOIPIdInLBLoMXNSOSOnOpOrPCRWToTrTxUpV7a1a2acarasatb3bcbobpbrbsbwcbcccechcmcpcsctcwdbdcdidodpdreceeeqerfcfdfffhfiflfmfnfpfrfsfwg0gpgsgxgyh1h2hdhfhihlhshzidinipisitivkakpktl1l2lklllnlolrlwmWmdmhmimpmrmsmumwnNnbndnlnsnxoboiokonoporotowpapcpdpepfpmpoppprpspwq0q1r1r2r3r4r5r6r7rbrcrdrergrirnrorprsrtrws0s1s2s3scsdspsqssstsvszt1t2tatbtctdtftmtotqtrtttwtxuautvdvevrvsvtvwwdwewgwqwrwswtzrzwfmtlognetAbsAccAckAddAllAndAnyArgAtoBitCCCCGICapCmpColDayDelDevDirDivDocDstDupETAEndEnvErrExpGCDGIDGNUGetGidHasHexIAMIDsIPPIncInoIntInvIovJarKeyLOGLenLogLshMACMDCMTUMapMaxMinModMsgMulNFdNegNetNewNotNowNumOffOldOneOutPIDPTRPadPctPidPixPopPosPubPutQosQuoR16R32RatRawRefRemReqRowRshRtoRttRunSIDSSHSSLSecSeqSetSigSrcStrSubSumSysT2dTLSTTLTXTTagTo4TopUIDURLURNUTCUidUseValVarXMLXor_g__p_absaccackaddalgallaltandargarrb64badbbbbdpbitblkbssbufc1bcapcascatccccfgcgocmdcmpcnfcntcolcrcctrctxcurcwddecdefdirdivdocdotdstdupeaxebpebxecxediedxeipekmencendenveoferrescesiespetmexpextfinfmtfrefsmfungcwgetgotgs2hashdri64idsidxifnincinditlkexkeykvsledlenlexlfslitlnsloclogloslowlutlvlmOSmacmaxmdsmemminmkpmsgmu2mulmutmuxnegnetnewnopnotnownssnudobjoffoidoldopsoptordoutpadpatpcspfdpidpinpopposprfptrpubputrawrdrrefregreqresretrpcrstrttrunrwcrwss2ks64secsemsepseqsetshlshrsigsizsp1sp2sp3spcsqrsrcsrvstkstrsubsumsymsystabtagtaptfntlstmptoktoptrltryttltypurlvalvecwidwinwmuxorflaghashmimepathsortsynctime*intAAAAACKsAddrAlgoArgsAtimAttrAuthBackBaseBitsBlobBodyBoolCallCertCmdsCodeCondConnCopyCoreCostCredCtimCttyDataDateDeclDescDialDiffDocsDoneDropEachElemEmitEnumEnvsExitExprFailFileFindFireFlagFlowFormFreeFromFuncGIDsGRPCGetJGetWGlobGrepGrowHTMLHaltHashHeadHelpHintHostHourINFOIPAMIdleInfoInitInstInt8IntPIntnIqmpIsCAJSONJSetJoinKeysKillKindLangLastLeafLeftLessLineListLoadLockLogfLogsLongLostMACsMBoxMapTMaskMeanMetaMmapModeMoreMoveMtimMyIDNArgNCPUNackNameNanoNextNodeNsecNullOnceOpenOptsPackPagePathPeekPermPgidPickPingPipePlayPmtuPortPostPrecPrefPrevPrivPropPullPushQinvQuitRGBARandRdevReadRectRecvRefsRepoRespRoleRootRowsRunERuneSASLSHA1STARSaltScanSealSeedSeekSendSetBSetLSetMSetNSetSSignSizeSkipSortSpanSpecSqrtStatStepStopSub0SwapSyncTag1Tag2TagsTailTaskTermTestTextTimeTo16TreeTrueTypeUIDsURIsURLsUUIDUintUnitUnixUsecUserVarPViewWARNWaitWantWarnWhatWhenWipeWireWrapYearZeroZoneacbwacctaddraeadalgoargpargsargvattrauthbackbasebiasbig4bitpbitsbodyboolbptrbufpbufrbufwbusybytecallcapscbufcellcertcidrcmdrcodecollcompcondconfconncontcopycostctxtcurgcurrdatadatedeaddescdialdictdirsdiscdivWdonedowndropdumpdupsebssecdhelememitentsenvveofcepfderrCerrcerrsexprfailfdmufeedfilefillfindfintflagflowfmtBfmtCfmtPfmtQfmtSformfreefreqfromfsetftabftypfullgctxgetcgidsgoidgoodgoosgopcgrowhBufhEnchandhashhbufhdecheadheaphenchighhisthmachosthtabhtmlhuffidleidocimg1img3infoinitinstint8intrintvinwbipadisOkiteritoaitypjfifjobskeyskidskillkindlanglastlazyleafleftlesslinelinklistloadlocklogfloopmakemantmapvmarkmaskmhdrminvmmapmodWmodemoffmonomoremsgsmtypmustnamenbitnbufncgonewgnewmnewsnextnicenicsnilvnobjnodenormnotenretnsecnsrcnstkoiwsoldponceopadopenoptsorigovflpRowpackpad0parkpathpclnpcsppeekpickpingpipepluspoolportpow5precpreqprevprivprogptabpubcpushquitrEMArandrcvrrdChreadrecvrefsregsreplreqsrerrrescresprootrowsrulerunerunqsaltsamesavesbrkscChscansctssealseekseensemasendsentsesssghisidesignsinksizeskipsortspansqrtsrcsstarstatstepstopsubcsubssumssynctEndtPostRowtagstailtaketccctemptermtesttexttimetinytmpltopotreetrietrimtvaluadducmpuidsumulunituquourisuseduserusubutoavalsvarpvarsversviewwaitwakewalkwallwantwbufwerrwhatwhenwirewrChwrMuwrapxy2dzerozerrzlibzone`P`P` P `P$`P(`P,`P0` P4`$P8`(P<`,P@`0PD`4PH`8PL`?Jjp_     @ "$&/0x<` = @N \`$tz'( H*,-046$7(8@F<Xdj@ABCD| HL NP  TPh!`Xr Z\` d ,lD npqptxt. x~ <90>?Jjp_     @ "$&/0x<` = @N \`$tz'( H*,-046$7(8@F<Xdj@ABCD| HL NP  TPh!`Xr Z\`bufiobytesimage**int*bool*int8*uintAddOpAddedAddrsAfterAgentAlignAliveAllocAppIdApplyArrayBasicBatchBeginBoolPBuildBytesCNAMECRC32CacheCanonCauseCflagChdirChmodChownClassCleanClearClockCloneCloseCoeffComboCommaCountCrc32CredsCurveDEBUGDailyDebugDelayDeltaDenomDepthDocIDDrainERROREmailEmptyEntryEqualErrorEventExistExtraFATALFatalFetchFieldFilesFirstFlagsFloatFlushForceFrameFreesFrontFstatFsyncFuncsGCSysGetIPGnameGroupHalenHasFPHasVXHavesHooksHostsHoursIPNetIPVarIdentIdrssIflagIndexInfofInfosInnerInodeInsetInt16Int31Int32Int63Int64Int8PIsAbsIsAckIsDirIsErrIsInfIsIntIsKeyIsNilIsSetIsTagIsrssItemsItersIxrssKeyIdKindsKnownLabelLevelLflagLimitLinesLinksLocalLogKVLoglnLowerLstatMagicMajorMapToMatchMergeMinorMkdirModelMonthMutexNFlagNamesNlinkNoAckNodesNonceNotesNswapNumGCNumInNvcswOflagOnoffOrderPanicParsePatchPausePreadPrimePrintPropsProtoProxyPrunePurgeQueryQueueRCodeRLockRangeReadyRefIDRegexReplyResetRetryRightRolesRootsRoundRouteRune0ScaleScopeServeSetBSSetFsSetIVSetIdSetNSSetSSSetupShellShiftShortSinceSliceSpaceSplitStackStageStartStateStatsStdinStimeStoreStyleSum32SwarmSysfdTRACETasksTimerTitleToMapTokenTopicTotalTouchTraceTreesTypesUSTARUint8UintPUnameUnionUpperUsageUtimeValidValueVarPFVhostViperVisitWantsWarnfWatchWidthWriteYCbCr_Func_byte_func_typeackIDaddedaddrsafteragentaliasalignallocaltMuapplyarenaarrayasDocatEOFatEOTatEndbatchbfreeblockboolvboundbuiltbwMaxbytepbytesc2wopcachecallscbindcertschainchanscheckchmodchunkclasscleanclearclockcloneclosecmKeycode_codeccodesconnscoptscountcredscsMgrcsemactypecurvecycled_tagd_valdatapdelaydelimdeltademuxdensedepthderefdialcdiffsdirtydisksdocIDdonecdoptsdraindyingedataehashemptyentryequalerorrerrcherroresizeetexteventevictexpNNexpWWextrafCallfailffaultfetchfieldfilesfinalfiredfirstflagsflowsflushfmtBxfmtQcfmtSxfoundframefreemfreesfunc_funcsgcbssgenIDgfreehash0haveshdrMuheap0heap1heap2hellohostshunksidentinbufincIVincgoindexindirinfosinnerinputinstrint16int32int64interinuseis224isDSTisDirisMaxisNilisRGBisRSAisRTLisSetisptrisstdisutcitemsitersivLenivTagjsCtxkeyOplabelladdrlaneslargelevellimitlineslinkslocallocksloopylportmagicmajormarksmatchmaxIDmaxpcmayBemdatamergemidleminorminpcminusmnextmodesmtimemtypemultimutexnCompnLeadnLinenbitsnbytendonendotsnetGonewChnewIfnewTrnextpnfreengsysnmsysnodesnoncenpagenprocnreadnrunenumgcnwaiton100oncesoneoforderouterownedpairsparamparsepatchpathspcbufpermspidlepingsplusVpreadprobeproofprotoproxyptrToquantquestqueuequotarLockrNextrPeakraddrratiordPosreadyrecvqrecvxregexreqMureqchresetreuserightrlockroundrouterportrsemartyperunessLastsRatesavedscanpscerrschedsendMsendqsendssendxseqGCservesetFhsetIdsetupsharpshiftsigMusiglrsigpcsigspsinfosizersleepslicespacespansspinesplitspropsreplss_spssavestackstartstatestdinstorestylestypesuitesweeptLasttMarktabletconntflagtimertimevtlisttokentotaltracetreaptreestrunctypesuint8uintvunrefunsetusagevTypevaddrvalidvalueviewsvlogfwLockwbBufwbuf1wbuf2widthwrPoswritewsemaxmlnscryptoerrorsexpvarregexp**bool*[]int*error*int16*int32*int64*ssh.F*uint8AcceptActionActiveAdvmssAndNotAnswerAppendArrayTAssignAuthorBeforeBinaryBitLenBlocksBottomBoundsBoxAddBranchBucketBufferBySizeCACertCMYKAtCPUSetCallerCanSetCancelChangeChksumChrootChunksCipherClientCloserCmpAbsColumnCommitConfigCookieCountPCountsCreateDebugfDecodeDeleteDelimsDetailDialerDigestDivModDoChanDomainDoubleDriverEncodeEntityEqualsErrMsgErrorfErrorsEventsExistsExitedExpandExpireFailedFamilyFanoutFatalfFchdirFchmodFchownField1Field2FieldsFilterFinishFirstNFollowForgetFormatFprintFramerGetAllGetEndGetGetGetIntGetKeyGetLenGetPutGetTtlGetValGetWebGetenvGlobalGoAwayGrayAtGroupsHandleHasADXHasAESHasAVXHasDFPHasFMAHasLenHasMSAHasSM3HasSM4HasSVEHasSigHatypeHeaderHeightHiddenHijackHostIDIPMaskIPNetPIPVarPImagesIndentInfolnInjectInlineInsertInt16PInt31nInt32PInt63nInt64PIntVarInvokeIovlenIsAMQPIsBareIsDoneIsFileIsLastIsNameIsNoteIsUintIsZeroIspeedIssuerKeyErrLabelsLastGCLatestLaunchLayoutLbraceLbrackLegacyLengthLevelsLingerListenLocaleLockedLoggerLookupMajfltMaxAgeMaxCapMaxKeyMaxrssMedianMethodMinKeyMinLenMinTTLMinfltMinuteModuleMountsMsNameMsTypeMsgrcvMsgsndMunmapMutateNegateNewCTRNewDayNewGCMNextGCNivcswNoWaitNocttyNodeIDNoticeNotifyNowaitNullOKNumCapNumOutOSTypeObjectOffsetOpCodeOpaqueOptionOriginOspeedOutputPackedPanicfParamsParentParsedPeeledPointsPolicyPreRunPrefixPrimesPrintfProbesPtracePubKeyPublicPwriteQuoRemQuotedRGBAAtRandomRbraceRbrackReadAtReaderReasonRecentRecordRegexpRegionRejectRemoteRemoveRenameRenderReportResultReusedRotateRouterRttvarSSLSetSackedSampleSchemeScriptSearchSecondSecureSelectSerialServerSetBitSetBufSetCapSetGetSetInfSetIntSetKeySetLenSetMaxSetMinSetPosSetPutSetRatSetRefSetTagSetenvSetsidSharedSignalSlice3SliceTSourceSpanIDSparseSpreadSprintStagesStart1Start2StatusStderrStdoutStorerStreamStrictStrideStringStructSymbolTagRPCTaggerTargetTaskIDTimeOKTitlesToHostToJSONTopicsTracedTracefTracerTracesTrialsURLForUint16Uint32Uint64Uint8PUniqueUnlockUnreadUnusedUpdateUpsertUserIdValuesVerifyVolumeWarnlnWeightWindowWorkerWriterWritevXattrsXpixelYpixelZoneId_defer_panicacceptactionactiveactualaddSecaddTLSaddrChaesKeyallocsanchorandNotappendarenasargLenarglenargmaparrkeyasMDocasciiFassumeatomicattachattrNSbackupbdpEstbeforebinlogbitLenbitmapblocksboundsbrokenbrokerbucketbufLenbufferbyAddrbyNamecallIDcalledcancelchainschrootchunkscipherclientclosedcloserclosescolumncommitcommonconcatcondfnconfigcreatecurEndcurReqcursorcutoffcutsetcyclesczDatadcachedebugfdecodedecompdecrefdeletedeltasdialIPdialerdigestdivMuldivmoddoCalldoReaddoScandomaindynTabe_typeecacheeequalefenceeflagselemOpencodeendTopeobRunerrorferrorsescapeetypeseventsexitedexpandexpectexpirefAlignfactorfailedfamilyfield0fieldsfinderfinishfixLenfloatvflushFfmtSbxfnoncefolderfollowfooterformalformatframerframesfuncIDfuturegc_sysgcdatagetEnvgetOutgetRefgetURLgflockgoAwaygroupsgrowByhAlignhandlehangulhasRTLhashedhasherhashesheaderheighthelperhelpgchijackhlSizeidleAtidleMuiflagsignoreinListinReadincSeqincrefindentinflowinlineinsertint31nintbufiovecsisBidiisDoneisFileisFreeisGRPCisGlobisRootisSeenisSentisYesCisYesDisZeroisdoneitemsvivSizekaTickkeyLenkeyTaglabelslayoutleaveslegacylengthlevelslexInflexKeylexNanlflagslinenoloaderlocabslogAllloggerlookupmacLenmanglemappedmaxWidmaxlenmcachemcountmedianmemorymethodmissesmodelsmsgLenmunmapmustBenCodesnbytesnchunkneedednegatenelemsnestedok,%ok,%netCgonewDotnewEndnewNilnewestnewvalnextIDnextTonextidngfreenistIDnmidlenoCopynoscannotEOFnotifynpagesnpidlensnamenum1xxnumCapnwriteobjectoffsetokVerboldestoldvalonDataonReadopAddropaqueopcodeopenedoptionoutbufoutputpallocparamsparentparkedparsedparserpcfileperiodpflagspickerpollerpopEOFpreRLEpreRunprefixprintfprocidproto3ptrbitpubKeypushNspwriteqcountquotedrandomreadFnreaderreasonrefillrefineregexpopremainremoverepeatresizeresolvresultreusedreviserotateroundsrouterroutesrunAllruneAtrusagerwlocksBytessamplesawEOFscChanscalarscasesschemescoptssearchsendersentAtseqNumseriesserveGserversetBitsetErrsetLocsetRefsetTagsetVarsha512sharedsharpVshift2shrinksignalsignerskipWSslicevsotypesourcespanIDsparsesrcBufsrcEndsrcPosstate1statesstatusstderrstdoutstickystorerstreamstrictstridestringsubstrsuffixsymOffsymtabsyncedsystemtBytestagLentargetterrorthreadthreshtickettimerstoBooltoLinetoNametoReadtokBuftokEndtokPostokenstrInfotracertryGettstarttv_secuint16uint32uint64ungetcunlinkunlockunpackunreadunscanunusedupdateupsertuseVarvaluesvarintvd_auxvd_cntvd_ndxvdsoPCvdsoSPverdefverifyversymvolLenwantedweightwidthswindowwrite0writeNwriterxcountyPlusXcontextnet/urlos/execos/userreflectruntimestrconvstringssyscallunicode**uint8*[0]int*[1]int*[2]int*[3]int*[4]int*[5]int*[6]int*[7]int*[8]int*[9]int*[]*int*[]bool*[]int8*[]uint*exec.F*fmt.pp*fmt.ss*func()*http.I*net.IP*net.MX*net.NS*string*uint16*uint32*uint64AcquireAdapterAddCertAddDateAddFileAddFlagAddGlobAddHookAddLineAddLinkAddValsAddWaitAddressAdvanceAliasesAllKeysAppNameArrayOKAsInt32AsInt64AtLeastAuthzIDAvgRateBackendBackoffBaseURLBindEnvBitSizeBlksizeBoolVarBooleanBoxListBucketsCOffsetCStrideCanAddrCanSignChanDirChangedChannelChtimesCiphersClassIdCollectColumnsCommandCommentCompactCompareComplexConfirmConnectConsumeContentContextControlConvertCookiesCountryCurRateCurrentDNSDoneDNSNameDSASigRDSASigSDebugGCDebuglnDecryptDefaultDeletedDeletesDestroyDetailsDialTCPDialTLSDigestsDisableDiscardDisplayDropAllDropOneDurableElapsedEmitIntEmitterEncodedEncodefEncryptEndTimeEntriesErrCodeErrInfoErrorlnExampleExecuteExpiredExpiresExtractFacketsFailureFatallnFeatureFiltersFindAllFindOneFloat32Float64ForEachFprintfGIDMapsGetBodyGetBoolGetCodeGetConnGetDataGetEtagGetFileGetInt8GetItemGetJSONGetKindGetLazyGetListGetNameGetPathGetPeerGetPostGetRoleGetRootGetSpanGetTaskGetTimeGetTypeGetUintGetWeakGotConnHTMLSetHandlerHasAVX2HasBMI1HasBMI2HasEImmHasERMSHasFCMAHasFPHPHasPathHasRoleHasSHA1HasSHA2HasSHA3HasSSE2HasSSE3HasTaskHashTagHeadersHeapSysHomeDirHostKeyIDSliceIPMaskPIPSliceISOWeekIfEmptyIfindexInblockIndexOfIndexesInitialInt32OKInt64OKInt8VarIntVarPInvalidInverseIsAdminIsCleanIsDeltaIsEmptyIsErrorIsFatalIsFloatIsInt64IsOwnerIsSetupIsValidIterateKdfAlgoKdfHashKeySizeLatencyLazyLogLeadCCCLength1Length2LoadAllLoadURLLocalesLongestLookupsMachineMallocsManagerMantExpMapKeysMarshalMatcherMatchesMaxDaysMaxSizeMaxTimeMeasureMembersMergeInMessageMethodsMinPrecMinSizeMinutesMirrorsModSqrtModTimeMonitorMsInt64MustGetMustIntMustSetNamelenNetworkNoFetchNoLocalNoProxyObjectsOnErrorOptionsOrderedOrigErrOublockPaniclnParentsPassivePatternPauseNsPayloadPeersIDPendingPkgPathPkttypePluginsPointerPostRunPostfixPreRunEPreparePrependPresentPresignPrintlnProcessPublishPutItemRLockedRLockerRSABitsRUnlockRWMutexRawDataRawPathRawReadRcv_mssRcv_rttReadAllReadBitReadDirReadMsgReaddirReceiveRecoverRecvMsgRefNameRefTypeRefererRefreshRegexOKRegionsReindexReleaseRemotesRemovedReplaceReplyToRequestRequeueResolveRetransRetryInRetryerRevokedRootCAsRoundUpRunLoopRunTaskSamplesScaleBySchemesSecondsSectionSendMsgServersServiceSessionSetArgsSetAuthSetAutoSetBOOLSetBitsSetBodySetBoolSetCMYKSetCodeSetFracSetGraySetHintSetItemSetJSONSetKeysSetListSetModeSetNULLSetNameSetPathSetPrecSetRGBASetSizeSetSkipSetSortSetTagsSetTaskSetTreeSetTypeSetUintSetcttySetpgidSettingShallowShuffleSigTypeSignKeySignbitSignersSkipSetSnd_mssSocketsSprintfStagingStartedStdTimeStoppedStorageStringPStringsStructTSubTypeSubjectSubkeysSubtypeSuccessSymlinkSyscallSysnameTCPInfoTLSInfoTagConnTagKeysTagNameTagSetsTailLogTaskLogTimeRemTimeoutToASCIIToArrayToBytesTraceIDTracelnTrailerTryLockTryRecvTrySendUIDMapsURLPathUint16PUint32PUint64PUintVarUnackedUseCRLFUseLineUserSetVagrantVariantVersionVolumesWNumberWStringWaitmsgWarningWasIdleWebHookWeekdayWeightsWorkingWrappedWriteAtWriteToWrittenX__pad1X__pad2YCbCrAtYOffsetYStrideYearDayabortedacquireaddConnaddLeafaddLineaddRefsaddressadvRefsadvancealiasesalignmealldonealllinkallnextalloc_mamendedanchorsanswersappNameappnameargSizeattemptattrvalauthzIDautoFmtaveragebackendbacklogbackoffbackup2backup3badVerbbalancebaseCtxbatchesbeforesbindingblockedbordersbreakerbucketsbufLockbufPipebufPoolbundlerby_sizebyteBufbyteLenbytesAtcallHdrcallRawcallerscancelccancelscaptioncentralcgoCtxtchangedchannelcheckercipher1cipher2cipher3cleanupclenBufclosechclosewgclosingcodeLencodegencolSizecommandcommentcompactcomparecompilecomposeconfirmconnErrconnectconsumecontentcontextcopyLencountercreatedcsEvltrctxDonecurAddrcurPagecurrentcurveiddateBufdebuggcdecideddecodeDdecoderdecryptdeflatedequeuederiveddestroydetailsdialTCPdialTLSdialUDPdialingdirOnlydirinfodiscarddiskWWNdisposednsModedoCleandoFlushdoMatchdoPrintdoScanfdocrashdraineddropAlle_entrye_flagse_idente_phnume_phoffe_shnume_shoffecdsaOkelemEncelementelseEncemitteremptiesenabledencInitencOptsencoderencryptendCharendOnceenqueueentrieserrConderrOnceescapedevalArgexecuteexpbitsexpiredextractfileCRCfiletabflowIdxflushedfmt0x64fmtBoolfootersforwardfreeBuffrexp10funcoffgctracegetBasegetBoolgetChangetConngetLeafgetMoregetPeergetRunegetSizegetSlowgetpadputgetpadputgnuHashgobTypegoidgengrowinggrpcErrgsignalhandlerhasBytehasPackhashGenhasmainhdrLinehdrsizeheadersheadsUphexBytehintErrhmacKeyhostKeyhttpErrhuffSymidleLRUignoredinCountincacheincludeindentsindexedinlTreeintModeinvalidireqhdrisAboveisDepthisEmptyisFinalisInertisProxyisValidkexLoopkeyNamekeySizekeysizekpCountkvstorelReaderlastAddlastPoslatencylexDatelexTruelexVoidlibcallliterallocalIdlockedglockedmlogBodyloggerslongestmacSizemachinemakeImgmapTypemappingmarshalmaskingmatchedmatchermatchesmaxSizemeasuremergeInmessagemethodsminFreqminSizemodTimemorebufmsgChanmsgRecvmsgSentmuFuncsnameLennameOffnameoffndigitsnetworknewBoolnewConnnewDatanewElsenewLinenewListnewTextnewWithnextIntnextMacnextValnext_gcnlIsEndnlookupnmallocnmfreednoColornotifyMnowFuncnpcdatanumDocsnumLineoReaderobjSizeobjectsonCloseonErroronEvictonFlushonWriteonceErronepassopenDayoperandoptionssys sys outUsedpCenterpColumnpMinus1packMappackRunpadCharpaddingparentsparseAtparseKVpatternpauseNSpaxHdrspayloadpendBufpendingpinSlowpipereqpkgPathpkgpathpointerpopVarsportnumpreemptprehashprepareprependprevPosprimaryprivateproblemprocessptrdatapushEOFpushcntputFastrSamplerWindowracectxrawConnreadBufreadErrreadMaxreadMsgreadPosreadValreaddirreadersreadi32readi64readingreadu32readu64realKeyreceivereclaimrecoverrecvMsgrefNamereleaserepeatsreqBodyreqMaskreqSentrequestreserveresolveresultsretryInreturnsrevokedroffsetroundUproutersrowLinerstCoderunlockrunnextsa_masksamplessaveBufscalarsscanIntscanOnescannedscannerschemesscratchsectionseedPossemOncesemSizesendAcksendBufsendMsgsentEOFserverssessionsetAddrsetAuthsetDonesetKindsetMonosetPathsetSpansetTruesetWordset_eipset_espset_secsi_addrsi_codesigaddrsigcodesigmaskskipNopskippedslaveOKsocketssoffsetsortkeysourcesspanKeyspecialsrcAttrsrcPathss_sizesshConnst_infost_namest_sizestartIDstartedstartpcstoppedstoragestreamsstringsstringvstructvsubLocksubNamesubkeyssuccesssymHashsymlinksysStatsyscalltColumntagNametagSetstagSizetagsizetakeAlltakeBufterrlenterrorsadd@Padd@PtextOffthreadstimeEndtimeouttlsHosttmpfiletoBytestoClosetoCounttoIndextoInt32toInt64toLocaltoPointtoPrototoVisittopbitstophashtraceIDtrailertreeSettv_nsectv_usectypeMaptypeOfftypemapunackedunicodeunixSecurlPartvd_hashvd_nextverHashversionvisitedwaiterswaitingwalkErrwatcherwatcheswinSizewiretagwrapErrwrappedwriteMuwriteTowritechwriterswrittenxmlnameyMinusX encodingmath/bignet/http**string**uint32*[0]bool*[0]uint*[10]int*[16]int*[19]int*[28]int*[3]*int*[3]bool*[60]int*[64]int*[8]bool*[8]uint*[][]int*[]error*[]int16*[]int32*[]int64*[]ssh.F*[]uint8*any.Any*big.Int*big.Rat*big.nat*cpu.x86*diff.op*float32*float64*fmt.fmt*ghw.NIC*ini.AST*io.pipe*net.SRV*os.File*os.file*osfs.OS*poll.FD*sqs.SQS*ssh.mux*tag.Key*tag.Map*tag.Set*tag.TTL*tag.Tag*uintptr*url.URL*v4.ruleAbortingAddChildAddMountAdditionAlgonameAllTasksAncestorAnnotateArgumentAuthInfoAuthTypeBaseHashBinaryOKBinomialBoolVarPBoundaryBoxImageBranchesBufferedBuildDirBuildURIBusyLoopBytesHexBytesRemCRITICALCa_stateCallbackCalledAsCapNamesCastTypeCertTypeCheckoutChecksumChildrenClassifyClientIDColorizeCommandsCommentsCompleteCompressConfigIDConnPoolContainsContentsCopyFromCopyListCopyPipeCoreDumpCountVarCriticalCursorIDDNSNamesDNSStartDataSizeDatabaseDateTimeDeadlineDefValueDeletionDevMajorDevMinorDevmajorDevminorDiffMainDigesterDiscoverDiskTypeDistinctDocumentDoubleOKDownloadDurationEachPageElementsElseListEmitBoolEmitSyncEnableGCEncodingEndpointErrorLogEventNumExchangeExcludesExecuteCExemplarExitCodeExitFuncExpandedExpectedExtendedFEEDBACKFailFastFailTaskFamiliesFieldMapFileInfoFileLineFileNameFilenameFillLeftFindHashFinishedFlagBitsFlagSignFloat32PFloat64PFlowinfoFormFileFormNameFprintlnFragmentFrameMaxFromJSONFullNameFunctionGenerateGetAckIdGetAgentGetBeginGetBytesGetCountGetCtypeGetEntryGetFieldGetIPNetGetInt16GetInt32GetInt64GetLabelGetLevelGetNanosGetPatchGetPathsGetRulesGetStartGetStateGetTimerGetTopicGetUUIDsGetUint8GetValueGoStringGroupIdsHCLTokenHTTPPathHandlersHasASIMDHasAliasHasCPUIDHasCRC32HasDCPOPHasFiredHasFlagsHasGHASHHasJSCVTHasLDispHasLRCPCHasPMULLHasSSE41HasSSE42HasSSSE3HasSTFLEHasZArchHashFuncHeapIdleHelpFuncHostPathHostnameHttpOnlyIPNetVarIPSlicePIdleTimeIfUnusedInConfigInUserNSIncludesIndexErrInjectorInstRateInt16VarInt32VarInt64VarInt8VarPIntSliceInternalIsAssignIsBinaryIsBranchIsClientIsClosedIsDeleteIsHyperVIsNormalIsNumberIsPseudoIsPublicIsRemoteIsSeekerIsStreamIsSubkeyIsUint64IteratorJSONNameKexAlgosKeyBytesKeyUsageKeysByIdLanguageLastUsedLessThanLinkNameLinknameListenerLoadFileLocalityLocationLogEventLogLevelLookupMXLookupNSMSpanSysMapIndexMappingsMarkDeadMaxDelayMaxKeyOKMaxLinesMemTotalMessagesMetadataMethodIdMinKeyOKMinValueMkdirAllModelistMulRangeMultipleMultiplyMustFlagMyWindowNameOnlyNextPageNextPartNoLchownNodeAddrNodeSpecNodeTypeNodenameNotAfterNotFoundNotHoistNsignalsNumFieldNumLinesObjectIDOfficialOffset32Offset64OnFooterOnHeaderOpenFileOptionalOrigErrsOrigNameOriginalOtherSysOverheadOverlapsPackRefsPackfilePageInfoParseAllPasswordPatternsPauseEndPeakRatePeerAddrPipelinePositionPostFormPostRunEPowerOffPreferGoPriorityProgressProtocolProviderProvincePushBackPusherIDQueryIntQuestionRawQueryRawTokenRawWriteReadASN1ReadBitsReadByteReadFormReadFromReadLineReadNullReadOnlyReadPrefReadRuneReadTaskReadlinkRealSizeReceivedRecvTimeRedirectRefSpecsRegistryRepeatedRequiredReservedResolverResourceResponseRetrieveRollbackRootPairRunnableRuntimesS2KCountSameSiteScope_idSecretIDSectionsSecuritySendHashSendTaskSentTimeServeTLSServicesSetAgentSetBytesSetCountSetDeltaSetErrorSetFlagsSetFloatSetIndexSetInt64SetItemsSetLabelSetLevelSetLimitSetLinesSetTableSetTokenSetValueSeverityShallowsShutdownSignCertSignaledSimplifySkipASN1SnapshotSnd_cwndSpanKindSprintlnStackSysStopTaskStreamIDSubChansSubImageSubjectsSupportsSymbolOKSysUsageTagImageTagQueueTaskFuncTempFileToCachedToScriptTopicIAMTopologyTrailCCCTraverseTreeHashTreeNameTruncateTryRLockTxCommitTypeFlagTypeflagUint8VarUintVarPUnixNanoUnixTimeUnparsedUntaggedUpsertedUserNameUserTimeUsernameValidateValidityValueErrVerifiedVerifierVisitAllWTimeoutWarningfWarningsWireTypeWithArgsWithNameWithTimeWorktreeWriteAllWriteMsgXXX_SizeactivityaddBytesaddChildaddEntryaddEventaddExtraaddNonGoaddrAttraddrFuncallspansaltProtoargLimitarrayEncasClientassertedassignToattemptsauthInfoautoHeadautoWrapawsErrorbalancerbaseMaskbaseaddrbaselinebidirulebitCountblackPixblockCRCboundarybreakErrbubbleUpbufStartbuildMapbusyListbytedatacacheEndcacheGetcacheKeycachePutcallEmitcallInfocanRetrycanceledcapNamescapacitycategorycgocheckchanListchanTypechannelscheckEndcheckNowcheckSumchecksumchildrenchunkingcloseAllcloseDotcloseErrcodebitscollapsecommandscommentscompleteconcretecondlogfconfirmMconfirmsconnPoolconstSumcontainscontentscontinpccoprimescopyDatacopyDistcountBufcriteriactxLinescurStartcurStatedataqsizdeadlinedecIndirdecOpFordecode32decode64defaultsdescChandialConndialUnixdidClosedidResetdisableddiscoverdispatchdivLargedivShiftdnsNamesdoAppenddoPrintfdocumentdoneChandoneFuncdoneInitdoneOncedoneRespdrainingdumpDatae_ehsizeelementselemsizeelemtypeembeddedenablegcencIndirencSpeedencodinggrowqendCycleendWriteend_markendpointeofErrorerroringevalBoolevalCallexchangeexcludesexpectedexplicitextElemsfailFastfailfastfastTagsfastrandfieldnumfileNamefilenamefinalMsgfinalizefindElemfindNextfinishedfirstErrfirstMsgfirstTryflagTypefmtBytesfmtFlagsfmtFloatforwardsfreeListfreeSpanfreeWaitfreelinkfromLinefromPunyfullHeadfullTailfuncInfofuncNamefuncTypefunctiongenerategetCRC32getCachegetInt64getSlicegetStategetTokengfreecntrand$time$rand$time$grow read seek read seek fillqfillqfillqwait`7wait`7handlershasErrorhashFunchashHeadhashPrevhassizerhaveVersheapGoalheap_syshelpFunchijackedhintCerthistSizehostKeysicookiesidleConnimplicitinGoAwayincominginflightinitFileinitOnceinitSpaninlIndexinputIdxinsecureisBrokenisClientisClosedisMappedisMarkedisProto3isPushedisRSAPSSisReusedisSecureisSelectit_valueitemListjoinTypekeepPackkeyCountkeyDelimkeyIndirkeySizerknownKeylastBytelastFreqlastReadlastSeenlastbodylastpartlastpolllazyInitlexCommalexEquallexFalselibcallglinkMasklistTypelistenIPlistenerloadAddrlogReadslogWritelookupIPlookupMXlookupNSmakeStubmantbitsmappingvmatchLenmatchcapmaxCodesmaxConnsmaxCountmaxprocsmcentralmeasuresminCodesminItersminwidthmoreBitsmstartfnmulAddWWmulRangemultiSegmustgetcmutatorsmyWindownameListnbgsweepncgocallneedzerofile,%file,%newBlocknewChainnewECDSAnewEntrynewFieldnewLimitnewRangenewStacknextBothnextBytenextFreenextFromnextFuncnextItemnextLinenextMainnextNodenextTimenextTreenextUintnoNotifynodeTypenonblocknonceGennonemptynoptrbssnotFoundnumExtranumInstrnumReadynwrittenobjIndexoffset64oiByHashonFooteronGoAwayonHeaderonHitEOFopenTuneoptionalread seek read seek outCountoverflowoverridepackListpadEntrypadbytespageInfoparseDSAparseIntparseOneparseRSAparseRefpasswordpatternspause_nspeekRunepipelinepointerspollablepositionpossiblepreferGoprefixesprevRunepreviousprintArgprintRowpriorityproviderproxyURLputBatchquitChanraceaddrrawInputrawTokenrcvrTyperdOffsetreadASN1readBytereadDatareadFormreadFromreadFullreadHashreadLinereadLockreadLoopreadMorereadNamereadPrefreadTyperealTyperecvInforecvTyperecyclerrefNamesregexpROregistryremoteIdrepeatedreqCountrequiredreservedresetAllresetErrresolverresourceresponsereturnedrouteMaprunqheadrunqsizerunqtailrwunlocksa_flagssafeBodysameHashscStatesscanBoolscanCharscanLinescanNextscanRunescanUintscanWorkscavengeseedListsegmentsselectorsemCountsendOpensendTypesendZerosentLastsepIndexseqStartsequenceserveSigserverIDservicessetBytessetCachesetErrorsetRunessetSpanssetStatesetValueset_nsecset_usecshutdownsi_errnosi_signosigcode0sigcode1simplifysleepingslowTagssnapshotsockPathsockaddrsortNamesortRefsspecialsspineCapspineLenspinningss_flagsst_otherst_shndxst_valuestackTabstartKexstepBothstktopspstopnotestoppingstopwaitstreamIDstwprocssubChanssubConnssubtreessudogbufsweeperssweepgensysAllocsysUsagetabwidthtagCounttag_datatargetpctearDowntempfiletemplatepeek@Pterm@Pnext@Ppeek@Pterm@Pnext@PthrottlethrowingticksEndtimeTypetimesnaptlsStatetmpBytestmpClasstoMetrictoObjecttoStringtoUint32toUint64tokStarttokenizetopologytrReadertracebuftraceseqtrailerstreeNametruncatetryAlloctryStoreudevInfounaryIntuncommonunformatunindentuseProxyuserTimeusernamevalIsPtrvalSizervalidatevarValuevariablevariadicvariancevd_flagsverifierwTimeoutwaitDonewaitReadwaitlinkwaitlockwaitnotewaittailwantIdlewasPanicwhyNoGNUwhyNoPAXwindowMuwireTypewriteAnywriteBufwriteEndwriteMsgwriteReqwritebufwritei64 io/ioutil math/rand os/signal **any.Any **big.Int **diff.op **ghw.NIC **net.SRV **os.File **url.URL *[0]int32 *[0]int64 *[0]uint8 *[14]int8 *[1]error *[1]int32 *[1]int64 *[1]uint8 *[256]int *[288]int *[29]int8 *[2]int32 *[2]uint8 *[30]int8 *[316]int *[3]error *[3]int32 *[3]int64 *[3]ssh.F *[3]uint8 *[4]int32 *[4]uint8 *[5]int32 *[5]int64 *[5]uint8 *[64]int8 *[65]int8 *[6]int16 *[6]int32 *[6]uint8 *[7]int32 *[7]uint8 *[8][]int *[8]error *[8]int16 *[8]int32 *[8]int64 *[8]uint8 *[96]int8 *[9]uint8 *[]*uint8 *[]exec.F *[]func() *[]net.IP *[]string *[]uint16 *[]uint32 *[]uint64 *afero.Fs *amqp.URI *asn1.Tag *ast.File *ast.Node *big.Word *big.form *bson.Raw *chan int *ecdsa.zr *exec.Cmd *gcfg.tag *http.Dir *http.Err *net.Addr *net.Conn *net.conf *net.conn *net.file *ssh.Conn *ssh.ecdh *sync.Map *tls.Conn *tls.aead *view.Row *xml.Attr *xml.Name AResource AbortTask AcceptTCP Acceptors AddCookie AddGoFlag AddNested AddOption Addresses Aggregate Algorithm AllowHTTP Annotatef Anonymous Arguments Artefacts AsFloat64 AsInt32OK AsInt64OK AuthCheck Authority AutoClose Available BasicAuth BatchSize BeginTime BindPFlag BitLength BlockSize BodyStart BoolSlice BooleanOK BoundAddr BoxRemove Broadcast BuildTree BulkWrite BytesHexP BytesSent CPUShares CRTValues CallSlice CaseMatch CertBytes Challenge ChannelId CheckBiDi CheckCert ChownOpts ChunkSize ClearRows ClientCAs ClientKey CloneTask CloseConn CloseRead CloseSend Coalesced Collation Commented Committer Completed ConnState Consumers Container Continued CopyBytes CopyValue CountVarP CreateCRL CreateOne CreateTag CreatedAt CurrentRc CurrentRp CurrentWc CursorIDs DBPointer Databases DebugData DeleteOne DeleteTag DialCreds DidResume DiffText1 DiffText2 DiskUsage Documents DotReader DualStack DurationP ECDSASigR ECDSASigS EarlyFail EmitInt32 EmitInt64 Encrypted EndStream Endpoints ErrorCode ErrorTask EventLogs EventType Exclusion Exclusive ExpandAny ExpiresAt Extension ExtraData FetchTask FieldsMap FillRight FindCRC32 FindEntry FindImage FindIndex FormValue Formatter FrameSize FromBytes Ftruncate FullBytes GetAckIds GetAction GetApiKey GetBroker GetByType GetCallId GetConfig GetCookie GetCustom GetDelete GetFormat GetIpPort GetJstype GetLabels GetLength GetLogger GetMaster GetMember GetMethod GetNumber GetOldest GetPacked GetPolicy GetPrefix GetRemote GetServer GetSocket GetStrict GetString GetSuffix GetSymbol GetSyntax GetTarget GetTopics GetUint16 GetUint32 GetUint64 GobDecode GobEncode GroupName GroupUUID HTMLBytes HTTPProxy HandleRPC HandleRaw Handshake HasAESCBC HasAESCTR HasAESGCM HasCaller HasPOPCNT HasParent HasSHA256 HasSHA512 HeapAlloc HeapInuse Heartbeat Histogram IPMaskVar IPNetVarP ImageData Immediate Immutable Increment InitGroup InitLevel InitSwarm InlineMap InsertOne Int16VarP Int32VarP Int64VarP IntSliceP Interface Intersect IsBracket IsComplex IsDefault IsEnabled IsExpired IsFailure IsLibvirt IsLiteral IsManager IsOnCurve IsPrivate IsProcess IsRegular IsRevoked IsRunning IsSampled IsStarted IsStopped IsSuccess IsTimeout IsWaiting IsWritten Isolation JoinSwarm JoinToken KeepAlive KeyUsages LabelKeys LastError LatencyMu LineCount ListNodes ListTasks ListenTCP LoadBytes LoadImage LocalAddr LogFields LookupErr LookupSRV LookupTXT MCacheSys MDocument MakeAdmin Mandatory MarshalTo MatchMain MatchRune MaxErrAge MaxTokens Mechanism MessageID MessageId MoveAfter MsgHeader Multiaddr Multiline MustInt64 MustUint8 Namespace NetworkID NewClient NewObject NewServer NewSpanID NewStream NewWorker NodesTask NonceSize Normalize NotBefore NumMethod NumSubexp OmitEmpty OnFailure OnSuccess Operation PadLength Pad_cgo_0 Pad_cgo_1 Paginator ParamsInt ParseForm ParseGlob ParseName Partition PatchMake PathSpecs Pdeathsig PeekRunes PixOffset PlainAuth PlainText Platforms Precision Prefixlen PrintFunc ProcessID Processes Prohibits PromiseID ProtoSize ProxyBSON ProxyDial ProxyFunc PublicKey PullImage PushFront PushImage PutUint16 PutUint32 PutUint64 QueryBool QueryTrim QueueBind QuickSpan RatString RawIssuer Rcv_space ReadArray ReadBytes ReadFrame ReadIndex ReadInt32 ReadInt64 ReadMsgIP ReadRegex ReadSlice ReadUint8 ReadValue Reference Remaining RemoveAll RemoveRef ReplyCode ReplyText RequestID Reserved0 ResetBody Retryable ReturnKey RootToken RoundDown RoundTrip RuneWidth SSHConfig SSLCaFile ScanPages ScanState SeenFiles SendChain SendChord SendGroup Sensitive Serialize ServeConn ServeFile ServeHTTP ServerKey ServiceID SessionID SetAction SetBorder SetBroker SetConfig SetCookie SetCreate SetDelete SetExists SetFailed SetFilter SetFooter SetFormat SetFrac64 SetHeader SetLinger SetMounts SetNoLock SetOption SetOutput SetParams SetParent SetPolicy SetPrefix SetRounds SetSelect SetSparse SetStatus SetString SetUint64 SetUnique SetUpdate SetUpsert SetupTask Shorthand Signature SkipSpace Snapshots SortFlags SourceDir Specified StartCond StartExec StartLine StartSpan StartTask StartTime StdinPipe StoredKey StreamDep StringVar Submodule Subscribe Subsystem Succeeded SwapLimit SwapNamed TLSConfig TLSUnique TagObject TarWriter Templates Temporary Timestamp ToMacaron ToUnicode TokenText TotalSize Transform Transport TrapCause TreeEntry TrimAbove TrimBelow Truncated TxnNumber Uint16Var Uint32Var Uint64Var Uint8VarP UintSlice Undefined Unmarshal UpdateOne UpsertSet UsageFunc UseNumber UserAgent UserUnset ValidArgs ValueElem ValueType WaitGroup WaitWrite WantReply WantWrite Warningln WillRetry WithError WithField WriteByte WriteData WriteNull WriteOnce WritePing WriteRune WriteToIP XXX_Merge X__st_ino ZlibLevel acceptRun ackTicker addSample addServer addedGzip allocBits allocator alternate ancestors appendRef applyMaps argNumber arguments artefacts associate authority autoClose availRead available b64Reader backtrack backwards badArgNum batchSize beginTime bestSpeed bestTimer bitCounts bitLength blacklist blockSize blockType blocksize bodyBytes bootstrap boundAddr bufReader bufWriter buffering busylarge bytesSent cacheSpan cacheZone calculate callCount calldepth canUseCgo cancelCtx canonical caughtsig chainHead checkAddr clearRows clearWake clientMD5 clientSum closeBody closeConn closeRead closeWith cmdStatus collector commaPrev commented committed compIndex composing configure connErrMu connError connected consumers copyArray copyCheck copyFuncs copySlice createDir createKey ctxPrefix curBundle dataBlock dataCount dataFrame deadlines debugData decodeBit decodeInt decodeMap decodePtr decompSet decrypter deferlock deferpool deriveKey didResume direction discarded diskModel dispatch0 dispatchN divShift2 dnsConfig doAddFile doDialTCP doExecute doPending doPrintln doRequest documents e_machine e_version elemIndir encodeIdx encodeInt encodeMap encodeRawemptyq encrypter endEscape endStream endpoints enginePtr enoptrbss entryHead entryPool envPrefix equalDocs equalFold errDetail errorChan escapeErr evalField evalFloat eventLogs eventsBuf evictList exclusion execFuncs expecting extraData fallbacks fetchPack fieldEncs fieldSpec fieldType fillStore findEntry findMatch fireHooks firstByte firstLine fixedSize floatBits flushCopy fmtString forceJSON formatter framePool freeBlock freeindex freelarge freqcache freshConn fromCount gcbssmask gcwaiting getLength getOffset getStream getUint64state,write$flush$write$flush$write(write(chmod write chmod close pread close write pread resetqresetqresetqstart`7stdin`7start`7stdin`7 globMatch goidcache goroutine gs2Header handshake hasEquals hasExpRef hasObject hasPrefix hashEqual hashMatch headerBuf headerKey heap_idle heap_live heap_scan heartbeat hexString hijackedv httpProxy idToIndex idleNodes idleState idleTimer ifControl ignoreErr ignoreMap inclusion increment indention inlineMap innerfind input_pos insertCGJ insertKey insertNew instQueue isBlocked isCapable isColored isEnabled isExpired isGNUHash isPartial isPointer isShallow isSymlink itablinks keepalive largefree lastEntry lastFrame lastRoute lastTicks lastWidth leftDelim leftValue lehmerGCD lengthKey lexEquals lexNumber lexRspace lexRvalue lexString libcallpc libcallsp listenTCP listenUDP listeners loadBytes localAddr localSize locations lockOwner lockedExt lockedInt lockorder logHandle logWrites lookahead lookupSRV lookupTXT lostExtra macKeyTag macResult mallocing marshaler matchGlob matchHost matchLeaf maxEvents maxStrLen maxmcount mayOnlyBe mechanism mergeInfo mspan_sys multiline mustNotBe nBSSRoots nameBytes nameSpace namespace needCloseclose,%close,% nevacuate newAction newConfig newNumber newRegexp newStream newString nextArena nextBlock nextIndex nextToken nextwaitm nfuncdata nlIsSpace noHeaders nonceMask nonceSize noptrdata notePanic noverflow npagesKey numBlocks numSubexp objectKey objectMap omitEmpty omitempty onFailure onSuccess onePacket openStart openVhostchmod close pread write chmod close pread write otherInit other_sys outHandle packedRef padString pairs_end pairs_top panicking parseArgs parseForm parseLine partition partsRead pathAddrs pathLines pause_end pclntable peekCount peerReset pkghashes popPrefix popWriter preferPAX prefixEnd primaries primitive printLine printRows printlock producers profilehz projectID proxyAuth ptrToThis publicKey published pushArray pushValue questions queuePool quickSpan rawBuffer readBlock readBytes readCount readEntry readError readFlush readIndex readLimit readSlice readStage readUntil readValue readerErr readerSem reconnect recovered recoverer recurring recursive remaining remoteWin reordered replenish reqFields requestID resHeader reserved0 reserved1 reserved2 retOffset roundDown roundTrip rsaSignOk saveError scWatcher scanWhile schedlink schedtick schedwhen searchMap selectors sendAlert sendEvent sendQuota sensitive sentClose sequencer serialize serverMD5 serverSum serviceID sessionID sessionId setBits64 setGoAway setIsBare setMarked setOption setParent setServer setStatus setString setTopVar setUint64 setWriter setupDone sigChecks signature singleUse sizecache sizeclass skipASCII skipBytes skipSpace spanIDInc spanStore spanalloc spanclass spineLock sprintlnn stackLock stacksize startAddr startPush startSema startTime statsTags statusBuf statusGen stdinpipe stepState stopParse storeHuff streamInt stringSeq stringVal stripMono subscribe sudoglock suffixOff swapState sweepdone syncFlush syscallpc syscallsp tMarkTerm tableSize taskRetry taskStateerror@PnewIf@Pparse@Perror@PnewIf@Pparse@P timeStart tlsConfig toBoolPtr toFloat32 toFloat64 toReplace tokenType totaltime traceback traceskip trackConn transform translate transport tryUpdate typeCheck typeError typelinks undeltify unhandled unmarshal unpackErr urlPrefix usageFunc useNumber userAgent validSave valueType valuesize waitWrite waitsince walkRange walkTreap warnCount wbufSpans wildcards windowEnd withRetry writeBits writeBody writeByte writeCode writeCopy writeEnum writeLock writeLoop writeMark writerSem zlibLevel  crypto/aes crypto/des crypto/dsa crypto/md5 crypto/rc4 crypto/rsa crypto/tls hash/crc32 image/jpeg **view.Row *[0]func() *[0]net.IP *[0]string *[0]uint32 *[0]uint64 *[108]int8 *[10]uint8 *[11]int32 *[11]uint8 *[127]bool *[128]bool *[12]uint8 *[13]int32 *[13]uint8 *[14]uint8 *[15]uint8 *[16]int32 *[16]uint8 *[17]int32 *[18]uint8 *[19]int32 *[19]uint8 *[1]string *[1]uint32 *[1]uint64 *[20]uint8 *[22]uint8 *[24]uint8 *[256]bool *[256]int8 *[256]uint *[25]uint8 *[28]uint8 *[29]uint8 *[2]string *[2]uint16 *[2]uint32 *[2]uint64 *[30]int32 *[30]uint8 *[32]int32 *[32]uint8 *[36]uint8 *[39]uint8 *[3]exec.F *[3]string *[3]uint32 *[3]uint64 *[40]uint8 *[45]uint8 *[48]uint8 *[4]string *[4]uint16 *[4]uint32 *[4]uint64 *[52]uint8 *[55]uint8 *[56]uint8 *[5]string *[5]uint32 *[64]uint8 *[65]int64 *[65]uint8 *[67]uint8 *[68]uint8 *[6]string *[6]uint16 *[72]uint8 *[7]string *[8]*uint8 *[8]string *[8]uint16 *[8]uint32 *[8]uint64 *[9]string *[9]uint32 *[]*net.MX *[]*net.NS *[]*string *[][]int32 *[][]uint8 *[]big.nat *[]float32 *[]float64 *[]ini.AST *[]tag.Key *[]tag.Set *[]tag.Tag *[]uintptr *agent.Key *asn1.Flag *auth.Cred *big.Float *billy.Dir *bsonx.Arr *bsonx.Doc *bsonx.Val *chan bool *chan uint *clog.MODE *clog.file *com.StrTo *complex64 *cpu.arm64 *cpu.s390x *diff.File *diff.hunk *flag.Flag *fmt.State *fmt.ssave *func(int) *gob.decOp *gob.encOp *hash.Hash *hcl.field *hmac.hmac *http.File *http.body *http.conn *idna.info *ini.Token *io.Closer *io.Reader *io.Seeker *io.Writer *jpeg.bits *list.List *log.Field *net.Error *net.Flags *net.IPNet *net.netFD *net.racer *net.scope *norm.Form *norm.Iter *os.Signal *osfs.file *parse.Pos *peer.Peer *pem.Block *pkix.Name *proto.wkt *rand.Rand *runtime.g *runtime.m *runtime.p *stats.End *struct {} *sync.Cond *sync.Once *sync.Pool *syntax.Op *tar.block *tasks.Arg *time.Time *time.zone *tls.alert *tls.block *token.Pos *toml.Tree *unicode.d *url.Error *user.User *uuid.Time *uuid.UUID *view.Data *view.View *xml.Token *xml.stack *yaml.node APIVersion AcceptUnix AccessTime ActualHash ActualSize AddCommand AddDetails AddFlagSet AddHandler AddProfile Additional AfterRetry AllAnswers Alternates AppendBSON AppendBulk ArgAliases Attributes AuthSource AutoDelete AverageRTT Background BaseConfig BindPFlags BlobObject BodyCloser BoolSliceP BranchName BranchNode BucketSize BufferSize BuildImage ByteReadCh CacheImage CanEncrypt ChangeTime ChannelMax CheckedOut CipherFunc ClientAuth ClientInfo Cloneflags CloseWrite Collection ColorModel CommitHash Committing CommonName CommonType Comparable Comparator CompareKey CompareURI Complex128 ConfigName ConfigSpec ConnectSet Connection Consistent Containers Controllen CoreDumped CreateExec CreateMany CreateNode CreatePart CreateTask Credential CursorOpts CursorType CustomType DataFilled DateTimeOK DebugFlags DebugPrint Decimal128 DecodeFull DecodeHook DecodedLen Decompress DeleteItem DeleteMany DeletePath Deprecated Descriptor DiffBisect DiffXIndex DisableSSL Disconnect DocumentOK Domainname DriverOpts EOLComment ElectionID EmitObject EmitString EmitUint32 EmitUint64 EncodedLen EndHeaders EndRequest EndSession Entrypoint ErrorCount ErrorStack Exclusions ExitStatus ExpFloat64 Expiration ExpireTime ExportSpan ExportView Expression Extensions ExtraFiles ExtraNames FieldAlign FieldsList Filesystem FilterFunc FindOffset FindServer FindString FinishTask FinishTime FlagUsages FlagsValid Float32Var Float64Var ForceQuery ForeachKey Foreground FprintFunc FromReader FromString FullMethod GRPCStatus GenDefault GetAddress GetBackend GetBaseURL GetChannel GetComment GetDefault GetDetails GetFloat32 GetFloat64 GetGeneral GetIPSlice GetLogPart GetMembers GetMessage GetOptions GetPackage GetPattern GetPayload GetProfile GetProject GetSeconds GetServers GetService GetSession GetStorage GetTimeout GetTrailer GetTypeUrl GetVersion Getsockopt GraphWidth HTMLString HTTPClient HTTPMethod HTTPSProxy HandleConn HandleFunc HasASIMDDP HasASIMDHP HasATOMICS HasChanged HasDefault HasEVTSTRM HasExample HasExpired HasOSXSAVE HashSuffixIDqs:"-" IPMaskVarP IPSliceVar Identifier Identities Implements InitBinary InitString Initialize InsertMany InsertedID IsBoolFlag IsCompound IsDisabled IsExtended IsInternal IsLoopback IsOperator IsResponse IsSeekable IsTerminal IsTypeZero IsVariadic IsWildcard JSONString JavaScript JoinTokens KeyExpired KeyFactors LayersSize LayoutElem LazyPrintf LazyQuotes LeaveSwarm LimitToken LineNumber ListImages ListQueues ListTables ListTopics ListenAddr ListenUnix LocalFlags LogRecords LoggerName LookupAddr LookupHost LookupPort MSpanInuse MXResource MacAddress MakePublic MapKeyProp MapValProp MarkHidden MarshalXML MatchBitap MaxBackoff MaxEntries MaxLatency MaxPathLen MaxReqSize MaxRetries MaxVersion Mechanisms MethodName MinLatency MinVersion ModInverse ModifiedAt MountsList MoveBefore MoveToBack Multiplier MustGetInt NSResource Nanosecond NewAddress NewRequest NewSession NewSubConn NewTraceID NextObject NextProtos NoCheckout NotifyFlow NumParents OCSPServer OCSPStaple ObjectIDOK ObjectPack ObjectStat ObjectType OneofTypes OpenStream OriginAddr OriginPort PAXRecords Parameters ParseFiles ParseFlags PatchApply PayloadLen Percentile PlanCreate PlanDelete PostalCode Precedence Precompute PrimaryKey PrintfFunc PrivateKey Projection Properties ProtoMajor ProtoMinor PubKeyAlgo PurgeQueue PurgeState PushConfig PushPlugin QueryInt64 QueryPages QueuePurge RawControl RawExpires RawSubject ReadBinary ReadBits64 ReadCloser ReadConfig ReadDirent ReadDouble ReadFromIP ReadMaxKey ReadMinKey ReadMsgUDP ReadString ReadSymbol ReadUint16 ReadUint24 ReadUint32 RecentList Recyclable References RemoteAddr RemoteName RemoveGlob RemoveNode Reordering ReplaceAll ReplaceOne ReplicaSet Repository RequestPty RequestURI ResetFlags ResolveNow ResponseTo RetryCount RetryDelay RetryRules RetryWrite RightAlign RoutingKey RunCommand SaltLength SaveToFile ScalarMult SecretName SecretSpec SeekToTime SendHeader ServerData ServerLoad ServerName SessionIDs SetActions SetAddress SetBackend SetBaseURL SetBorders SetCaption SetComment SetComplex SetContext SetCookies SetDefault SetEnabled SetEntries SetFloat64 SetHandler SetKeyType SetMantExp SetMaxTime SetMessage SetNewLine SetNoDelay SetOrdered SetPointer SetRowLine SetSSEType SetSegment SetShallow SetTableId SetTagKeys SetTagName SetTimeout SetTrailer SetVersion SetWeights SignUserId Signatures SizeOnDisk SkipAnswer SleepDelay SocketData SocketPath SpanString SprintFunc StackInuse StatusCode StderrPipe StdoutPipe StopSignal StorageDir StreamName StringVarP Submodules SubnetSize Subsection SuggestFor SystemTime TagObjects TargetType TaskDelete TaskStream Terminated ThisUpdate TimeSeries Timestamps ToDocument ToExtended TokenRatio TotalAlloc Tracestate TreeObject TryAcquire TxRollback TypeString Uint16VarP Uint32VarP Uint64VarP UintSliceP Underlying UnreadByte UnreadRune UnsafeAddr Unshallows UntagQueue UpdateItem UpdateMany UpdateNode UploadFile UploadPack UpsertedID UseContext UseSession UserCreate UserRemove UserUpdate ValidAfter WNumberSet WantsClean WhenString Whitespace WireLength WithDetail WithFields WithLogger WithRegion WktPointer WriteArray WriteError WriteField WriteFrame WriteIndex WriteInt32 WriteInt64 WriteMsgIP WriteProxy WriteRegex WriteToUDP WriteValue X__ifi_pad YAMLString ZeroFields _interface ackRequest activeCall activeConn actualSize addChannel addSubtree addTarFile algorithms allMatches allocCache allocCount allocLarge annotation appendHash appendRDNs appendRune applyBlack arenaHints assignRune assistTime attrExists attrPrefix availWrite averageRTT backoffIdx baseConfig basicWidth beginChunk best_width bgMarkDone blockStart blockingCh bodyReadCh bodyWriter bubbleDown bucketsize bufferSize buffer_pos buildIndex bulkHasher cacheStart cachealloc cachedsize callBefore callInvoke calledDone callerGone canAddrEnc catchPanic cgoCallers channelzID checkError checkNotOn checkValid checkedOut checkempty childFiles cipherFunc ciphertext clearBatch clearflags closeWrite closerFunc cmdMonitor commandMap comparator compileDec complexity compressor configFile configName configType confirming connString connection contentKey continueCh controlBuf copyObject countAlloc countState createFunc credential currCommit currentCRC currentPos cursorOpts debugLevel debugflags decodeBits decodeBool decodeCaps decodeCost decodeFunc decodeLine decodeUint deleteSelf delivering dequeueAll destructor dialSerial dialSingle diffBisect directives diskVendor dynamicVar e_shstrndx earlyClose ellipticOk emitScalar encodeLine encodeUint endControl enoptrdata errChannel errIgnored escapeHTML escapeList escapeText escapeTree evalString eventCount evictCount exclusions exitStatus expression extPending extensions fastInvoke feedBuffer fieldAlign fieldalign fileAndDir fillWindow finalFlush findServer firstBatch firstField firstLevel firstReady fixsigcode floatToken flow_level flushTimer fmtBoolean fmtComplex fmtInteger fmtPointer fmtUnicode forResolve frameCache frameStack freeManual free_bytes fromResult gc_trigger gcdatamask gcmarkBits gcscandone generation getContent getFloat64 getPending getPointer getReadBuf getRefName gfreeStackexpandexpandpwrite pwrite stderr`7stdout`7stderr`7stdout`7 goAwayCode goLookupIP goSigStack goodArgNum handleData handlePing handshaker handshakes hasStarted hashOffset headerChan headerDone headerSent heap_alloc heap_inuse httpStatus httpsProxy idNotFound idleConnCh inShutdown indentedIn initConfig initRotate initStream initString initialize inputBytes insertBack insertCert invalidate invalidptr ipMatchers isBlocking isCompound isCritical isExported isModifier isMultiACK isNotEmpty isRPCStats isTerminal isWildcard items_data keyWireTag largealloc lastActive lastMethod lastRecord lexComment lineLength lineNumber lineOffset line_break listenUnix loadOffset local_scan lookupAddr lookupHost lookupName lookupPort macGeneric markPrefix markReused marshalDoc marshaller matchExact maxBackoff maxStreams maxVersion mcache_sys mergeValue messageset mimeHeader minVersion missLocked missingArg missingKey modulename montgomery nDataRoots nSpanRoots nackTicker namespaces needextram needsSniffaccept,%accept,% newChannel newCommand newLiteral newRequest newSession nextCalled nextCipher nextProtos nextSpanID nextTicket nextTokens nlargefree nmspinning notCreated notifyChan npreleased nsmallfree numBuckets numRetries numericVal objectItem objectList objectPath objectType offsetAnon offsetFreq offsetHash oiByOffset oldbuckets onOrphaned onShutdown oneofElems open_endedexited pwrite pwrite exited packetData packetPool pagesInUse pagesSwept pairs_data parameters parenDepth parseArray parseCaret parseClass parseColon parseFuncs parseGroup parseOctal parseStart parseState parseTilde patchMake2 pathVarLog pauseStart pcExpander peekLength peekString pingStream pingTicker pluginpath popElement preRLEUsed preemptoff prefixRune prevTokens printTrace printValue privateKey processDHT processDQT processDRI processErr processSOF processSOS progCoeffs promisedID properties pubKeyAlgo pushPacket pushWriter putNewline raceignore raiseError rawPattern raw_buffer readClient readCloser readEvents readFrames readHeader readLength readLocked readPacket readRecord readString readUnlock readerDone readerPass readerWait rebaseName recvHeader recvMethod references reflowText rejectConn rekeyBytes releaseAll remainSize remoteAddr remoteRefs removeNode removeSpan renderHTML replaceAll reportView reqTrailer requestKex resTrailer resequence resetIndex resolveNow resultRefs retryCount rightDelim rightValue rotateLeft runCommand runHandler runtimeCtx sa_handler safeString saltLength savedError sawRegular scanCalled scanDigits scanEscape scanNumber scanString schedtrace selectDone sendClosed sendGoAway sendModAck sendTypeId sentHeader serialized serveMsgCh serverInit serverName serverOpts serverSide setContent setFlusher setMaxSize setPointer setRefRwfs shorthands shutDownIn sigContext signalLock signatures signingKey simpleCall sleepUntil snapHeader socketPath sortedRefs sourceIter sourcepath splitBlock sqrtDirect stackcache stacks_sys standalone startCheck startCycle startParse startTimes startWrite start_mark statsTrace statusCode statusType stderrpipe stdoutpipe storedSize streamByID streamType stringType submodules subscribed subsection sudogcache sweepSpans symstrings sysmonnote sysmontick sysmonwait systemTime tSweepTerm targetAddr taskFailed terminalFdaction@Perrorf@PuseVar@Pexpect@Pbackup@PnewDot@PnewEnd@PnewNil@PuseVar@Paction@Pbackup@Perrorf@Pexpect@PnewDot@PnewEnd@PnewNil@P throwsplit ticketKeys ticksStart timeSeries timeoutSet tinyallocs tinyoffset toInt64Ptr tokenError tokenStack tokenState traceEvent traceIDAdd traceSweep traceSwept tracelastp transition treapalloc tryAcquire tryGetFast tryOneName typeString underlying unexpected unknownOpt unlinkOnce updateHEAD usedOldKey userConfig userForced valWireTag validateDB valueCount vd_version verifyData visitQueue volAndPath waiterFunc waitreason wantsClose whitespace whyNoUSTAR widPresent wireLength workbufhdr writeBlock writeBytes writeChunk writeDebug writeErrCh writeError writeFrame writeLines writeModel writeSched writeSlice writeStart writerDone wroteBytes wroteFrame zlibWriter archive/tar crypto/hmac crypto/rand crypto/sha1 crypto/x509 image/color sync/atomic **agent.Key **diff.hunk **flag.Flag **http.conn **list.List **net.IPNet **runtime.g **runtime.p **sync.Pool **tls.block **toml.Tree **user.User **xml.stack *[0][]int32 *[0][]uint8 *[0]float32 *[0]float64 *[0]ini.AST *[0]uintptr *[100]uint8 *[10]string *[10]uint16 *[11]string *[128]uint8 *[129]uint8 *[12]string *[12]uint16 *[148]uint8 *[14]string *[162]uint8 *[16]uint16 *[16]uint32 *[16]uint64 *[175]uint8 *[17]string *[17]uint64 *[185]uint8 *[18]uint32 *[190]uint8 *[191]uint8 *[196]uint8 *[19]string *[19]uint32 *[1][]int32 *[1][]uint8 *[1]ini.AST *[1]tag.Key *[1]uintptr *[208]uint8 *[209]uint8 *[20]uint64 *[23]string *[248]uint8 *[249]uint8 *[24]string *[24]uint16 *[255]uint8 *[256]uint8 *[25]string *[262]uint8 *[26]uint16 *[27]string *[286]int32 *[28]uint64 *[294]uint8 *[29]uint32 *[2][]uint8 *[2]tag.Key *[2]uintptr *[303]uint8 *[30]uint32 *[317]uint8 *[31]string *[32]string *[32]uint32 *[334]uint8 *[33]string *[34]string *[39]string *[3][]uint8 *[3]uintptr *[403]uint8 *[411]uint8 *[419]uint8 *[47]string *[4][]uint8 *[4]uintptr *[512]uint8 *[5][]int32 *[5][]uint8 *[607]int64 *[60]string *[63]string *[64]uint32 *[65]uint32 *[67]uint16 *[67]uint64 *[6][]uint8 *[6]uintptr *[768]uint8 *[78]string *[800]uint8 *[80]uint64 *[86]uint16 *[88]string *[8]*string *[8][]int32 *[8][]uint8 *[8]float64 *[8]tag.Key *[900]uint8 *[91]string *[93]string *[940]int32 *[97]string *[]*any.Any *[]*big.Int *[]*diff.op *[]*float64 *[]*ghw.NIC *[]*net.SRV *[]*os.File *[]*url.URL *[][2]int32 *[][5]uint8 *[][7]uint8 *[][8]uint8 *[][]string *[][]uint32 *[]ast.Node *[]big.Word *[]bson.Raw *[]net.Addr *[]xml.Attr *[]xml.Name *afero.File *afero.OsFs *amqp.Error *amqp.Queue *amqp.Table *amqp.frame *auth.Error *aws.Config *aws.Logger *aws.lenner *bidi.Class *big.ErrNaN *billy.File *bsonx.Elem *bsonx.IDoc *bsonx.MDoc *chan error *cipher.cbc *cipher.cfb *cipher.ctr *cipher.gcm *clog.LEVEL *clog.slack *codes.Code *color.CMYK *color.Gray *color.RGBA *complex128 *cpu.option *csv.Reader *csv.Writer *diff.Chunk *diff.Patch *docker.Env *exec.Error *expvar.Int *expvar.Var *flag.Value *fmt.buffer *func() int *func(bool) *func(uint) *git.Remote *git.Status *git.runner *gob.typeId *hpack.node *iam.Handle *iam.Policy *iam.client *image.CMYK *image.Gray *image.RGBA *index.Tree *index.node *jpeg.block *json.Delim *json.Token *json.field *log.Logger *md5.digest *mount.Type *net.Dialer *net.IPAddr *net.IPConn *net.IPMask *net.byPref *net.ipAttr *noder.Path *nodes.Node *norm.input *object.Tag *os.Process *os.dirInfo *os.timeout *parse.Node *parse.Tree *parse.item *pflag.Flag *rc4.Cipher *redis.Conn *regexp.job *ssh.Client *ssh.Config *ssh.Signal *ssh.Signer *ssh.buffer *ssh.runner *ssh.window *stack.Call *swarm.Info *swarm.Meta *swarm.Node *swarm.Peer *swarm.Spec *swarm.Task *sync.Mutex *sync.entry *tag.ctxKey *tar.Format *tar.Header *tar.Writer *tar.parser *tasks.Task *time.Month *time.Timer *tls.Config *token.File *token.Type *toml.token *trace.Link *trace.Span *trace.cond *trace.data *url.Values *user.Group *v4.mapRule *x509.pkcs8 *yaml.field AccessKeyID AckDeadline Acknowledge AddIdentity AddLineInfo AddListener AddProducer AddWithTime AfterEachFn Aggregation AllSettings AmbientCaps Annotations AppendChild ArtefactDir AsFloat64OK Attachments AttemptTime AuthMethods BaggageItem BaseHandler BlobObjects BuckHashSys BuildAbsURL BulkLogData BytesBase64 BytesHexVar CallOptions CallsFailed Certificate ChannelData ChannelType CipherSuite ClearFooter CloseNotify CloseStream ClusterInfo ClusterTime CommandList CommandName CommandPath CommentChar CommitImage Compression Compressors Concurrency ConnectDone Constructed ConsumerTag ContainerID ContainsAll ContentType ConvertRead CreateQueue CreateTable CreateTopic Credentials CredsBundle CryptBlocks CurrentTime CurveParams CustomQueue DBPointerOK DataBearing DebugString DecodeBytes DecodeGroup DecodeValue DefaultHash DefaultMask DeleteQueue DeleteTable DeleteTopic DeliveryTag DeltaObject Description Destination DialContext DiffContext DiffTimeout DiffToDelta DurationVar ElapsedTime EmitEnabled EmitFloat32 EmitFloat64 EnableColor EncodeToken EncodeValue EndResponse EndpointFor Environment ErrorDetail ErrorString ErrorUnused EscapedPath ExportImage ExtKeyUsage ExternalRef FieldByName FilePatches Fingerprint FlagCertify Float32VarP Float64VarP FloatString ForEyesOnly ForceColors ForceUpdate FprintfFunc FrameHeader GetAudience GetBindings GetByOffset GetBytesHex GetChildren GetComments GetDatabase GetDisabled GetDuration GetEnumType GetExtendee GetIPv4Mask GetIntSlice GetJsonName GetLocation GetMapEntry GetMessages GetMetadata GetNamePart GetPageSize GetPosition GetProtocol GetQueueUrl GetResource GetSelector GetSnapshot GetTypeName GetWTimeout GidMappings GobEncoderT GreaterThan HTTPRequest HasASIMDFHM HasASIMDRDM HasNextPage HasPipeline HasPriority HealthCheck HeapObjects IDGenerator IPAddresses IPSliceVarP IPv4Address IPv6Address IdleTimeout IdxChecksum ImportImage IncrMsgRecv IncrMsgSent IndexWriter InitRequest InputOffset InputStream InputTokens InsertAfter InsertedIDs InspectExec InspectNode InspectTask IntSliceVar IntentToAdd InvalidUTF8 InvertMatch IsCompleted IsIdentRune IsMalformed IsMulticast IsPresigned IsPrimaryId IsTemporary IsUntracked IssuerKeyId JSONVersion JoinRequest KeyBytesErr KeyIdString LabelValues LatinOffset LaunchAsync LeadComment LineComment ListBackups ListConfigs ListPlugins ListSecrets ListVolumes LoadOrStore LockSection LookupCNAME MCacheInuse MDocumentOK MakeManager MakePrivate MarshalBSON MarshalJSON MarshalTOML MarshalText MarshalYAML MatchReader MatchString MaxAttempts MaxHandlers MaxPoolSize MaxRespSize MemoryLimit MergeConfig MoveToFront Multistream MustFloat64 MustGetBool MustGetUint NGoroutines NamePadding Nanoseconds NeedsUpdate NestedChans NetworkInfo NewWithMode NoOptDefVal NoSetGroups NormFloat64 NotifyClose NumChildren NumForcedGC NumSettings ObjectPacks OpenChannel OplogReplay OutOrStderr OutOrStdout OverflowInt PTRResource Parallelism ParamsInt64 PasswordSet PatchMargin PatchToText PayloadType PeekASN1Tag PeersWindow Percentiles Permissions Precomputed PrettyPrint PrintlnFunc ProcessName PruneImages PseudoValue PublishTime PullContext PushContext PutIdleConn QueryEscape QueueDelete QueueUnbind ReadAnyASN1 ReadBoolean ReadConcern ReadElement ReadFromUDP ReadMsgUnix ReadTimeout RealRootDir RebaseNames ReceivePack RecoverWith RecvTimeout Redelivered ReflectArgs RemoteAddrs RemoveAdmin RemoveImage RemoveTimer Replacement ResolveUndo ResumeAfter Retransmits RetryPolicy RetryWrites ReuseRecord Revocations RootTaskDirRunqs:"-" SOAResource SRVResource SSLInsecure ScanRequest SendMessage SendRequest SendTimeout ServiceName ServiceSpec SessionPool SessionType SetAutoHead SetBlocking SetBoundary SetChildren SetColWidth SetComments SetDataType SetDeadline SetDefaults SetDocument SetDuration SetEmitFunc SetExpected SetHelpFunc SetIndexArn SetInsecure SetMapIndex SetMessages SetNameOnly SetOriginal SetPipeline SetQueueUrl SetRecycler SetRegistry SetSnapshot SetTableArn ShouldRetry SigningName SortStrings SortingFunc SpacesWidth SpanContext SprintfFunc StateString StdDuration StoragePath StreamEnded StringArray StringSlice StringToInt StringValue StringWidth SubexpNames Subsections SuccessTask Synchronous SysProcAttr SyscallConn TBSCertList TCPListener TXTResource TagResource TextVersion TimestampOK ToContainer ToLogRecord TokenCreate TokenDelete TreeObjects TrimRuntime TrustedCert UidMappings UndefinedOK Unprocessed Unsubscribe UpdateModel UpdateState UpdateSwarm UpdateTable UpdateTopic UploadHaves UpsertedIDs UsageString ValidBefore ValueString VirtualHost WTimeoutSet WatchConfig WebHookEdit WireVersion WithContext WithDetails WithMessage WithOptions WithPadding WriteBinary WriteConfig WriteDouble WriteErrors WriteGoAway WriteHeader WriteMaxKey WriteMinKey WriteMsgUDP WriteStatus WriteString WriteSubset WriteSymbol WriteToUnix WriterLevel XXX_Marshal ackDeadline ackTimeDist acquiretime activeConns addJacobian addListener addMetadata addOffset64 addReadPref addToBucket additionals allocManual alloc_bytes anchor_data annotations appendBytes appendGroup appendSlice appendValue application asPointerTo assistQueue attachments authorities badCharSkip batchNumber beforeFuncs best_indent bgMarkReady blackStride bodyAllowed bodyRemains bothAreDirs buildChains byNameValue byteRepeats bytesMarked bytesRemain callOptions callsFailed canceledErr canonHeader captionText charinfoNFC checkBucket checkMethod checkParent cipherSuite clearMarked clientHello closeCalled closeIfIdle closeLocked closeNotify closeStream closedNodes clusterTime codegenFreq compressBuf compression compressors computeKeys configPaths connCountMu contentType copyEntries copyNewFile cpuFillInfo createImage createIndex createdTime createstack ctrlNetwork currentPart currentSize debugFramer decodeArray decodeBasic decodeFloat decodeFlush decodeOpMsg decodeSlice decodeValue decoderTags deleteChild deleteEntry description destination dialAddress diffCompute dirtyLocked discardInfo diskBusPath disposition doBuildTree doneServing dynamicSize e_phentsize e_shentsize elseControl emitEnabled enableTrace encodeArray encodeBatch encodeCRC32 encodeDepth encodeEntry encodeFlush encodeOpMsg encodeValue endSessions endpointURL ensureNBits ensureSwept eosReceived errorString estdStreams evalCommand evalComplex evalInteger eventHijack events_head evictOldest expectOneOf extKeyUsage externalDec externalEnc fastForward filePatches fillDeflate findPrimary findfunctab finishBlock finishStack formatOctal gccheckmark gcscanvalid genPackList getAddrConn getDoneChan getFlagType getIdleConn getInt32Ptr getMoreOpts getParentIDdoMatchdoMatchexpiredYexpiredYwrapErr readdir wrapErr readdir readErrqreadErrqreadErrq goAwayDebug goLookupPTR gpuFillInfo h2transport handlerDone hasFunction hasNetHooks hasOverflow hasTrailers haveWritten heap_marked heartbeater helpCommand httpResCode idleTimeout ignoreArray ignoreLinux ignoreSlice inDigestBuf indentTrace indexTokens indirectkey initBundler initDeflate initialized inputReader inputString insertFlush insertValue ipAddresses ipv4Enabled ipv6Enabled isConnStats isConnected isH2Upgrade isIdentRune isLargeSpan it_interval keySchedule lastCharLen lastChecked lastFetched lastLineLen leadComment lengtherror lexTableKey lifeTimeout lineComment literalFreq literalType loadConfigs loadIdxFile logWithFile lookPathErr lookupCNAME lookupGroup lookupValue marshalAttr marshalCore marshalPack matchOrElse maxAttempts maxPrefetch maxReadSize maxStreamID maybeAdjust maybeConcat memFillInfo mspan_inuse multistream nStackRoots nUnreadable namedRoutes needsUpdate nestedChans netFillInfo newAddrConn newPipeline newSigstack newTemplate newVariable newoverflow nextHandled next_sample nlargealloc noListeners noldbuckets npausesweep numReturned numforcedgc objectCache objectPacks objectValue offsetEmbed oldoverflow onEachWrite onIdleTimer openChannel openGenericsuccess readdir wrapErr readdir wrapErr success overflowBuf packetsSent pairs_start parseAssign parseDotRHS parseEscape parseFilter parseRepeat parseRvalue parseString passwordSet pastHeaders pathEtcMtab pathNodeCPU pciFillInfo pendingAcks pendingData pendingTime perRPCCreds pingHandler postMessage precPresent preemptible preemptscan prefixBytes prepareRead printFooter printPacket processData processHunk processLine processPing progressive proxyForURL pushElement pushEnabled raiseErrorf readCString readConcern readEntries readFrameCh readHuffman readMessage readPreface readRequest readTimeout readTrailer readVersion readerCount receiveTime reclaimList recvContent recvMessage releaseSema releasetime removeEntry reportError reportUsage reqCanceler requestRead resetQueued resetStream resolveArgs resolveHead resumeToken retryLocked retryPolicy retryTaskIn retryWrites returnSlice rotateRight runtimehash sa_restorer safePointFn sampleCount savedOffset scalar_data scanComment scanComplex scanErrorOr scanHeredoc scheddetail sealGeneric searchTable secondLevel sendKexInit sendMessage sendRequest sentInitMsg seqNumBytes serverHello serversLock setConnFlow setDeadline setFirstRef setInt32Ptr setMapIndex setPackfile set_sigaddr set_sigcode setoverflow shouldIndex shouldRetry shouldVisit simple_keys skipCString spanContext speciallock sqrtInverse stackguard0 stackguard1 startBucket startEscape stdoutOrErr stopReading stopReqBody stopTimerCh storeLocked streamQuota stringBytes stringWidth stringsLock subChannels subexpNames subscribers synchronous syntaxError syscalltick syscallwhenpopVars@Precover@PnewBool@PnewElse@PnewList@Pbackup2@PnewText@PnewWith@Poperand@Pbackup3@PpopVars@Precover@Pbackup2@Pbackup3@Pcommand@Pcommand@PnewBool@PnewElse@PnewList@PnewText@PnewWith@Poperand@P textsectmap toBoolSlice toStringPtr toUint32Ptr toUint64Ptr tokens_head total_alloc traceIDRand trailerUsed tryAllAddrs uncacheSpan unknownType unprocessed unsetWriter unsubscribe unusedsince updateFuncs updateState updateWidth vagrantfile valsIndices valueQuoted valueToToml valueToTree waitSession waittraceev waitunlockf wakeupExtra walkAllRefs wholeRegexp withControl withinRange writeConfig writeHeader writeIndent writeKeyLog writeLength writePacket writeRecord writeString writeStruct writeSubset writeTokens writeUint16 writeUint32 writeUnlock writestring wroteHeader A@ crypto/ecdsa encoding/csv encoding/gob encoding/hex encoding/pem encoding/xml hash/adler32 internal/cpu text/scanner unicode/utf8 **git.Remote **iam.Policy **index.node **log.Logger **parse.Tree **pflag.Flag **sync.entry **token.File **trace.Span *<-chan bool *[0][]string *[0]xml.Attr *[1024]uint8 *[1025]uint8 *[113]string *[11]float32 *[126]string *[128]uint16 *[128]uint32 *[133]string *[13]float64 *[1408]uint8 *[140]uint16 *[145]uint16 *[1536]uint8 *[158]uint16 *[16]big.nat *[17]float64 *[1]ast.Node *[1]big.Word *[1]net.Addr *[2138]int32 *[2399]uint8 *[23]float64 *[252]string *[256]uint16 *[256]uint32 *[256]uint64 *[257]uint32 *[2589]uint8 *[264]uint16 *[32]uintptr *[33]float64 *[33]uintptr *[34]float64 *[396]uint32 *[4096]uint8 *[40]float64 *[456]uint16 *[512]uint32 *[540]uint32 *[64]uintptr *[65]uintptr *[67]uintptr *[8192]uint8 *[828]string *[8][2]int32 *[8][8]uint8 *[8][]string *[940]uint32 *[]*http.Dir *[]*view.Row *[][16]int32 *[][16]uint8 *[][2]string *[][2]uint16 *[][32]uint8 *[][9]uint32 *[][][]uint8 *[]bsonx.Doc *[]bsonx.Val *[]chan bool *[]chan uint *[]clog.MODE *[]complex64 *[]gob.decOp *[]gob.encOp *[]hcl.field *[]io.Closer *[]io.Reader *[]io.Writer *[]log.Field *[]os.Signal *[]struct {} *[]sync.Pool *[]tasks.Arg *[]time.Time *[]time.zone *[]tls.alert *[]token.Pos *[]user.User *agent.Agent *amqp.Config *amqp.Return *amqp.reader *amqp.writer *armor.Block *ast.Comment *base.Config *big.decimal *big.divisor *billy.Basic *bsonrw.mode *chan string *chan uint32 *chan uint64 *chroot.file *cipher.AEAD *clog.Logger *color.Alpha *color.Color *color.Model *color.NRGBA *color.YCbCr *crc32.Table *crr.syncMap *crypto.Hash *ctxio.ioret *docker.Exec *docker.Port *empty.Empty *expvar.Func *file.runner *flate.hcode *flate.token *flock.Flock *fmt.Scanner *frame.Frame *fsnotify.Op *func() bool *func() uint *func([]int) *func(error) *func(int32) *func(int64) *func(uint8) *gax.APICall *gax.Backoff *gax.Retryer *gax.grpcOpt *gax.sleeper *gcfg.setter *ghw.BusType *ghw.context *git.TagMode *git.command *git.fsBased *gob.Decoder *gob.Encoder *gob.gobType *gob.mapType *gotty.stack *grpc.jsonMC *grpc.jsonSC *grpc.parser *grpc.picker *gzip.Header *gzip.Reader *gzip.Writer *hash.Hash32 *hcl.decoder *http.Client *http.Cookie *http.Header *http.Server *http.client *http.mp4Sig *http.noBody *http2.Flags *http2.Frame *iam.Binding *image.Image *image.Point *image.YCbCr *index.Entry *index.Index *index.Stage *ini.ASTKind *io.ReaderAt *io.WriterTo *json.Number *log.Encoder *logrus.Hook *map[int]int *metadata.MD *mount.Mount *net.OpError *net.TCPAddr *net.TCPConn *net.UDPAddr *net.UDPConn *net.nssConf *net.rawConn *net.timeout *noder.Equal *noder.Noder *norm.qcInfo *object.Blob *object.File *object.Tree *openpgp.Key *os.FileInfo *os.FileMode *os.ProcAttr *os.fileStat *packp.Depth *parse.lexer *pflag.Value *primitive.A *primitive.D *primitive.E *primitive.M *proto.Sizer *proto.byTag *proto.codec *proto.field *proto.sizer *proto.xname *rand.Source *redis.Error *runtime.mOS *scram.c1Msg *scram.c2Msg *scram.s1Msg *scram.s2Msg *sha1.digest *sqs.Message *ssh.Channel *ssh.Request *ssh.Session *ssh.Waitmsg *ssh.channel *ssh.command *ssh.dhGroup *ssh.element *ssh.execMsg *ssh.forward *ssh.macMode *ssh.sshConn *stats.Begin *swarm.Swarm *sync.Locker *sync.noCopy *syntax.Inst *syntax.Prog *syntax.frag *sys.Uintreg *tag.Mutator *tag.mutator *tasks.Chain *tasks.Chord *tasks.Group *template.JS *time.Ticker *time.dataIO *tls.CurveID *tls.cbcMode *token.Token *trace.Trace *trace.event *trace.trace *unix.Linger *unix._C_int *url.timeout *uuid.Domain *v1.Platform *view.worker *viper.Viper *xml.Comment *xml.Decoder *xml.Encoder *xml.printer *yaml.byName *yaml.parser *zlib.Writer *zlib.reader AAAAResource AMQPlainAuth Acknowledged Acknowledger AddGoFlagSet AddParseTree AddReference AdjustStream AllQuestions AllowDiskUse AnswerHeader AppendFormat AppendHeader AppendString ApplyCommand ApplyOptions Architecture ArrayFilters ArtefactPath AssignableToAuthqs:"-" Authenticate AutomaticEnv Availability BatchGetItem BoolSliceVar BytesBase64P BytesHexVarP CallFunction CallsStarted CanInterface Canonicalize Capabilities Certificates CgroupDriver CheckHostKey CipherSuites ClientConfig CloseAndCopy ClusterStore CombinedMult CommitObject CompressorID ComputeRange ConfigWriter ConnectStart ConnectionID ConvertWrite CopyDocument CreateBackup CreateBranch CreateConfig CreatePlugin CreateRemote CreateSecret CreateVolume CreationTime DataPathAddr DataPathPort DatabaseName DaysToExpire Decimal128OK DecodeStatus DecodeString DecodeVarint DefaultSpace DeleteBackup DeleteBranch DeleteObject DeleteRemote DeletedCount DeliveryMode DialWithConn DiffEditCost DisableColor DockerClient DriverStatus DurationVarP ElectionTick EnablePlugin EncodeString EncodeVarint ErrorBuckets ErrorContext EscapeString ExchangeBind ExpandString ExportImages ExtendedType ExtensionMap FetchContext FieldByIndex FilterPrefix FilterRegexp FindAllIndex FindSubmatch FixedDecimal FlushHeaders FprintlnFunc FullDocument GetAttribute GetAuthority GetBoolSlice GetCookieInt GetExtension GetGoPackage GetIamPolicy GetInputType GetMessageId GetNodeRoute GetOidcToken GetOneofDecl GetPageToken GetSnapshots GetStringMap GetTaskRoute GetTimestamp GetUintSlice GetUserRoute GroupAppPath HTMLSetBytes HTTPResponse HandleStatus HandlerLimit HardwareAddr HasDollarOut HasPCLMULQDQ HasPrefixURL HeadersEnded HeadersFrame HeapReleased HelpTemplate IgnoreErrors ImageHistory IncludeFiles IndexConfigs IndexStorage InsertBefore InspectImage InspectQueue InspectSwarm IntSliceVarP IsIdentifier IsVirtualBox JavaScriptOK KernelMemory KeyExchanges KeyLogWriter LastBoundary LastSignedAt LastStreamID LifetimeSecs ListNetworks ListServices ListenConfig ListenPacket LookupIPAddr MakeInternal MatchMaxBits MatchRunePos MatchedCount MaxAwaitTime MaxExtension MaxIdleConns MaxStaleness MessageCount MessagesSent MethodByName MethodConfig MustGetInt64Nameqs:"-"Nameqs:"t" NamespaceDir NamespaceTag NewImageFrom NextBoundary NotifyCancel NotifyReturn NumberToSkip OCSPResponse ObjectDelete OnClientSide Organization OutputStream OutputTokens OverflowUint PGPSignature ParamsEscape ParamsFilled ParentHashes ParentSpanID PatchContextPathqs:"-" PauseTotalNs PrefetchSize ProcessState ProtoAtLeast ProtoMessage ProviderName PruneVolumes PseudoFields PushBackList QueryFloat64 QueryRequest QueryStrings QueueDeclare QueueInspect QuoteMapKeys RSASignature Rcv_ssthresh ReadASN1Enum ReadCodeLine ReadDateTime ReadDocument ReadDotBytes ReadDotLines ReadExtended ReadFromUnix ReadInConfig ReadObjectID ReadPipeline ReadResponse Readdirnames RecordHeader RecvCompress RegisterNode RegisterTask RemoveByName RemoveConfig RemoveOldest RemoveOption RemovePlugin RemoveSecret RemoveVolume ReplaceHooks ReportCaller RetryTimeout RoundTripOpt RuntimeError SSLCaFileSet SaltPassword SearchImages SelectServer SendCompress SerialNumber ServeContent SessionToken SetAlignment SetBackNamed SetBackupArn SetBasicAuth SetBatchSize SetCallDepth SetCollation SetEndpoints SetEnvPrefix SetFormatter SetIamPolicy SetIndexName SetItemCount SetKeepAlive SetKeySchema SetLogOutput SetMD5OfBody SetMaxEvents SetMessageId SetNextToken SetQueueName SetQueueUrls SetReference SetResponses SetReturnKey SetTableName SetTaskField SetTraceInfo SetURLPrefix SetUsageFunc ShowRecordID SignIdentity SignWithOpts SignatureKey SilenceUsage SingleBranch SkipQuestion SkipWorktree Snd_ssthresh SprintlnFunc StartAnswers StartRequest StartSession StartingFrom StatsContext StatsHandler StdinContext StreamOutput StrictErrors StringArrayP StringSliceP StringToIntP SubjectKeyId Subscription SupportsStub SystemStatus TLSNextProto TargetPrefix TaskExecutor TaskFileList TimerSeconds ToOSFileMode ToProjective ToTomlString TopContainer TraceOptions TrailersOnly TriggerChord UintSliceVar Uncompressed UnknownFlags UnmarshalKey UnmarshalXML UnpackStatus Unshareflags UpdateConfig UpdateSecret UsagePadding UseDualStack UseRefDeltas ValidateArgs VersionMajor VersionMinor VisitParents WaitForReady WatchChannel WindowChange WithEndpoint WithLogLevel WriteBoolean WriteComment WriteConcern WriteHeaders WriteMsgUnix WriteTimeout WroteHeaders WroteRequest XORKeyStream ZlibLevelSet addConnCalls addRecursive adjustParams adjustWindow advanceFrame afterContext alignedItems alpnProtocol artefactPath assignBucket asyncResults atRightDelim atTerminator atomicstatus bgScanCredit bindingIndex blockControl bothAreFiles buckhash_sys calledHeader callsStarted cancelStream canonicalize certificates charinfoNFKC checkAdvance checkDrained checkPseudos checkoutFile cipherSuites clientRandom cloneRefSpec closeChannel columnsAlign connPoolOnce consumeTimer consumeUntil contentRange context_mark conversation convertFloat convertModel convertToRGB convertWords copyTrailers coresForNode counterCrypt createBranch credentialCB currentBatch currentChain currentLines currentTable dashBoundary decodeConfig decodeDeepen decodeHeader decodeSingle decodeString decodeStruct decoderCache decompressor defaultUsage defaultValue deferpoolbuf dequeueSudoG dialParallel diffLineMode disableRetry doEarlyClose doKeepAlives doRemoveFile droppedCount earlyCloseFn editTextNode elideWrapper encodeFanout encodeFooter encodeHashes encodeHeader encodeSingle encodeStruct encryptedKey end_implicit endbufferCol enlistWorker errorContext errorHandler escapeAction escapeBranch evalFunction evalPipeline eventMonitor extensionMap extraHeaders fieldIndexes finishedHash firstAttempt firstErrLine firstRefHash firstRefName flagErrorBuf footerParams forceRefresh formatHeader formatString gcAssistTime gcpacertrace generatePath getDataFrame getExpiresIn getSessionID getTransport gfreeNoStackwriteBufqwriteBufqwriteBufq globNormFunc globalSentMu goAwayReason goLookupHost goidcacheend handleGoAway handlePacket handshakeErr hasMDNSAllow hasURLPrefix hasmarshaler headerMaxLen headerParams heap_objects helpTemplate hijackLocked hitReadLimit hpackEncoder huffmanBlock idleDeadline idleMarkTime ignoreSingle ignoreStruct ignorerCache indexObjects initConnPool input_reader insertSingle insertUnsafe interfaceVal interspersed isHeaderSent isMessageSet isNoColorSet isRegistered isReplayable isSubscribed keyMarshaler kindDecoders kindEncoders lastBoundary lastRuneSize last_gc_unix leadingSpace linktimehash listenStream literalStore logListeners logThreshold lookupString lookupUnsafe makeSpanData mappingSlice markDoneSema markrootDone markrootJobs markrootNext marshalValue masterSecret matchSubtree maxExtension maxFrameSize maxIdleConns maxListeners maxSizeLimit maxStaleness maxTokenSize maxWriteSize mcache_inuse measurements mergeFlatMap methodConfig modulehashes morePointers multiSegment mustReadRune needsQuoting newChildNode newSubmodule newTLSConfig nextBoundary nextCharFreq nextNonSpace nextOverflow nextPackData nextPairFreq nextProtoErr nextProtoNeg nextStreamID nmidlelocked notAFunction noteBodyRead ocspResponse ocspStapling offsetToType onePassRunes openComplete originalHash originalSize originalTypeuserTime sysUsage userTime sysUsage outDigestBuf overflowTime packetCipher paniconfault parseComment parseControl parseElGamal parseLongArg parseNumeric parsedTarget pastTrailers pathSysBlock peekNonSpace pendingNacks prefixFormat preparePanic prepareRetry prepareWrite prevGoAwayID printCaption printColored printHeading printMessage problem_mark processFrame productTable protoAtLeast proxyAddress proxyNetwork pullMessages pushDocument quoteMapKeys quotedString rangeControl rawStatusMsg readChecksum readCodeLine readFinished readResponse readSelector readUnsigned read_handler readdirnames recordBuffer recvCompress recvMessages reflectValue reflexivekey registerConn releaseEntry removeOldest removeServer replacements reportOutput reportStatus reqHandshake requireIndex rescheduling resetBackoff resolverFunc root_context rsaDecryptOk sameSizeGrow scalar_style scanExponent scanFraction scanMantissa searchInPath seenExternal selectServer sendAckIDRPC sendCompress sendFinished sendServeMsg serverOffset serverRandom sessionState setBlacklist setConnState setIsSampled setMarshaler setReadLimit setRefNorwfs sha1Checksum shutdownOnce shutdownSema shuttingDown simpleLruMap skipResource sortedActual sortedFormal srcBufOffset stacks_inuse startedWrite statsHandler stderrCloser strictErrors subtreeBytes sumOfSquares sweepWaiters sysexitticks systemConfig systemVerify takeOverflow targetSchemepipeline@PitemList@PnewChain@PnewField@PnewRange@Ppipeline@PitemList@PnewChain@PnewField@PnewRange@P textOrAction timeToUint32 timersBucket toBytesSlice toExtensions toFloat32Ptr toFloat64Ptr toInt64Slice toIsEmptyDir toWireFormat token_number tokensBuffer traceHeaders transitional triggerRatio tryBacktrack tryToDeltify tryWriteCopy typeDecoders typeEncoders unmarshalKey unmarshalVal unrecognized updateBlocks updatePicker updateWindow useRefDeltas useSTD3Rules v1extensions valMarshaler validSession validateType waitCanceled waitOnHeader walkIfOrWith walkTemplate wantBlockCRC writeBuffers writeConcern writeHeaders writeMessage writePadding writeRawFile writeTimeout writeWaiters writingFrame wroteFrameCh wroteHeaders wroteRequest  compress/gzip compress/zlib crypto/cipher crypto/sha256 crypto/sha512 encoding/asn1 encoding/json html/template internal/poll net/textproto path/filepath regexp/syntax text/template **ast.Comment **frame.Frame **http.Cookie **iam.Binding **index.Entry **object.Tree **parse.lexer **sqs.Message **ssh.channel **trace.trace *[0]bsonx.Doc *[0]bsonx.Val *[0]hcl.field *[100]uintptr *[128]float32 *[128]uintptr *[14592]uint8 *[19105]uint8 *[1]bsonx.Doc *[1]bsonx.Val *[1]io.Reader *[1]io.Writer *[1]log.Field *[1]tasks.Arg *[1]time.zone *[2138]string *[2304]uint16 *[256][]uint8 *[256]float32 *[2]io.Reader *[2]io.Writer *[2]log.Field *[2]os.Signal *[3008]uint16 *[3][9]uint32 *[3]io.Writer *[4][16]uint8 *[508]uintptr *[512]uintptr *[5952]uint16 *[5]sync.Pool *[65008]uint8 *[65536]uint8 *[8128]uint16 *[8]*http.Dir *[8]bsonx.Val *[8]chan uint *[8]clog.MODE *[8]gob.decOp *[8]struct {} *[8]time.Time *[8]tls.alert *[8]token.Pos *[91][2]int32 *[]*agent.Key *[]*diff.hunk *[]*flag.Flag *[]*gob.decOp *[]*gob.encOp *[]*http.conn *[]*net.IPNet *[]*runtime.g *[]*runtime.p *[]*sync.Pool *[]*toml.Tree *[]*yaml.node *[][64]uint32 *[][][]string *[]bidi.Class *[]billy.File *[]bsonx.Elem *[]clog.LEVEL *[]codes.Code *[]complex128 *[]cpu.option *[]diff.Chunk *[]gob.typeId *[]jpeg.block *[]json.field *[]net.IPAddr *[]net.ipAttr *[]nodes.Node *[]parse.Node *[]parse.item *[]regexp.job *[]ssh.Signal *[]ssh.Signer *[]swarm.Node *[]swarm.Peer *[]swarm.Task *[]tar.Format *[]toml.token *[]trace.Link *[]yaml.field *agent.client *amqp.Backend *amqp.Channel *amqp.Decimal *amqp.message *argon2.block *asn1.encoder *ast.ListType *ast.WalkFunc *atomic.Value *awserr.Error *big.Accuracy *billy.Chroot *bson.Decoder *bson.Encoder *bufio.Reader *bufio.Writer *bytes.Buffer *bytes.Reader *bytes.readOp *bzip2.reader *cache.Object *cache.buffer *cast5.Cipher *cexp.Counter *chan []uint8 *chan<- error *cipher.Block *clog.Adapter *clog.Factory *clog.Message *clog.console *clog.discord *color.Gray16 *color.RGBA64 *command.Find *command.Read *crc32.digest *crr.Endpoint *docker.Error *docker.Image *docker.Mount *docker.State *docker.Stats *driver.Value *dynamodb.Get *dynamodb.Put *dynamodb.Tag *file.command *flag.FlagSet *flate.Reader *flate.Writer *flate.byFreq *fmt.Stringer *fmt.fmtFlags *fmt.readRune *frame.byName *func() error *func() int32 *func() int64 *func() uint8 *func(func()) *func(string) *func(uint32) *func(uint64) *git.LogOrder *git.Worktree *gob.decInstr *gob.encInstr *gob.gobError *gob.typeInfo *gob.wireType *gotty.parser *grpc.payload *grpc.rpcInfo *http.Flusher *http.Handler *http.Request *http.connLRU *http.dialRes *http.htmlSig *http.session *http.textSig *http2.Framer *iam.RoleName *idna.Profile *idna.options *iface.Broker *image.Config *image.format *index.byName *interface {} *io.eofReader *io.teeReader *jpeg.decoder *jpeg.huffman *json.Decoder *json.byIndex *json.encOpts *json.scanner *list.Element *logrus.Entry *logrus.Level *macaron.Leaf *macaron.Tree *mongo.Client *mongo.Cursor *mount.Driver *net.DNSError *net.Listener *net.Resolver *net.UnixAddr *net.UnixConn *net.addrList *net.sockaddr *noder.Hasher *norm.nfcTrie *object.Patch *os.LinkError *os.PathError *packp.Action *parse.IfNode *path.lazybuf *peer.peerKey *poll.fdMutex *poly1305.mac *proto.Buffer *proto.Merger *proto.custom *proto.tagMap *proto.writer *pubsub.Topic *redis.Script *reflect.Kind *reflect.Type *reflect.flag *reflect.name *regexp.entry *regexp.input *regexp.queue *revision.Ref *rsa.CRTValue *runtime.Func *runtime.bmap *runtime.hmap *runtime.itab *runtime.name *runtime.note *scanner.Mode *schema.Route *scram.Client *scram.Server *session.Node *session.Pool *session.Type *sort.reverse *ssh.cbcError *ssh.chanConn *ssh.chanList *ssh.noneAuth *strings.span *swarm.Config *swarm.Driver *swarm.Secret *sync.RWMutex *sync.rlocker *syntax.Error *syntax.Flags *syscall.Conn *tag.Metadata *tar.headerV7 *template.CSS *template.URL *term.Winsize *time.Weekday *tls.halfConn *tls.listener *tls.ssl30MAC *tls.tls10MAC *toml.Decoder *toml.Encoder *toml.encOpts *topology.fsm *trace.Config *trace.SpanID *trace.Status *trace.bucket *trace.family *trace.lruMap *unix.TCPInfo *unix.Termios *unix.Timeval *unix.Winsize *unix.mmapper *url.Userinfo *url.encoding *uuid.Variant *uuid.Version *v4.blacklist *v4.whitelist *view.AggType *view.SumData *view.command *xml.CharData *xml.ProcInst *xml.typeInfo *yaml.MapItem *yaml.byIndex *yaml.decoder *yaml.encoder *yaml.keyList AMQPConnector AcceptableCAs ActiveReports AddAttributes AddConfigPath AddPermission AdvertiseAddr AllReferences AllowEmptyEnv AppendSection ArgsLenAtDash AssignDecimal AuthMechanism Authoritative Authorization AverageRTTSet BindFlagValue BlockFragment BoolSliceVarP BoundaryAfter BucketOptions ByteThreshold BytesReceived CNAMEResource CancelRequest CanonicalAddr CharsetReader CheckRedirect ChordCallback CleanOriginal ClearBuildLog ClearComments ClientStreams ClientVersion ClockSequence CodeWithScope CommitObjects CompressBytes ConfigStorage ConsumerCount ContainerPath ContentLength ConvertibleTo CorrelationId CreateNetwork CreateService CumulativePct DecodeElement DecodeFixed32 DecodeFixed64 DecodeMessage Decomposition DefaultCipher DeleteMessage DescribeTable DiffFromDelta DiffHalfMatch DiffMainRunes DisableColors DisablePlugin DockerRootDir DocumentCount Documentation DurationNanos DurationSlice EncodeElement EncodeFixed32 EncodeFixed64 EncodeMessage EncodedObject EndpointCache ErrorHandling ExchangeChans ExtensionName ExtensionType FallbackDelay FanoutMapping FindAllString FirstBoundary FlagErrorFunc FullTimestamp GCCPUFraction GetAllowAlias GetAnnotation GetAttributes GetClientConn GetDependency GetDeprecated GetExpireTime GetExtensions GetMessageIds GetMethodName GetNestedType GetOneofIndex GetOutputType GetPrivileges GetPushConfig GetSourceFile GetStatsRoute GetStatusCode GetSubChannel GetTokenRoute GetUpdateMask GracefulClose HTMLSetString HandleStreams HasDuplicates HasErrorLabel HasLocalFlags HasSubsection HeaderEncoder HeartbeatTickID json:"ID"ID json:"Id"ID json:"id" IgnoreMissing ImagesDeleted ImagesToClean InsertedCount InspectConfig InspectSecret InspectVolume InterfaceData Intermediates InternalFetch InternalProto IsForceUpdate IsUnspecified KernelVersion KeysByIdUsage KillContainer LastErrorTime LastWriteTime Last_ack_recv Last_ack_sent LatestBuckets ListDatabases ListQueueTags ListSnapshots ListenSockets LiteralPrefix LoggingDriver LookupDecoder LookupElement LookupEncoderM type:"map" MarkWantWrite MarshalBinary MatchAlphabet MatchDistance MaxBatchCount MaxPacketSize MergeInConfig MessageEvents MessageLength MessageTypeId ModifiedCount ModuleStorage MultipartForm MustGetString MustGetUint64 NewClientConn NewObjectPack NormalizePath NotifyBlocked NotifyConfirm NotifyPublish NumGoroutines NumMaxRetriesOK bson:"ok"OS json:"os" ObjectPackIdx ObjectStorage ObjectsToPack OperationTime OverflowFloat ParamsFloat64 ParentContext PatchDeepCopy PatchFromText PatchSplitMax PostFormValue PreferredHash PrefetchCount PrintDefaults PriorityParam ProbablyPrime PruneNetworks PushBackNamed PushFrontList ReadASN1Bytes ReadDBPointer ReadLineBytes ReadTimestamp ReadUndefined ReferenceName RegisterAlias RegisterCodec RegisterTasks RegularFields RemoveCommand RemoveHandler RemoveManager RemoveNetwork RemoveProfile RemoveSection RemoveService RemoveSubConn Renegotiation RepackObjects RequestMethod ResetCommands ResetIterator ResizeExecTTY ResolveMounts ResponseFlags ReturnSession SecretKeyring SectionReader SeekFromStart SelfSignature ServerStreams ServerVersion ServiceConfig SessionKeyLen SetAnnotation SetAttributes SetAverageRTT SetBackground SetBackupName SetBackupType SetBucketSize SetBufferBody SetConfigFile SetConfigName SetConfigType SetControllen SetCursorType SetFrontNamed SetHeaderLine SetPolicyName SetProjection SetPutRequest SetReadBuffer SetReaderBody SetRegionName SetRemoteAddr SetScanFilter SetStateRetry SetStringBody SetSuccessful SetTableNames SetTagComment SetTaskOutput SetTaskResult SetTaskStatus SetsockoptInt SettingCreate SettingRemove SettingUpdate ShallowUpdate ShallowWriter ShowSensitive SignWithFlags SigningMethod SigningRegion SilenceErrors SkipAuthority SocketOptions SocketTimeout SphereVersion StartResponse StartedAccess StdoutContext StopConsuming StopContainer StorageCreate StorageDelete StorageEngine StreamingPull StreamsFailed StreetAddress StringValueOK SubscriptionsTagqs:"tag" ToRDNSequence Total_retrans TrailingComma TreeEntryFile UintSliceVarP UnmarshalBSON UnmarshalJSON UnmarshalMeta UnmarshalText UnmarshalYAML UntagResource UpdateContext UpdateService UpdateUseTime UploadPackBin UploadRequest UpsertedCount UsageTemplate WaitContainer WebHookCreate WebHookDelete WithTransport WrappedErrors WriteArrayEnd WriteConfigAs WriteDateTime WriteDocument WriteExtended WriteObjectID WritePriority WriteRawFrame WriteSettings XXX_Unmarshal ZeroReadIsEOF activeStreams addConnLocked addGzipHeader addSubChannel advMaxStreams advanceString allowEmptyEnv alpnProtocols appendMapping appendPointer applySettings applyToSingle argsLenAtDash averageRTTSet beforeContext blockFillInfo block_allowed bodyReadError byteAvailable bytesReceived cachesForNode calculateHash cancelRequest caseSensitive cgoCallersUse checkCanParse checkPipeline checkRedirect checknonempty cleanPackList clientKexInit clientSession clientVersion closeNotifyCh closeWhenIdle collectedRows columnsParams combineHangul commitAttempt compatibility compileSingle complexTokens compressorMap computeOutCtx connPoolOrDef consumeNumber contentLength convertNumber convertString createContext createSubTree currentCommit declBodyBytes decodeACKLine decodeDefault decodeHuffman decodeOpReply decodeQuantum decodeShallow decodeVersion decryptTicket deriveCounter deterministic didEarlyClose diffHalfMatch diffMainRunes diffieHellman diskSizeBytes dnsDebugLevel emitWithValue encodeEntries encodeHeaders encodeOffsets encodeOpQuery encodeOptions encodeSection encodeShallow encodedObject readSliceq encryptTicket encryptedData encryptedMPI1 encryptedMPI2 encryptionKey endbufferLine endpointCache endpointLimit errorHandling establishKeys evalChainNode evalFieldNode excludeHeader executeAndPut expNNWindowed fallbackDelay fillAlignment finalTrailers findHashIndex finishRequest firstBoundary firstZoneUsed flagErrorFunc footerWritten formatNumeric functionTable gcAssistBytes genObjectList genOffsetHash getClientConn getConfigFile getConfigType getIdleConnCh getInt32Slice getMeasureRef getNextObject getNotifyChan getObjectSize getObjectType getTableWidth getTrAuthData getWriteError doExecute doExecute sendAlert$ sendAlert$ closeBody( closeBody( goAwayHandler goLookupCNAME handleCommand handleMethods handlerHeader hasFileChange hasprotosizer headerFragBuf headerHandler headerWritten heap_released heredocIndent idealConstant incrnoverflow indirectvalue insertOrdered isCheckmarked isReceivePack isSpanInTreap itemSliceZero leadingRegexp leadingString legacyGetMore listenSockets lruAttributes mappingStruct mapping_style markStartTime marshalSimple marshalStruct marshalWriter maxElectionID maxSetVersion maxTableIndex messageEvents messageMaxLen missingMethod monitorEvents mutualVersion needkeyupdate needsContinue nestedContext newClientConn newHttpClient newInputBytes nextFreeIndex nextProtoOnce normalSockets numAttributes numConnecting objectsToPack oldExtensions oldbucketmask onCloseCalled onIdleTimeout openWithRetry orderedActual orderedFormal outSubpackets output_buffer output_writer parentsPflags parseShortArg partitionInfo partitionType pendingObject pendingUpdate pickerBuilder popParseState previousState problem_value processGoAway processorsGet rawJSONStream rawJSONString rawStatusCode rawSubpackets readASN1Int64 readBytesLeft readEntryName readExtension readFromBlock readFromUntil readHandshake readLineSlice readMetaFrame readOnePacket readSignature realReplenish receiveActive receiveExtend registerAlias remoteAddrStr removeElement replaceServer replyToWriter reqBodyClosed reqDidTimeout requestedGzip reserveLength resetWorktree resolveDeltas resolveObject safePointNote safePointWait scanFirstLine scanRawString scanValString secretKeyring seenTableKeys sentRequestMu serverKexInit serverVersion serversClosed sessionTicket setAuthHeader setFieldProps setHEADCommit setInt32Slice shutdownTimer stackExpander startingtrace stopContainer strAttributes streamingPull streamsFailed subpacketType successfulRPC taskSucceeded terminateCell stopParse@P ifControl@P newAction@P newNumber@P newString@P stopParse@P ifControl@P newAction@P newNumber@P newString@P textNodeEdits toStringSlice toUint32Slice toUint64Slice tokenValueEnd tokens_parsed topologyNodes traceRefCount trackListener transactionRc transactionRp transactionWc triggerDelete uncompressBuf unmarshalAttr unmarshalCore unmarshalPack unmarshalPath unwrapPointer updateRequest updateShallow updateTimeout updateUseTime usageTemplate validateLabel valueFromToml valueFromTree waitContainer waittraceskip windowHandler withoutOption writeDeadline writeLoopDone writePackfile writeSelector write_handler writerScanner wroteContinue xGoogMetadatacompress/bzip2compress/flatecontainer/listmime/multiparttext/tabwriter**amqp.Channel**bytes.Buffer**dynamodb.Tag**flag.FlagSet**gob.typeInfo**http.Request**list.Element**macaron.Leaf**macaron.Tree**net.Listener**pubsub.Topic**runtime.itab**session.Node**trace.bucket**trace.family**url.Userinfo*[0]*sync.Pool*[0][][]string*[0]bsonx.Elem*[0]json.field*[0]yaml.field*[1000]uintptr*[10][2]uint16*[12][16]uint8*[16384]uint16*[16][16]int32*[1]bsonx.Elem*[1]json.field*[1]net.IPAddr*[1]parse.Node*[1]yaml.field*[25]gob.decOp*[25]gob.encOp*[262144]uint8*[2]bsonx.Elem*[2]codes.Code*[32768]uint32*[3]bsonx.Elem*[3]parse.item*[4]bsonx.Elem*[4]jpeg.block*[8]*flag.Flag*[8]*gob.decOp*[8]*gob.encOp*[8]*http.conn*[8]*sync.Pool*[8]*yaml.node*[8][64]uint32*[8]bidi.Class*[8]billy.File*[8]clog.LEVEL*[8]codes.Code*[8]gob.typeId*[8]ssh.Signal*[8]tar.Format*[]*aws.Config*[]*git.Remote*[]*hpack.node*[]*index.node*[]*log.Logger*[]*parse.Tree*[]*pflag.Flag*[]*sync.entry*[]*token.File*[]*trace.Span*[][256]uint32*[][]bsonx.Doc*[]big.divisor*[]bsonrw.mode*[]chan string*[]crc32.Table*[]crypto.Hash*[]docker.Port*[]flate.hcode*[]flate.token*[]func(error)*[]gcfg.setter*[]ghw.BusType*[]gob.gobType*[]grpc.jsonMC*[]http2.Flags*[]index.Stage*[]ini.ASTKind*[]logrus.Hook*[]metadata.MD*[]mount.Mount*[]noder.Noder*[]openpgp.Key*[]os.FileInfo*[]primitive.E*[]syntax.Inst*[]tag.Mutator*[]tls.CurveID*[]token.Token*[]trace.event*[]unix._C_int*[]v1.Platform*aes.aesCipher*agent.wireKey*amqp.Blocking*amqp.Delivery*amqp.basicAck*amqp.basicGet*amqp.basicQos*amqp.confirms*amqp.txCommit*amqp.txSelect*anagent.Timer*argon2.scheme*asn1.RawValue*ast.ObjectKey*aws.JSONValue*bcrypt.hashed*bcrypt.scheme*bidi.bidiTrie*billy.Capable*billy.Symlink*bson.RawValue*bsonrw.Copier*bsontype.Type*bufio.Scanner*cipher.Stream*client.Client*clog.receiver*cobra.Command*color.Alpha16*color.NRGBA64*color.NYCbCrA*command.Count*command.Error*command.Write*common.client*config.Branch*config.Config*config.Option*crypto.Signer*des.desCipher*digest.Digest*dns.rawChoice*docker.Change*docker.Client*docker.Config*docker.Device*docker.Dialer*docker.ErrMsg*docker.Health*docker.RootFS*docker.Signal*docker.ULimit*docker.Volume*docker.stream*dotgit.DotGit*driver.Valuer*dsa.PublicKey*errcode.Error*flag.boolFlag*flag.intValue*fmt.Formatter*fmt.ScanState*fmt.scanError*func() net.IP*func() string*func() uint16*func() uint32*func() uint64*func([]uint8)*func(float64)*func(ini.AST)*func(int) int*func(uintptr)*gax.boRetryer*ghw.DriveType*git.ResetMode*git.Submodule*gob.arrayType*gob.decBuffer*gob.decEngine*gob.decHelper*gob.encBuffer*gob.encEngine*gob.encHelper*gob.fieldType*gob.sliceType*gotty.stacker*grpc.Streamer*grpc.addrConn*grpc.callInfo*grpc.jsonName*hpack.Decoder*hpack.Encoder*http.Hijacker*http.Response*http.SameSite*http.ServeMux*http.canceler*http.exactSig*http.muxEntry*http.response*http.sniffSig*http2.ErrCode*http2.Setting*idna.idnaTrie*idtools.IDMap*idxfile.Entry*idxfile.Index*iface.Backend*image.Uniform*index.Decoder*index.Encoder*ini.TokenType*ini.ValueType*io.ByteReader*io.ByteWriter*io.PipeReader*io.PipeWriter*io.ReadCloser*io.ReadSeeker*io.ReadWriter*io.ReaderFrom*io.RuneReader*log.fieldType*logging.Color*logging.Level*logging.level*logrus.Fields*logrus.Logger*macaron.Route*macaron.group*map[uint8]int*mongo.Session*net.AddrError*net.Interface*net.byRFC6724*net.dnsConfig*net.nssSource*net.sysDialer*net.temporary*norm.formInfo*norm.iterFunc*norm.nfkcTrie*object.Change*object.Commit*object.Object*optional.Bool*packet.Config*packet.Packet*packet.Reader*packet.UserId*packp.AdvRefs*packp.Command*packp.stateFn*parse.DotNode*parse.NilNode*parse.endNode*parse.stateFn*parser.Parser*pflag.FlagSet*pflag.ipValue*plumbing.Hash*poll.pollDesc*proto.Message*proto.pointer*pubsub.Client*rand.Source64*readpref.Mode*reflect.Value*reflect.rtype*reflect.tflag*reflect.visit*regexp.Regexp*regexp.thread*result.Delete*result.Insert*result.Update*result.Upsert*rsa.PublicKey*runtime.Error*runtime.Frame*runtime._func*runtime._type*runtime.eface*runtime.gobuf*runtime.hchan*runtime.hiter*runtime.iface*runtime.mheap*runtime.mlink*runtime.mspan*runtime.mutex*runtime.scase*runtime.slice*runtime.stack*runtime.sudog*runtime.tflag*runtime.timer*runtime.waitq*runtime.wbBuf*scanner.Error*server.Loader*server.server*session.state*sha256.digest*sha512.digest*sideband.Type*simplelru.LRU*sort.IntSlice*sort.lessSwap*ssh.ExitError*ssh.PublicKey*ssh.Signature*ssh.cbcCipher*ssh.direction*ssh.gcmCipher*ssh.kexResult*ssh.signalMsg*ssh.sshConfig*ssh.transport*ssh_config.KV*stats.ConnEnd*stats.Handler*stats.Measure*stats.Options*status.Status*storer.Storer*swarm.Network*swarm.Service*swarm.TLSInfo*swarm.Version*sync.readOnly*syntax.InstOp*syntax.Regexp*syntax.parser*syntax.ranges*syscall.Errno*syscall.Iovec*tag.metadatas*tar.formatter*tar.headerGNU*tasks.Headers*template.HTML*template.attr*template.kind*time.Duration*time.Location*tls.ticketKey*token.FileSet*toml.Position*toml.sortNode*toml.tomlOpts*trace.Sampler*trace.TraceID*trace.minCond*types.IntMode*units.unitMap*unix._Socklen*url.temporary*user.Identity*user.UserForm*user.lineFunc*v1.Descriptor*view.Exporter*warnings.List*x509.CertPool*x509.KeyUsage*x509.validity*xml.Directive*xml.Marshaler*xml.fieldInfo*yaml.IsZeroerAllAdditionalsAllAuthoritiesAppendBuildLogAuthorityKeyIdB type:"blob"BackToOriginalBannerCallbackBatchWriteItemBindFlagValuesBoundaryBeforeBreakWithErrorBytesBase64VarCallsSucceededChannelzMetricCheckSignatureChildSpanCountCloseWithErrorCollectionNameCombinedOutputConfigqs:"-"ConfigFileUsedConnectNetworkConnectTimeoutContentSubtypeCountDocumentsCountLooseRefsCountPerBucketCountThresholdCreateFormFileCreateSnapshotCredentialSpecDecodeDocumentDecodeRawBytesDecodeZigzag32DecodeZigzag64DecryptionKeysDefaultRetryerDefaultRuntimeDefaultSamplerDelayThresholdDeleteProducerDeleteSnapshotDescribeBackupDescribeLimitsDiffPrettyHtmlDiffPrettyTextDisableSortingDiscardUnknownDurationSlicePEastAsianWidthEmailAddressesEmitLazyLoggerEncodeRawBytesEncodeToStringEncodeZigzag32EncodeZigzag64EntrypointListEnumDescriptorExchangeDeleteExchangeUnbindFindImageInHubForeachSettingForgetUnsharedFullMethodNameGetBytesBase64GetCertificateGetClusterTimeGetCookieInt64GetDescriptionGetDoubleValueGetIsExtensionGetItemRequestGetJavaPackageGetMaxMessagesGetMessageTypeGetOptimizeForGetOrderingKeyGetPermissionsGetPublishTimeGetRubyPackageGetServiceLogsGetSizeInBytesGetStringArrayGetStringSliceGetStringToIntGetStringValueGetSwiftPrefixGetTopChannelsGetWithTimeoutGot100ContinueGot1xxResponseGroupCompletedGroupTaskCountHTTPStatusCodeHandleTaskStopHasCountAndSumHasSubCommandsHasTemplateSetID bson:"_id"IPv4ForwardingInheritedFlagsInitialBackoffInspectPluginsInspectServiceInstallPluginsIntDecodeValueIntEncodeValueInterpolationsIsErrorExpiredIsLevelEnabledIsNormalStringIsOrganizationIterReferencesKeepAlivesSentL type:"list"LastUpdateTimeLast_data_recvLast_data_sentLatencyBucketsListContainersListenAndServeLocalNodeStateLocalThresholdMapDecodeValueMapEncodeValueMarkDeprecatedMarkFlagCustomMarshalXMLAttrMatchThresholdMaxHeaderBytesMaxMessageSizeMaxPathLenZeroMaxPoolSizeSetMaxRecvMsgSizeMaxSendMsgSizeMergeConfigMapMulticastAddrsMustGetFloat64NameAndAliasesNamespaceCloneNewPlanFromMapNewTaskFromMapNumberReturnedNumberToReturnOnConfigChangeOnlyCachedConnOomKillDisableOriginalOpCodePackfileWriterPartialSuccessPauseContainerPipelineCreatePipelineDeletePortMappingAPIPresignRequestPurgeGroupMetaPushFrontNamedPutItemRequestRawDecodeValueRawEncodeValueReadBufferSizeReadDecimal128ReadJavascriptReadMIMEHeaderReadPreferenceReadValueBytesReceiveMessageReceivePackBinRegistryConfigRekeyThresholdRemoteManagersRemoveIdentityRemoveListenerReplaceAllFuncRequestOptionsRequiredNotSetResponseToHEADResponseWriterRetryWritesSetRetryingCommitReturnDocumentRevocationTimeRoundedIntegerSELinuxContextSSLInsecureSetScalarBaseMultSearchImagesExSeekToSnapshotServerResponseSetBackfillingSetBaggageItemSetBillingModeSetBinaryValueSetColMinWidthSetColumnColorSetEmitEnabledSetEnvironmentSetFooterColorSetHeaderColorSetHelpCommandSetIndexStatusSetMessageBodySetOplogReplaySetQueryFilterSetReadConcernSetReplacementSetResourceArnSetResumeAfterSetReuseFramesSetSenderFaultSetStringValueSetTableStatusSetTargetValueSetTextVersionSetWithCommentSetWithOptionsSetWriteBufferSetsockoptByteShallowStorageSignatureValueSkipAdditionalSkipAllAnswersSpaceReclaimedStandardOutputStartConsumingStartContainerStartQuestionsStreamsStartedStrictMatchingStringArrayVarStringSliceVarStringToIntVarStringToStringSubsampleRatioSuggestionsForTBSCertificateTextMarshalerTTimeDifferenceTopicInProjectTryLockContextURLDecodeValueURLEncodeValueUnknownOptionsUnmarshalErrorUnmarshalExactUpdateSnapshotUploadArtefactVerifiedChainsVerifyHostnameVerifyPasswordVolumesDeletedWhiteoutFormatWithDisableSSLWithHTTPClientWithMaxRetriesWithSleepDelayWriteDBPointerWriteRSTStreamWriteTimestampWriteUndefinedXXX_OneofFuncsacceptRunUntiladdLineNumbersaddMeasurementaddNextSegmentaddRefFromHEADadditionalDataaddtimerLockedadobeTransformallocfreetraceallowedFormatsallowedMaxSizeappendKeyValueapplyToShardedapplyToUnknownarenaHintAllocarrayInterfaceautoMergeCellsbackgroundReadbannerCallbackblockingpickerboolAttributesbySubjectKeyIdcallsSucceededcanCheckPrefixcanWriteRecordchannelzMetriccheckRefFormatcheckoutChangecleanedPatternclientCertPassclientFinishedclientProtocolcloseAfterWaitcloseIdleConnscloseListenerscloseNotifyErrcloseWithErrorcompatibleTypecompressorTypeconnectTimeoutconnectionOptsconsumeCommentconsumeLiteralcontentSubtypecontentTypeErrcountRemainingcreateAudiencecreateOverflowcreateReadPrefcurOpenStreamsdebugFramerBufdecIgnoreOpFordeclareTrailerdecodeCommandsdecodeDocumentdecodeObjectAtdefaultRetryerdeltaBaseCachedeltaSizeLimitdescribeStructdialClientConndialTLSDefaultdidCloseNotifydiffHalfMatchIdiskNUMANodeIDdiskPartitionsdispatchCloseddoAddDirectorydomainMatchersdoubleJacobianeditActionNodeemailAddressesencodeCommandsencodeDocumentencodeShallowsencodeTrailersendStreamErrorenvKeyReplacerescapeTemplateevalFieldChainextensionsReadfindConfigFilefindNamespacesfindPackedRefsforgetStreamIDfreeSpanLockedfromIsEmptyDirgcBgMarkWorkergcrescanstacksgcstoptheworldgetCertificategetDerivedKeysgetExtElemInfogetLookupGroup allMatches replaceAll replaceAll allMatches readRecord$ readRecord$ maxVersion$ minVersion$ serverInit$ ticketKeys$ maxVersion$ minVersion$ serverInit$ ticketKeys$ wantsClose( wantsClose( checkValid  checkValid gobDecodeOpForgoodSuffixSkipgrowIfRequiredhandleChannelshandleForwardshandleResponsehandleSettingshandlerWrapperhandshakeMutexhasAMQPBackendhasRecentErrorhdrListSizeErrheaderWriteBufheapArenaAllochttp2TransportincrefAndCloseinitSemaphoresinitialBackoffisValidCommandlast_anchor_idlexLeftBracketlistenDatagramlistenUnixgramlocalThresholdlookaheadTokenlookupGroupCtxmanualFreeListmapEncodeValuemarshalRemotesmaxBitStateLenmaxHeaderBytesmaxInsertIndexmustBeExportednewInputReadernewInputStringnextPageCallednextPageTokensnlDashBoundaryobjectAtOffsetobjectPackOpenobjectPackPathoffsetEncodingonConfigChangeonWriteTimeoutoperateHeaders systemTime  checkValid  checkValid  systemTime outgoingLengthparseBodyFrameparseClassCharparseDimensionparsePerlFlagspause_total_nspendingModAckspendingPacketspersistentFlagpickTLSVersionpreTaskHandlerprefixCompleteprepareForReadpreprocessDataproblem_offsetprocessHeadersprocessSettingprocresizetimeprojectIfSlicepushParseStateraw_buffer_posreadASN1BigIntreadASN1Uint64readAdditionalreadBase128IntreadCloseErrorreadExtensionsreadPayloadLenreadPreferencerecentPositionreleaseChannelremoveAddrConnremoveIdleConnremoveListenerreplaceOptionsreplicaSetNameresHeaderValidresetTransportresourceHeaderretryThrottlerreverseBracketrotateFilenamerunSafePointFnscanBasePrefixscanIdentifiersendActualTypesentContentLensentInitPacketsequence_styleserverFinishedserverInitOncesetCheckmarkedsetCipherSuitesetErrorLockedsetExpAndRoundsetFromScannersetRawTerminalsetReqCancelershouldThrottlesingleLineListsizeExtensionssizeMessageSetskipWhitespacestartContainerstart_implicitstreamsStartedsupportSymrefsswitchBalancerswitchToReadersysblocktracedtag_directivestemplateV7Plus startParse@P unexpected@P newCommand@P startParse@P unexpected@P endControl@P newCommand@P endControl@PtoFloat32SlicetoFloat64SlicetraceBufHeadertraceReclaimedtryAcquireSematryLoadOrStoretryPutIdleConntryUpdateAddrstypeByDefValueunderlyingPathunmarshalDepthunreadLastCharunregisterConnunregisterViewupdateLastSeenuseJSONDecodervagrantCommandvalCachedSizervalidateLabelsvalidateServervalidateTargetvalueInterfaceverifiedChainswaitBuildIndexwaitNextSamplewaitingStreamswalkObjectTreewireMessageBufwriteBlockHuffwriteBytesLeftwriteExtensionwriteGNUHeaderwritePAXHeaderwriteProto3AnywriteRawHeaderwriteToOrderedcrypto/ellipticencoding/base64encoding/binary**anagent.Timer**ast.ObjectKey**cobra.Command**command.Write**config.Branch**config.Option**dotgit.DotGit**git.Submodule**gob.decEngine**gob.fieldType**grpc.addrConn**http.Response**idxfile.Entry**net.dnsConfig**object.Change**object.Commit**packp.Command**reflect.rtype**regexp.Regexp**regexp.thread**runtime._type**runtime.hchan**runtime.mspan**runtime.sudog**runtime.timer**scanner.Error**syntax.Regexp*[0][]bsonx.Doc*[0]noder.Noder*[0]primitive.E*[131072]uint32*[15]cpu.option*[16]bidi.Class*[1]*aws.Config*[1]bsonrw.mode*[1]metadata.MD*[1]tag.Mutator*[2]bsonrw.mode*[2]metadata.MD*[2]unix._C_int*[3]bsonrw.mode*[4]tls.CurveID*[4]trace.event*[8]*git.Remote*[8]*index.node*[8]*parse.Tree*[8]*pflag.Flag*[8]*sync.entry*[8]*trace.Span*[8][256]uint32*[8]crypto.Hash*[8]docker.Port*[8]func(error)*[8]gcfg.setter*[8]ghw.BusType*[8]gob.gobType*[8]http2.Flags*[8]index.Stage*[8]ini.ASTKind*[]**log.Logger*[]*ast.Comment*[]*color.Color*[]*frame.Frame*[]*http.Cookie*[]*iam.Binding*[]*index.Entry*[]*object.Tree*[]*sqs.Message*[]*ssh.channel*[]*ssh.macMode*[]*trace.trace*[][3][9]uint32*[][4][16]uint8*[][]jpeg.block*[][]yaml.field*[]amqp.message*[]argon2.block*[]asn1.encoder*[]clog.Factory*[]docker.Mount*[]func() error*[]gob.decInstr*[]gob.encInstr*[]iam.RoleName*[]image.format*[]interface {}*[]jpeg.huffman*[]logrus.Level*[]reflect.Kind*[]reflect.Type*[]regexp.entry*[]rsa.CRTValue*[]schema.Route*[]strings.span*[]swarm.Config*[]swarm.Secret*[]tag.Metadata*[]trace.bucket*[]view.AggType*[]yaml.MapItem*adler32.digest*agent.AddedKey*amqp.PlainAuth*amqp.allocator*amqp.basicNack*amqp.bodyFrame*amqp.consumers*amqp.queueBind*armor.encoding*arraylist.List*asn1.BitString*ast.ObjectItem*ast.ObjectList*ast.ObjectType*base.errPicker*base64.decoder*base64.encoder*bidi.Direction*big.byteReader*billy.TempFile*binary.decoder*binary.encoder*binarylog.Sink*blake2b.digest*bson.Marshaler*bsoncore.Value*bsonrw.vrState*bsonrw.vwState*bundler.bundle*bytes.asciiSet*cache.FileSize*chan io.Reader*chan net.racer*chan os.Signal*chan struct {}*chan time.Time*channelz.entry*cipher.ctrAble*cipher.gcmAble*client.Fetcher*client.Request*command.Delete*command.Insert*command.Update*common.Backend*common.Command*common.Profile*common.session*config.Comment*config.Decoder*config.Encoder*config.Include*config.Modules*config.Options*config.RefSpec*config.Section*crr.Discoverer*csv.ParseError*diff.FilePatch*diff.Operation*distribution.D*dns.dnsBuilder*dns.ipResolver*docker.APIPort*docker.Network*docker.Runtime*dotgit.Options*dsa.Parameters*dsa.PrivateKey*elliptic.Curve*encoding.Codec*errgroup.Group*exec.ExitError*exec.closeOnce*flag.boolValue*flag.uintValue*flate.Resetter*fmt.GoStringer*fsnotify.Event*fsnotify.watch*func() []error*func() []int32*func() []uint8*func() float32*func() float64*func() ini.AST*func() uintptr*func([]string)*func(afero.Fs)*func(ast.Node)*func(bson.Raw)*func(int) bool*func(int) uint*func(int, int)*func(net.Addr)*func(uint) int*gax.CallOption*gcfg.extraData*ghw.WithOption*ghw.netPrinter*git.FileStatus*git.GrepResult*git.LogOptions*git.Repository*git.StatusCode*git.Submodules*gob.CommonType*gob.GobDecoder*gob.GobEncoder*gob.structType*gotty.TermInfo*grpc.baseCodec*grpc.csAttempt*grpc.firstLine*grpc.traceInfo*grpcsync.Event*http.BasicAuth*http.ConnState*http.CookieJar*http.Transport*http.http2flow*http.http2gate*http.http2pipe*http.httpError*http.httpRange*http.keyValues*http.maskedSig*http.rpSession*http.socksAddr*http.socksConn*http.upSession*iam.grpcClient*idna.joinState*idna.labelIter*idna.runeError*idxfile.Writer*io.ByteScanner*io.RuneScanner*io.WriteCloser*io.atomicError*io.multiReader*io.multiWriter*ioutil.devNull*jmespath.Lexer*jmespath.token*jpeg.component*json.Marshaler*json.jsonError*log.LazyLogger*logging.Logger*logging.Record*logging.logger*macaron.Handle*macaron.Locale*macaron.Params*macaron.Render*macaron.Router*map[int32]bool*map[int]string*map[string]int*metadata.rawMD*mongo.Database*multipart.File*multipart.Form*multipart.Part*multipart.part*net.PacketConn*net.ParseError*net.dialResult*net.writerOnly*nettrace.Trace*norm.insertErr*object.Changes*object.TagIter*objfile.Reader*objfile.Writer*openpgp.Entity*openpgp.Subkey*os.newFileKind*packet.ecdhKdf*packfile.Error*parse.BoolNode*parse.ListNode*parse.NodeType*parse.PipeNode*parse.TextNode*parse.WithNode*parse.elseNode*parse.itemType*pflag.boolFlag*pflag.intValue*pkix.Extension*primitive.Null*printer.Config*proto.duration*proto.nonFatal*pubsub.Message*rand.devReader*rand.rngSource*reflect.Method*reflect.method*regexp.machine*request.Option*request.Waiter*resolver.State*revision.token*rsa.PSSOptions*rsa.PrivateKey*runtime.Frames*runtime._defer*runtime._panic*runtime.bucket*runtime.dbgVar*runtime.elfDyn*runtime.elfSym*runtime.funcID*runtime.gcBits*runtime.gcMode*runtime.gcWork*runtime.lfnode*runtime.mTreap*runtime.mcache*runtime.mstats*runtime.schedt*runtime.sigset*runtime.stackt*runtime.tmpBuf*server.handler*server.session*session.Client*session.Server*setting.Config*signal.handler*sort.Interface*ssh.AuthMethod*ssh.NewChannel*ssh.algorithms*ssh.authResult*ssh.cipherMode*ssh.connection*ssh.extChannel*ssh.kexInitMsg*ssh.noneCipher*ssh.packetConn*ssh.pendingKex*stats.InHeader*stats.RPCStats*storage.Storer*stringprep.Set*strings.Reader*swarm.CAConfig*swarm.Endpoint*swarm.NodeRole*swarm.NodeSpec*swarm.Platform*swarm.TaskSpec*sync.WaitGroup*sync.poolLocal*syntax.EmptyOp*syscall.IPMreq*syscall.Linger*syscall.Msghdr*syscall.RtAttr*syscall.Rusage*syscall.Signal*syscall.Stat_t*syscall._C_int*tabwriter.cell*tag.tagContent*tar.fileWriter*tar.headerSTAR*tar.sparseElem*template.Error*template.JSStr*template.delim*template.jsCtx*template.state*time.zoneTrans*tls.cthWrapper*tls.recordType*token.Position*token.lineInfo*toml.Marshaler*toml.tokenType*toml.tomlLexer*toml.tomlValue*topology.sconn*trace.Exporter*trace.LinkType*trace.SpanData*trace.eventLog*trace.logEntry*trace.traceSet*transport.ping*transport.side*unsafe.Pointer*utils.sortable*view.CountData*view.collector*view.recordReq*x509.PEMCipher*x509.authKeyId*xml.EndElement*xml.fieldFlags*yaml.Marshaler*yaml.TypeError*yaml.fieldInfo*yaml.yamlErrorAddTimerSecondsAdditionalBytesArrayFiltersSetAuthorityHeaderBS type:"list"BeforePresignFnBundleByteLimitBytesBase64VarPClientHandshakeCodeWithScopeOKCommandDocumentCommandStatusesCommitContainerCompleteAttemptCompletedTracesComputeChecksumConfigurePluginConnectionStateConstantTimeSumContentEncodingContextSpecificContinueOnErrorCreateContainerCreateFormFieldCriticalOptionsCryptoPublicKeyDefaultAddrPoolDefaultLanguageDiffLevenshteinEndOfIndexEntryEntriesByOffsetEnvironmentListEphemeralPubKeyExchangeDeclareExcludePatternsExclusiveAccessExecuteTemplateExecutionDriverExportContainerExtraExtensionsFieldByNameFuncFieldsPerRecordFilterAndFormatFindAllSubmatchFindReaderIndexFindStringIndexFirstKexFollowsForceNewClusterGetClientHeaderGetDefaultValueGetGoAwayReasonGetLogThresholdGetMainDocumentGetMethodConfigGetPendingTasksGetPhpNamespaceGetPositionPathGetPushEndpointGetReservedNameGetResponseBodyGetSecureCookieGetServerHeaderGetSettingRouteGetSizeByOffsetGetStorageRouteGetSubscriptionGetValidAddressGetWebHookRouteGroupTaskStatesHasETF3EnhancedHasRemoteParentHistogramWindowHostKeyCallbackHostKeyFallbackIdentityMappingIdleConnTimeoutInterpolatePathIsErrorThrottleIsFirstURLLocalIsGlobalUnicastIsGroupVisibileIsHostAuthorityIsUserAuthorityKeepDescriptorsKeepaliveParamsKey ssh:"rest"KeyLifetimeSecsLastErrorObjectListCollectionsListTablesPagesLooseObjectTimeLstatIfPossibleMatchEmptyWidthMaxConnIdleTimeMaxConnsPerHostMaxDocumentSizeMaxFailureRatioMaxLinksPerSpanMaxStalenessSetMottainaiClientMultipartReaderMustGetDurationNEventsListenerNS type:"list"Name qs:"name"NamespaceAppendNamespaceCreateNamespaceDeleteNetworksDeletedNewCBCDecrypterNewCBCEncrypterNewConversationNewPlanFromJsonNewTaskFromJsonNoCursorTimeoutNullDecodeValueNullEncodeValueOffsetReferenceOperatingSystemOverflowComplexParseStructTagsPatchAddContextPatchAddPaddingPath qs:"path"PersistentFlagsPingWithContextPluginsqs:"-"ProtocolVersionPruneContainersPublishSettingsPull qs:"pull"QuickSpanStringReadASN1BooleanReadASN1ElementReadASN1IntegerReadMetaHeadersReadWireMessageReceiveSettingsRegisterDecoderRegisterEncoderRemoveContainerRemoveMultiplesRemoveReferenceRenameContainerResolveEndpointResolveRevisionRetryThrottlingS3UseAccelerateSQS yaml:"sqs"SS type:"list"SafeWriteConfigScanWithContextSecretAccessKeySecurityOptionsSecurityVersionServerHandshakeServiceqs:"-"SetActiveReportSetAllowDiskUseSetArrayFiltersSetAutoWrapTextSetBackupStatusSetDelaySecondsSetErrorHandlerSetFullDocumentSetGlobalTablesSetHelpTemplateSetInterspersedSetLogThresholdSetMaxAwaitTimeSetMaxListenersSetMaximumUnitsSetMinimumUnitsSetReadDeadlineSetReportCallerSetRequestItemsSetReturnValuesSetRowSeparatorSetScannedCountSetSecureCookieSetSendCompressSetShowRecordIDSetStateFailureSetStatePendingSetStateStartedSetStateSuccessSetTagCommentedSetTagMultilineSetTemplatePathSetTransferSizeSetWriteConcernShortestDecimalShorthandLookupSig ssh:"rest"SigLifetimeSecsStorageFileListStringArrayVarPStringSliceVarPStringToIntVarPStringToStringPSubscriptionIAMSumOfSquaredDevSupportedCurvesSupportedPointsSupportedProtosTLSClientConfigTagQueueRequestTaskLogArtefactTaskRelativeDirTestPermissionsTimeDecodeValueTimeEncodeValueTimestampFormatTruncationTokenTryRLockContextUintDecodeValueUintEncodeValueUlimitsqs:"-"UncompressBytesUnmarshalBinaryUnmarshalStreamUpdateAddressesUpdateContainerUpdatedExistingUploadArtefactsUserKeyFallbackVagrantfilePathValidPrincipalsVerifyNoUpgradeVerifySignatureVersionTemplateVisitInt64ValueWait100ContinueWaitWithContextWithCredentialsWriteBufferSizeWriteDataPaddedWriteDecimal128WriteJavascriptWriteValueBytesX sshtype:"30"XXX_MessageNameZeroWidthJoineractionNodeEditsaddConnIfNeededaddErrorContextaddListenSocketaddLostAtomic64addNormalSocketaddSymbolicRefsaddedGoFlagSetsallocSpanLockedallocateBucketsallocateChannelawakenKeepalivebalancerBuilderbalancerWrapperbubbleDownIndexbuildHashSuffixbuildSubpacketsbytesExtensionsbytesForSigningcallUnmarshalercanonicalHeadercertsFromClientchannelHandlerscheckAPIVersioncheckFrameOrdercleanObjectListclientHandshakeclientHelloInfocloseAfterReplycloseAfterStartcloseConnectioncloseDoneLockedcloseNotifierChcloseNotifierMucloseNotifySentcodegenEncodingcollectCommentscombinesForwardcommandCalledAscomparisonCountcompressMessagecompressionOptsconnectionErrorconnectionstateconsumeLBracketconsumerWaitingcreateTagObjectcreateTransportcurBalancerNamedecodeFirstWantdecodeInterfacedecomposeHanguldeleteFromIndexdeleteRandomKeydialStreamLocaldiffBisectSplitdoFullHandshakedoReadEntryNameencodeChecksumsencodeFilePatchencodeFirstWantencodeInterfaceerrInvalidParamexpNNMontgomeryexpectsContinueexportedMethodsextensionRangesextensionsBytesextensionsWritefastSkipHashingfieldFromStructfindSuggestionsforEachObservergc_cpu_fractiongenerateCodegengenerateSubkeysget1xxTraceFuncgetCallAuthDatagetChannelTracegetDecEnginePtrgetFromPackfilegetFromUnpackedgetHostWithPortgetLineFromDatagetMethodLoggergetPointerSlicegetRemoteConfiggetSANExtensiongetStartedWrite writeRecord$ closeNotify$ closeNotify$ writeRecord$ writeKeyLog$ writeKeyLog$ isH2Upgrade( isH2Upgrade( setDeadline  setDeadline globalResponseshandleRSTStreamhandleReadErrorhandshakeStatushasSANExtensionheaderTableSizehealthCheckFunchostKeyCallbackhostLookupOrderidWithinCallGenidleConnTimeoutidleStateLockedignoreInterfaceincomingCheckedincomingDirNameincrCallsFailedinitialHeapLiveisFinalBoundarylastMsgRecvTimelastMsgSentTimelexRightBracketlisternersCountliteralEncodinglocal_largefreelookupFirstZonemapping_contextmarkBitsForBasemarshalBranchesmatchAddrFamilymatchBitapScoremaxStalenessSetmemoryCacheSizememoryCacheTypemultipartReaderneedsFrameFlushnewClientStreamnewDecoderStatenewEncoderStateobjectInterfaceobjectsToUploadonSettingsTimeronShutdownTimeroriginateStream setDeadline  setDeadline pagesSweptBasisparseColonSlashparseDefinitionparseExpressionparseGroupArrayparseNamedClassparsePrivateKeyparseRightParenpathProcCpuinfopathProcMeminfopathRunUdevDatapathSysClassDrmpathSysClassNetpendingRequestspersistentAllocpersistentFlagspickCipherSuitepopulateHeaderspostTaskHandlerprefaceReceivedprepareForWriteprimaryIdentityprocessPriorityprocessSettingsprocessTrailersproducerContextpublisherClientquoted_implicitreadClientHelloreadPacketsLeftrefineNonZeroesregisteredTasksremoteProvidersrequestTooLargeresolveAddrListresolverBuilderresolverWrapperrestoreOriginalretryThrottlingsendAlertLockedserverHandshakesetGoAwayReasonsetHEADToBranchsetHEADToCommitsetPointerSlicesetReadDeadlineshuffleByWeightsignPrepareHashsimpleNameMatchsimplifyComplexsortedKeyValuesssGoAwayHandlerstartFrameWritestdinPipeWriterstdoutThresholdsupportedCurvessupportedPointsswapVerticalBartableSizeUpdatetemplateControl withControl@P expectOneOf@P hasFunction@P newPipeline@P newTemplate@P newVariable@P withControl@P elseControl@P expectOneOf@P hasFunction@P elseControl@P newPipeline@P newTemplate@P newVariable@PticketSupportedtoOldExtensionstoken_availabletopologyOptionstruncateMessagetryRegisterViewunackedSettingsunexpungeLockedunmarshalReaderverifyDNSLengthversionTemplatewaitForBodyReadwaitForContinuewantSettingsAckwithAddedOptionwriteCloseErrorwriteExtensionswriteFrameAsyncxorKeyStreamAsmcrypto/x509/pkixinternal/testlog**ast.ObjectItem**config.Section**git.FileStatus**openpgp.Entity**parse.ListNode**parse.TextNode**pubsub.Message**runtime._defer**setting.Config**signal.handler**trace.SpanData**trace.eventLog**trace.traceSet*[0]*http.Cookie*[0]interface {}*[0]yaml.MapItem*[129]*runtime.g*[1]amqp.message*[1]interface {}*[1]reflect.Kind*[1]reflect.Type*[2]amqp.message*[2]asn1.encoder*[2]interface {}*[2]reflect.Kind*[3]interface {}*[4][]jpeg.block*[4]interface {}*[4]jpeg.huffman*[5]interface {}*[5]reflect.Kind*[64]big.divisor*[6]func() error*[6]interface {}*[7]**log.Logger*[7]interface {}*[7]trace.bucket*[8]*color.Color*[8]*object.Tree*[8]*ssh.macMode*[8]*trace.trace*[8][4][16]uint8*[8][]yaml.field*[8]clog.Factory*[8]interface {}*[8]logrus.Level*[8]reflect.Kind*[8]reflect.Type*[8]schema.Route*[8]view.AggType*[]*amqp.Channel*[]*dynamodb.Tag*[]*flag.FlagSet*[]*gob.typeInfo*[]*gob.wireType*[]*http.Request*[]*list.Element*[]*macaron.Leaf*[]*macaron.Tree*[]*net.Listener*[]*pubsub.Topic*[]*runtime.bmap*[]*runtime.itab*[]*trace.bucket*[]*trace.family*[][]logrus.Hook*[]asn1.RawValue*[]bson.RawValue*[]bsontype.Type*[]dns.rawChoice*[]docker.Change*[]docker.Device*[]docker.ULimit*[]docker.Volume*[]ghw.DriveType*[]gob.decHelper*[]gob.encHelper*[]gotty.stacker*[]grpc.jsonName*[]http.muxEntry*[]http.sniffSig*[]http2.ErrCode*[]http2.Setting*[]idtools.IDMap*[]idxfile.Index*[]ini.TokenType*[]logging.Color*[]logging.Level*[]logging.level*[]macaron.group*[]net.Interface*[]net.nssSource*[]packet.Packet*[]plumbing.Hash*[]proto.Message*[]proto.pointer*[]reflect.Value*[]reflect.visit*[]result.Upsert*[]runtime.Frame*[]runtime.scase*[]stats.Options*[]swarm.Service*[]syscall.Iovec*[]time.Duration*[]tls.ticketKey*[]toml.sortNode*[]types.IntMode*[]user.Identity*[]view.Exporter*[]xml.fieldInfo*abstract.Scheme*address.Address*agent.dsaKeyMsg*agent.rsaKeyMsg*agenttasks.Plan*agenttasks.Task*amqp.Connection*amqp.Publishing*amqp.basicGetOk*amqp.basicQosOk*amqp.properties*amqp.queuePurge*amqp.txCommitOk*amqp.txRollback*amqp.txSelectOk*anagent.Anagent*anagent.Handler*anagent.TimerID*asn1.Enumerated*asn1.RawContent*asn1.oidEncoder*ast.LiteralType*auth.SaslClient*awserr.awsError*balancer.Picker*base64.Encoding*bidi.Properties*binaryheap.Heap*blowfish.Cipher*bson.RawElement*bsoncodec.Proxy*bufio.SplitFunc*bundler.Bundler*bzip2.bitReader*cache.BufferLRU*cache.ObjectLRU*capability.List*chacha20.Cipher*chan parse.item*channelz.Server*channelz.Socket*channelz.server*clog.FileConfig*color.Attribute*color.modelFunc*command.GetMore*config.Includes*config.Sections*connection.Pool*connection.pool*context.Context*ctxio.ctxReader*ctxio.ctxWriter*digest.Digester*digest.Verifier*digest.digester*dns.dnsResolver*dns.netResolver*dnsmessage.Name*dnsmessage.Type*docker.APIActor*docker.APIMount*docker.BuildArg*docker.CPUStats*docker.Endpoint*docker.NetIPNet*dynamodb.Delete*dynamodb.Update*ecdsa.PublicKey*expvar.KeyValue*ext.boolTagName*filesystem.node*flag.int64Value*flate.byLiteral*flate.levelInfo*flowrate.Reader*flowrate.Status*func() *[]uint8*func() *big.Int*func() [8]uint8*func() []string*func() asn1.Tag*func() bson.Raw*func() net.Addr*func(*http.Dir)*func(*int) bool*func(...string)*func([]ini.AST)*func(bool) bool*func(int) []int*func(int) error*func(int) uint8*func(int32) int*func(io.Reader)*func(io.Writer)*ghw.NetworkInfo*git.GrepOptions*git.ListOptions*git.PullOptions*git.PushOptions*gob.emptyStruct*grpc.CallOption*grpc.ClientConn*grpc.Compressor*grpc.DialOption*grpc.StreamDesc*grpclog.loggerT*hpack.indexType*http.AuthMethod*http.FileSystem*http.atomicBool*http.bodyLocked*http.byteReader*http.condResult*http.connReader*http.contextKey*http.fakeLocker*http.gzipReader*http.http2Flags*http.http2Frame*http.readResult*http.socksReply*http.writerOnly*http2.DataFrame*http2.FrameType*http2.PingFrame*http2.SettingID*http2.connError*iam.PolicyDelta*idna.labelError*idna.valueRange*idxfile.Decoder*idxfile.Encoder*idxfile.objects*image.Rectangle*index.TreeEntry*inject.Injector*inject.injector*io.stringWriter*jmespath.Parser*jmespath.expRef*jmespath.jpType*jpeg.huffmanLUT*json.RawMessage*json.mapEncoder*json.ptrEncoder*json.tagOptions*knownhosts.addr*logging.Handler*logging.Wrapper*logging.context*logrus.FieldMap*logrus.exitFunc*logrus.fieldKey*macaron.Context*macaron.Handler*macaron.Macaron*macaron.Request*map.hdr[int]int*map[int32]int32*map[string]bool*map[uint64]bool*measurable.Type*merkletrie.Iter*metricdata.Type*metricdata.Unit*mongo.IndexView*net.TCPListener*net.policyTable*net.rawListener*net.sysListener*norm.Properties*norm.lookupFunc*norm.normReader*norm.normWriter*norm.streamSafe*norm.valueRange*oauth2.setParam*object.BlobIter*object.FileIter*object.FileStat*object.TreeIter*openpgp.KeyRing*opentracing.Tag*os.ProcessState*os.SyscallError*packet.ecdsaKey*packet.seReader*packfile.Parser*packfile.reader*parse.ChainNode*parse.FieldNode*parse.RangeNode*parser.PosError*passlib.Context*pem.lineBreaker*pflag.boolValue*pflag.int8Value*pflag.parseFunc*pflag.uintValue*pktline.Encoder*pktline.Scanner*plumbing.Hasher*primitive.Regex*printer.printer*properties.item*proto.Extension*proto.Marshaler*proto.boolValue*proto.marshaler*proto.mergeInfo*proto.notLocker*proto.timestamp*pubsub.Snapshot*readpref.Option*redis.fieldSpec*reflect.ChanDir*reflect.imethod*reflect.mapType*reflect.nameOff*reflect.ptrType*reflect.textOff*reflect.typeAlg*reflect.typeOff*regexp.bitState*regexp.regexpRO*request.Request*request.Retryer*resolver.Target*result.Distinct*result.IsMaster*revision.AtDate*revision.AtPush*revision.Parser*rsa.OAEPOptions*runewidth.table*runtime.elfEhdr*runtime.evacDst*runtime.functab*runtime.funcval*runtime.imethod*runtime.lfstack*runtime.libcall*runtime.maptype*runtime.nameOff*runtime.profBuf*runtime.ptrtype*runtime.rwmutex*runtime.sigTabT*runtime.sigctxt*runtime.siginfo*runtime.special*runtime.textOff*runtime.timeval*runtime.typeAlg*runtime.typeOff*runtime.workbuf*scanner.Scanner*schema.APIRoute*server.fsLoader*setting.Setting*signal.stopping*simplelru.entry*ssh.CertChecker*ssh.Certificate*ssh.Permissions*ssh.forwardList*ssh.tcpListener*ssh_config.Host*ssh_config.Node*stack.CallStack*stats.ConnBegin*stats.ConnStats*stats.InPayload*stats.InTrailer*stats.OutHeader*storage.Storage*strconv.decimal*strings.Builder*swarm.DNSConfig*swarm.NodeState*swarm.Placement*swarm.Resources*swarm.TaskState*sync.notifyList*syntax.compiler*syscall.IPMreqn*syscall.RawConn*syscall.Timeval*syscall.Utsname*syscall.mmapper*tar.headerError*tar.headerUSTAR*tar.sparseArray*tasks.Retriable*tasks.Signature*tasks.TaskState*template.Srcset*template.common*template.option*textproto.Error*time.ParseError*tls.Certificate*tls.cipherSuite*tls.finishedMsg*tls.macFunction*toml.SetOptions*toml.annotation*toml.tomlParser*topology.Option*topology.Server*topology.config*trace.Attribute*trace.discarded*trace.errorCond*trace.eventLogs*trace.histogram*trace.spanStore*trace.traceList*unicode.Range16*unicode.Range32*unix.EpollEvent*url.EscapeError*util.removerAll*util.underlying*vagrantutil.Box*view.measureRef*viper.FlagValue*webhook.WebHook*wiremessage.Msg*xml.SyntaxError*xml.TokenReader*xml.Unmarshaler*xml.parentStack*xmlutil.XMLNode*yaml.jsonNumber*yaml.structInfo*yaml.tagOptionsAbortTransactionActiveTraceCountAddDebugHandlersAddEventListenerAddNestedContextAdditionalHeaderAdjustRoutingKeyAppendTaskOutputAppendValueBytesArrayDecodeValueArrayEncodeValueAutoLockManagersBinaryMarshalerTBridgeNfIptablesCallerPrettyfierChangeStaticPathChannelzParentIDCleanUpContainerClientPropertiesClusterAdvertiseConfirmBeforeUseContainerChangesContainersPausedControlAvailableCopyValueToBytesCurvePreferencesData ssh:"rest"DefinedTemplatesDiffCharsToLinesDiffCleanupMergeDiffCommonPrefixDiffCommonSuffixDiffLinesToCharsDiffLinesToRunesDisableExpansionDisableTimestampDroppedLinkCountDurationSliceVarEndpointResolverExcludedIPRangesExtensionDetailsFindOneAndDeleteFindOneAndUpdateFloatDecodeValueFloatEncodeValueGenZshCompletionGetAttributeNameGetBindingDeltasGetCookieFloat64GetDurationSliceGetListenerCountGetNextPageTokenGetNormalizeFuncGetReservedRangeGetSecurityValueGetSequenceArrayGetServerSocketsGetStatusDetailsGetStatusMessageGetSubscriptionsHasEncodedObjectImageToCacheNameIncludeSourceDirInspectContainerIsErrorRetryableIsManagerOrAdminIsOpeningBracketIsTaskRegisteredItem type:"map"KeyIdShortStringKeys ssh:"rest"LanguageOverrideListGlobalTablesLogicalRemainingLookupElementErrMACsClientServerMACsServerClientMakeGroupVisibleMarkFlagFilenameMarkFlagRequiredMarshalBSONValueMaxReadFrameSizeMessagesReceivedModifyPushConfigN type:"string"NewEncodedObjectNewServiceConfigNextObjectHeaderPackfileChecksumPeerCertificatesPersistentPreRunPreviousAttemptsPropertiesStringProxyEncodeValueQueryWithContextQuoteEmptyFieldsReadConcernLevelReadOptionalASN1ReadRemoteConfigRecordTransitionRecursionDesiredReferenceStorageRegexDecodeValueRegexEncodeValueRegisterProtocolRemovePermissionRemoveSubsectionReplaceAllParamsReplaceAllStringRequestSubsystemResolveReferenceRest ssh:"rest"RestartContainerRevocationReasonRunCommandCursorS type:"string"S3ForcePathStyleSecurityProtocolSeekObjectHeaderSendMessageBatchSerializePrivateServeFileContentServerPropertiesSessionTicketKeySetAWSAccountIdsSetAttributeNameSetAttributeTypeSetBackupDetailsSetCapacityUnitsSetDeleteRequestSetDeterministicSetEncodedObjectSetFlagErrorFuncSetKeyConditionsSetNormalizeFuncSetOperationNameSetReceiptHandleSetReplicaStatusSetSphereVersionSetStateReceivedSetStorageEngineSetStreamEnabledSetTotalSegmentsSetTransactItemsSetUnlinkOnCloseSetUsageTemplateSetWriteDeadlineSetsockoptIPMreqSetsockoptLingerSignatureSchemesSignedHeaderValsSkipAllQuestionsSkipOptionalASN1SleepWithContextSliceDecodeValueSliceEncodeValueSocketTimeoutSetSpreadDescriptorStartAdditionalsStartAuthoritiesStartTransactionStreamsSucceededSupportsSessionsTLSHandshakeDoneTransactGetItemsTransferEncodingTraverseChildrenTrimLeadingSpaceUncompressedSizeUnmarshalXMLAttrUnpauseContainerUpdateTimeToLiveValidateResponseValueDecodeValueValueEncodeValueWeaklyTypedInputWithUseDualStackWriteDocumentEndWritePushPromiseWriteSettingsAckWriteWireMessageWroteHeaderFieldXXX_unrecognizedabortPendingReadaddIndexFromFileappendExtensionsappendInt32SliceappendMessageSetawaitFlowControlbuildFetchedTagsbumpIdleDeadlinebytesOutStandingcachedWriteErrorcertificateTypeschangeCipherSpecchannelzParentIDcheckResetOrDonechordAsyncResultclientMaxStreamscloseDescriptorscombinesBackwardcommitIndexEntrycompressionLevelcomputeMergeInfoconnPerHostCountconnectWithRetrycopyDocumentCorecreateAttrPrefixcreateLogWriterscreateOptionsDoccurClientStreamscurPushedStreamscurrentTokenStopcurvePreferencesdashBoundaryDashdebugReadLoggerfdecHostConnCountdecodeGobDecoderdecodeMapFromMapdecodeOtherWantsdecodeVarintSlowdecoderOrigNamesdeleteAttrPrefixdeleteReferencesdiffLinesToRunesdiskIsRotationaldiskSerialNumberdoAddFileToIndexeditTemplateNodeencodeGobEncoderencodeSubsectionenterKeyExchangeevalVariableNodeexplicitNonceLenfetchAndCheckoutfieldNeedsQuotesfreeDecoderStatefreeEncoderStategcMarkWorkerModegcshrinkstackoffgetFakeNativeURLgetObjectContentgetOutFlowWindowgetTraceRefCount cipherSuites$ cipherSuites$ formatHeader$% formatHeader$% formatHeader$% formatHeader$% isReplayable( isReplayable( readdirnames  readdirnames gotIdleConnTracegotTrailerHeadergpuFillNUMANodesgpuFillPCIDevicehandleKeepAliveshasDecompositionheartbeatTimeouthelperDrainBlockhttp2FrameHeaderignoreGobDecoderincHostConnCountincomingChannelsincomingRequestsincrCallsStartedinsertDecomposedinspectContainerinternetAddrListisSingleLineListisValidSignatureisViramaModifierkeepaliveEnabledlastChunkOrAlloclastHeaderStreamlast_gc_nanotimelegacyKillCursorlexLiteralStringlifetimeDeadlinelistenFirstErrorliteralInterfacelocal_nlargefreelocal_nsmallfreelocal_tinyallocsmarkBitsForIndexmarkWorkerLabelsmarshalInterfacematchNextSegmentmaxPushPromiseIDmaxReadFrameSizemaxRemotePayloadmemoryCacheLevelmetricDescriptormissingFlagNamesmustBeAssignablemutateHeaderFuncnFlushCacheRootsneedToSendGoAwaynewAttemptLockednextObjectHeadernumTrailerValuesonPrefaceReceiptoracleCamouflage readdirnames  readdirnames parseCaretBracesparseHeaderFrameparseInlineTableparseMethodFrameparseVerticalBarpathNodeCPUCachepeerCertificatespendingKeyChangeprepareKeyChangeprobeRequestBodyreadCipherPacketreconstructBlockrecordWriteErrorrefillAllocCacheregeneratePickerregisterOnHitEOFresetObservationresolvedOriginalresolverUpdateChreturnConnectionruneIsProhibitedsawFirstSettingssendWindowUpdatesequence_contextserverAPIVersionsetWriteDeadlinesetupHTTP2_ServesizeV1ExtensionsstandardCriteriastartFlushLockedstartHealthCheckstateChangeQueuestoreResumeTokenstreamsSucceededsubscriberClientsyntaxErrorTokenterminalInitOnce peekNonSpace@P rangeControl@P textOrAction@P nextNonSpace@P parseControl@P peekNonSpace@P rangeControl@P blockControl@P textOrAction@P blockControl@P nextNonSpace@P parseControl@PtopLevelChannelstopologyFillInfotrailingZeroBitstransferEncodingtruncateMetadatatryExpungeLockedtryGrowByResliceunmarshalRemotesunpackCompressedupdateAverageRTTupdateHeaderSentupdateReferencesupdateSubmodulesuserConfigFindervalueDecodeValuevalueToTreeSlicewalkReadyInOrderwantWriteFrameChwants10KeepAlivewithSettedOptionwriteBaseIfDeltawriteDeltaHeaderwriteFixedHeaderwriteHeaderBlockwritePacketsLeftwriteRequestBodywriteStoredBlockwriteStreamResetwriteUSTARHeaderwriterDescriptor A@internal/nettracenet/http/httputilnet/http/internal**[]syscall.Iovec**agenttasks.Plan**agenttasks.Task**capability.List**channelz.server**proto.mergeInfo**pubsub.Snapshot**runtime.funcval**runtime.special**ssh_config.Host**tasks.Signature**tasks.TaskState**template.common**tls.cipherSuite**topology.Server**trace.spanStore**vagrantutil.Box**xmlutil.XMLNode*<-chan struct {}*<-chan time.Time*[0]plumbing.Hash*[0]proto.pointer*[0]reflect.Value*[0]time.Duration*[10]*trace.trace*[12]interface {}*[16][3][9]uint32*[1]*macaron.Leaf*[1]*macaron.Tree*[1]http2.Setting*[1]plumbing.Hash*[1]reflect.Value*[1]stats.Options*[1]tls.ticketKey*[21]interface {}*[22]interface {}*[256]*hpack.node*[25]reflect.Type*[27]interface {}*[2]reflect.Value*[2]time.Duration*[32]strings.span*[5]reflect.Value*[8]*amqp.Channel*[8]*gob.typeInfo*[8]*gob.wireType*[8]*http.Request*[8]*list.Element*[8]*macaron.Leaf*[8]*macaron.Tree*[8]*net.Listener*[8]*trace.bucket*[8]*trace.family*[8][]logrus.Hook*[8]bsontype.Type*[8]ghw.DriveType*[8]gob.decHelper*[8]gob.encHelper*[8]gotty.stacker*[8]http.muxEntry*[8]http2.ErrCode*[8]idxfile.Index*[8]ini.TokenType*[8]logging.Color*[8]logging.Level*[8]logging.level*[8]plumbing.Hash*[8]proto.Message*[8]reflect.Value*[8]reflect.visit*[8]time.Duration*[8]toml.sortNode*[8]types.IntMode*[8]user.Identity*[8]view.Exporter*[]*anagent.Timer*[]*ast.ObjectKey*[]*clog.receiver*[]*cobra.Command*[]*command.Write*[]*config.Branch*[]*config.Option*[]*docker.Volume*[]*dotgit.DotGit*[]*gob.fieldType*[]*grpc.addrConn*[]*norm.formInfo*[]*object.Change*[]*object.Commit*[]*packp.Command*[]*reflect.rtype*[]*regexp.Regexp*[]*regexp.thread*[]*runtime._type*[]*runtime.mspan*[]*runtime.sudog*[]*runtime.timer*[]*syntax.Regexp*[][]*http.Cookie*[][]interface {}*[]bsoncore.Value*[]bsonrw.vrState*[]bsonrw.vwState*[]chan struct {}*[]common.Profile*[]config.RefSpec*[]diff.FilePatch*[]docker.APIPort*[]docker.Network*[]docker.Runtime*[]encoding.Codec*[]gax.CallOption*[]git.GrepResult*[]http.ConnState*[]http.httpRange*[]http.keyValues*[]idna.joinState*[]jmespath.token*[]jpeg.component*[]map[string]int*[]openpgp.Subkey*[]parse.itemType*[]pkix.Extension*[]reflect.method*[]request.Option*[]runtime.dbgVar*[]runtime.elfDyn*[]runtime.elfSym*[]runtime.gcBits*[]ssh.AuthMethod*[]stringprep.Set*[]swarm.Platform*[]syscall._C_int*[]tabwriter.cell*[]tag.tagContent*[]template.state*[]time.zoneTrans*[]token.lineInfo*[]trace.Exporter*[]trace.logEntry*[]unsafe.Pointer*[]yaml.fieldInfo*aes.KeySizeError*agent.dsaCertMsg*agent.rsaCertMsg*amqp.basicCancel*amqp.basicReject*amqp.basicReturn*amqp.channelFlow*amqp.channelOpen*amqp.headerFrame*amqp.methodFrame*amqp.queueBindOk*amqp.queueDelete*amqp.queueUnbind*annotations.Http*armor.lineReader*asn1.SyntaxError*asn1.byteEncoder*ast.CommentGroup*aws.LogLevelType*awserr.baseError*awserr.errorList*backoff.Strategy*balancer.Builder*balancer.SubConn*base.baseBuilder*big.RoundingMode*billy.Capability*billy.Filesystem*binary.ByteOrder*binary.bigEndian*binarylog.Cancel*binarylog.Logger*binarylog.logger*bson.Unmarshaler*bsoncodec.Zeroer*bsoncore.Element*bsonrw.ejvwState*bufio.ReadWriter*capability.entry*chan *amqp.Error*chan amqp.Return*chan ctxio.ioret*chan ssh.forward*chan<- os.Signal*chan<- struct {}*channelz.Channel*channelz.channel*cipher.BlockMode*client.logWriter*clog.SlackConfig*command.Distinct*command.IsMaster*common.Commander*config.SQSConfig*config.Submodule*connection.Error*context.canceler*context.emptyCtx*context.timerCtx*context.valueCtx*crypto.Decrypter*crypto.PublicKey*des.KeySizeError*digest.Algorithm*dnsmessage.Class*dnsmessage.RCode*docker.APIEvents*docker.APIImages*docker.Container*docker.DiskUsage*docker.HostMount*docker.IndexInfo*docker.LogConfig*docker.PluginEnv*docker.SwarmNode*docker.TopResult*docker.doOptions*dynamodb.Replica*dynamodb.retryer*ecdsa.PrivateKey*ecdsa.invertible*emission.Emitter*endpoints.Region*endpoints.region*envconfig.Setter*ext.SpanKindEnum*filepath.lazybuf*flag.stringValue*flag.uint64Value*flate.compressor*flate.dictWriter*flate.tableEntry*flowrate.Monitor*flowrate.Percent*fmt.stringReader*fsnotify.Watcher*func() [16]uint8*func() [2]string*func() [][]uint8*func() []ini.AST*func() []tag.Set*func() bsonx.Arr*func() bsonx.Doc*func() hash.Hash*func() io.Reader*func() io.Writer*func() parse.Pos*func() time.Time*func() token.Pos*func() uuid.Time*func(*[16]uint8)*func(*[32]uint8)*func(*bool) bool*func(*flag.Flag)*func(*list.List)*func(*runtime.g)*func(*runtime.p)*func(*view.Data)*func([][]string)*func([]int) bool*func(bool) error*func(complex128)*func(error) bool*func(gob.typeId)*func(int) string*func(int32) bool*func(int64) bool*func(string) int*func(tar.Format)*func(trace.Link)*func(uint8) bool*func(url.Values)*gax.CallSettings*ghw.Architecture*git.CleanOptions*git.CloneOptions*git.FetchOptions*git.PruneHandler*git.PruneOptions*git.RepackConfig*git.ResetOptions*git.objectWalker*gob.decoderState*gob.encoderState*gob.userTypeInfo*grpc.dialOptions*grpc.payloadInfo*grpc.retryPolicy*grpclog.LoggerV2*hcl.lexModeValue*http.HandlerFunc*http.PushOptions*http.chunkWriter*http.closeWriter*http.errorReader*http.extraHeader*http.h2Transport*http.http2Framer*http.http2Server*http.http2sorter*http.http2stream*http.persistConn*http.socksDialer*http2.frameCache*httpproxy.Config*httpproxy.config*iam.BindingDelta*idtools.Identity*io.LimitedReader*io.SectionReader*ioutil.nopCloser*jmespath.ASTNode*jmespath.argSpec*jmespath.tokType*jpeg.FormatError*jpeg.huffmanSpec*json.SyntaxError*json.Unmarshaler*json.decodeState*json.encodeState*json.encoderFunc*logrus.Formatter*logrus.MutexWrap*macaron.routeMap*machinery.Server*machinery.Worker*map.iter[int]int*map[int32]string*map[int64]string*map[string][]int*map[string]error*map[string]int16*map[string]int32*map[string]int64*map[uint32]int32*map[uint8]string*metricdata.Point*mongo.Collection*mongo.IndexModel*mongo.StreamType*mongo.WriteError*mongo.WriteModel*mongo.sessionKey*multipart.Reader*multipart.Writer*net.HardwareAddr*net.ListenConfig*net.UnixListener*net.byMaskLength*net.nssCriterion*object.FileStats*object.Signature*object.TreeEntry*object.textChunk*object.treeNoder*openpgp.Identity*opentracing.Span*packet.PublicKey*packet.Signature*packet.parsedMPI*packfile.Encoder*packfile.Scanner*packp.DepthSince*parse.ActionNode*parse.BranchNode*parse.NumberNode*parse.StringNode*pflag.countValue*pflag.goBoolFlag*pflag.int16Value*pflag.int32Value*pflag.int64Value*pflag.ipNetValue*pflag.uint8Value*pkix.RDNSequence*pools.bufferPool*primitive.Binary*primitive.MaxKey*primitive.MinKey*primitive.Symbol*properties.lexer*proto.Properties*proto.ProtoSizer*proto.bytesValue*proto.extPropKey*proto.int32Slice*proto.int32Value*proto.int64Value*proto.messageSet*proto.oneofField*proto.textWriter*rc4.KeySizeError*redis.structSpec*reflect.cacheKey*reflect.funcType*regexp.runeSlice*request.Handlers*resolver.Address*resolver.Builder*result.BulkWrite*revision.scanner*runtime.MemStats*runtime.arenaIdx*runtime.chantype*runtime.divMagic*runtime.finblock*runtime.fixalloc*runtime.funcInfo*runtime.guintptr*runtime.heapBits*runtime.mapextra*runtime.markBits*runtime.mcentral*runtime.muintptr*runtime.parkInfo*runtime.pollDesc*runtime.puintptr*runtime.semaRoot*runtime.stackmap*runtime.stkframe*runtime.stringer*runtime.textsect*runtime.timespec*runtime.traceBuf*runtime.vdsoInfo*scanner.Position*scram.KeyFactors*semaphore.waiter*server.rpSession*server.upSession*sideband.Demuxer*sort.StringSlice*ssh.ClientConfig*ssh.ConnMetadata*ssh.dsaPublicKey*ssh.forwardEntry*ssh.kexAlgorithm*ssh.kexDHInitMsg*ssh.optionsTuple*ssh.packetCipher*ssh.rsaPublicKey*ssh.sessionStdin*ssh.singleWriter*ssh.unixListener*ssh_config.Empty*ssh_config.token*stats.OutPayload*stats.RPCTagInfo*strconv.NumError*strconv.extFloat*stringprep.Error*strings.Replacer*strings.asciiSet*strings.replacer*strings.trieNode*struct { error }*swarm.ConfigSpec*swarm.ExternalCA*swarm.IPAMConfig*swarm.JoinTokens*swarm.NodeStatus*swarm.PortConfig*swarm.PortStatus*swarm.Privileges*swarm.RaftConfig*swarm.SecretSpec*swarm.SpreadOver*swarm.TaskStatus*sync.copyChecker*syntax.ErrorCode*syntax.charGroup*syntax.patchList*syscall.IPv6Mreq*syscall.NlMsghdr*syscall.ProcAttr*syscall.RtGenmsg*syscall.Sockaddr*syscall.Timespec*syscall._Socklen*tabwriter.Writer*tasks.TaskResult*template.FuncMap*template.context*template.element*template.escaper*template.urlPart*textproto.Reader*timeseries.Clock*tls.finishedHash*tls.keyAgreement*tls.nextProtoMsg*tls.sessionState*tls.timeoutError*tls.xorNonceAEAD*toml.validRuneFn*trace.Annotation*trace.bucketData*tracestate.Entry*transport.Stream*transport.framer*transport.goAway*transport.inFlow*types.EnumParser*unicode.foldPair*utf8.acceptRange*utils.Comparator*view.Aggregation*viper.pflagValue*x509.Certificate*x509.ExtKeyUsage*x509.certificate*x509.rfc1423Algo*xml.StartElement*xml.TagPathError*yaml.Unmarshaler*yaml.yaml_mark_t*yaml.yaml_node_tAMQP yaml:"amqp"AcknowledgedWriteAddCACertFromFileAddRemoteProviderAllowIllegalReadsAppendMarshalBSONAppendWireMessageAttachToContainerBackoffMultiplierBatchGetItemPagesBinaryDecodeValueBinaryEncodeValueBufferedByteLimit BuildArgsqs:"-" CacheFromqs:"-"CanTakeNewRequestCausalConsistencyCheckCRLSignatureCode bson:"code"Code json:"code"CommitTransactionCompressedMessageCompressionConfigConnectTimeoutSetConnectivityState Containerqs:"-"ContainersDeletedContainersRunningContainersStoppedContextjson:"-"CopyFromContainerCreateGlobalTableData json:"data"DecodeStringBytesDeleteItemRequestDeleteLooseObjectDescribeEndpointsDiffCommonOverlapDisableAutoGenTagDisableKeepAlivesDisconnectNetworkDone bson:"done"DownloadArtefactsDurationSliceVarPEmbeddedSignatureEnableCompressionEncodeStringBytesEncodedObjectIterEncodedObjectSizeExperimentalBuildFatalWithWarningsFilterStripPrefixFindOneAndReplaceFindSubmatchIndexFinishWithOptionsFlagUsagesWrappedForEachObjectHashForce qs:"force"GenBashCompletionGetAggregateValueGetCcEnableArenasGetExtensionRangeGetNamespaceRouteGetParsedDurationGetPhpClassPrefixGetRegisteredTaskGetSourceCodeInfoGetStringToStringGetWeakDependencyHandleAPIResponseHandleChannelOpenHandshakeCompleteHasAvailableFlagsHasInheritedFlagsHealthCheckConfigHeartbeatIntervalHighlightLocationHostKeyAlgorithmsInactivityTimeoutInitialWindowSizeIsRecordingEventsLessThanOrEqualToListDatabaseNamesListQueuesRequestListSubscriptionsListTablesRequestListenAndServeTLSLocalThresholdSetMaxHeaderListSizeMaxKeyDecodeValueMaxKeyEncodeValueMaxRequestsErrorsMinKeyDecodeValueMinKeyEncodeValueModifyAckDeadlineNICs json:"nics"Name bson:"name"Name form:"name"Name json:"name"NameToCertificateNamespaceFileListNewWriteSchedulerNonInheritedFlagsNumberOfCursorIDsPerRPCCredentialsPermittedIPRangesPersistentPostRunPersistentPreRunEPhysicalRemainingPolicyIdentifiersPurgeQueueRequestRawTBSCertificateReadASN1BitStringReadCodeWithScopeReadContinuedLineReadHeaderTimeoutRecurseSubmodulesReferencedContextReplaceAllLiteralReportActiveSpansRequireFormEncodeRetentionDurationRotateWorkerTokenSafeWriteConfigAsSetAttributeNamesSetAutoMergeCellsSetConditionCheckSetConsistentReadSetDisableScaleInSetEnvKeyReplacerSetGlobalTableArnSetHandlerWrapperSetIndexSizeBytesSetKMSMasterKeyIdSetMessageGroupIdSetPreTaskHandlerSetProjectionTypeSetReadPreferenceSetReplicaUpdatesSetResponseWriterSetRestoreSummarySetReturnDocumentSetSSEDescriptionSetSequenceNumberSetSourceTableArnSetStreamViewTypeSetTableSizeBytesSetsockoptIPMreqnSignWithAlgorithmSize json:"Size"Size json:"size"StandardDeviationStorageRemovePathStringDecodeValueStringEncodeValueStringToStringVarSuccessjson:"-"SupportedVersionsSymbolDecodeValueSymbolEncodeValueTLSHandshakeStartTags type:"list"Text json:"text"Type bson:"type"UntagQueueRequestUpdateGlobalTableUpdateItemRequestUploadStorageFileUploadToContainerVerifySignatureV3VisitFloat64ValueVisitSummaryValueWatchRemoteConfigWebHookDeleteTaskWebHookTaskUpdateWhiteoutConverterWithMinIterationsWriteArrayElementWriteConcernErrorWriteContinuationWriteWindowUpdateXXX_OneofWrappersXXX_WellKnownTypeaddRefsFromRefDirallocBitsForIndexarbitraryTemplateassistWorkPerBytebackoffMultiplierbalancerBuildOptsbuildCommitObjectbuildTagSignaturecalculateChildrencanTakeNewRequestcheckIfHasPrimarycloseWriteAndWaitcommandsAreSortedcommandsMaxUseLencompressionMethodconnectionTimeoutcopyFileToStoragecurrentParsedCharcurrentTokenStartdebugWriteLoggerfdecodeArrayHelperdecodeDeepenSincedecodeShallowLinedecrTraceRefCountdedicatedMarkTimedeleteSelfFromMapdeleteSelfIfReadydisableKeepAlivesdispositionParamsdoReadEntryNameV4doRecursiveUpdatedoRemoveDirectorydoResumeHandshakeendpointForRegionextendableProtoV1firstResolveEventfixAndBreakChainsforEachObjectHashforwardOrBoundarygetDoneChanLockedgetKeyValueConfiggetNextFileCommitgetReadyTransport readHandshake$ decryptTicket$ encryptTicket$ readHandshake$ decryptTicket$ encryptTicket$ updateUseTimeY updateUseTimeY mutualVersion$ mutualVersion$goLookupHostOrdergroupAsyncResultshandleChannelOpenhandshakeCompletehealthCheckConfigheartbeatIntervalhostKeyAlgorithmshttp2HeadersFrameignoreArrayHelperinactivityTimeoutincrTraceRefCountincrementOverflowinitCheckmarkSpaninitialWindowSizeinterfaceDecodersinterfaceEncodersisAggregationDatalastMarshaledSizelexInsideTableKeylexLeftCurlyBracelexStringAsStringlookupTypeDecoderlookupTypeEncodermakeHeadersCopiermapRoundTripErrormarkTaskCompletedmarshalSubmodulesmaxClientStreamIDmaxHeaderListSizeminConnectTimeoutmodSqrt3Mod4PrimemodSqrt5Mod8PrimenextElementLengthnormalizeFlagNamenormalizeNameFuncparseColonDefaultparseFieldIndexedparseFieldLiteralparseTemplateNameparseUnicodeClasspoolLocalInternalprePublishHandlerprepareCipherSpecprocessApp0MarkerprocessRunCommandpushCodeWithScopereadHeaderTimeoutreadReferenceFilereadReferenceFromreadSessionTicketremoveLeadingDotsscheduleBodyWritesendSessionTicketsessionTicketKeysstandardDeviationstaysWithinBufferstopShutdownTimersweepPagesPerBytetemplateNodeEdits checkPipeline@P checkPipeline@PtokenValueAllowedtraceIDUpperBounduncompressMessageuncompressedBytesunmarshalBranchesupdateDescriptionupdateFlowControlvagrantfileExistsvalueToOtherSliceversion_directivewaitWriterBlockedwatchRemoteConfigwriteBlockDynamicwriteCipherPacketwriteRecordLockedwriteStoredHeaderwritingFrameAsyncnet/http/httptrace**ast.CommentGroup**capability.entry**channelz.channel**config.Submodule**docker.DiskUsage**gob.encoderState**http.http2stream**http.persistConn**openpgp.Identity**packet.PublicKey**packet.Signature**parse.ActionNode**proto.Properties**tasks.TaskResult**trace.bucketData**transport.Stream**x509.Certificate*[0]*cobra.Command*[0]*command.Write*[0]*config.Option*[0]config.RefSpec*[1]*ast.ObjectKey*[1]*cobra.Command*[1]*object.Change*[1]*object.Commit*[1]*syntax.Regexp*[1]config.RefSpec*[1]gax.CallOption*[1]ssh.AuthMethod*[1]time.zoneTrans*[1]unsafe.Pointer*[2147483647]uint8*[2]config.RefSpec*[2]syscall._C_int*[2]unsafe.Pointer*[3]*cobra.Command*[4]*cobra.Command*[4]*norm.formInfo*[4]*reflect.rtype*[4]jpeg.component*[50]http.sniffSig*[536870911]uint32*[5]template.state*[6]*cobra.Command*[6]template.state*[7]*cobra.Command*[8]*anagent.Timer*[8]*config.Branch*[8]*grpc.addrConn*[8]*reflect.rtype*[8]*regexp.Regexp*[8]*runtime._type*[8][]*http.Cookie*[8][]interface {}*[8]chan struct {}*[8]common.Profile*[8]docker.Runtime*[8]encoding.Codec*[8]http.ConnState*[8]idna.joinState*[8]map[string]int*[8]parse.itemType*[8]tag.tagContent*[8]trace.Exporter*[8]unsafe.Pointer*[8]yaml.fieldInfo*[]**gob.decEngine*[]*ast.ObjectItem*[]*config.Section*[]*fsnotify.watch*[]*ghw.WithOption*[]*git.FileStatus*[]*parse.TextNode*[]*pubsub.Message*[]*regexp.machine*[]*runtime._defer*[]*runtime.bucket*[]*signal.handler*[]*ssh.cipherMode*[]*trace.SpanData*[]*trace.traceSet*[][4]jpeg.huffman*[][]net.nssSource*[][]reflect.Value*[]abstract.Scheme*[]address.Address*[]agenttasks.Plan*[]agenttasks.Task*[]anagent.Handler*[]anagent.TimerID*[]bidi.Properties*[]bson.RawElement*[]color.Attribute*[]dnsmessage.Type*[]docker.APIMount*[]docker.BuildArg*[]docker.Endpoint*[]flate.levelInfo*[]grpc.CallOption*[]http.http2Flags*[]http2.FrameType*[]http2.SettingID*[]idna.valueRange*[]index.TreeEntry*[]jmespath.jpType*[]jpeg.huffmanLUT*[]logrus.fieldKey*[]macaron.Handler*[]map[string]bool*[]norm.Properties*[]norm.valueRange*[]object.FileStat*[]proto.Extension*[]readpref.Option*[]reflect.imethod*[]runewidth.table*[]runtime.evacDst*[]runtime.functab*[]runtime.imethod*[]runtime.sigTabT*[]runtime.typeAlg*[]runtime.typeOff*[]setting.Setting*[]signal.stopping*[]ssh_config.Node*[]storage.Storage*[]syscall.Timeval*[]tls.Certificate*[]topology.Option*[]trace.Attribute*[]unicode.Range16*[]unicode.Range32*[]unix.EpollEvent*[]viper.FlagValue*[]webhook.WebHook*agent.ecdsaKeyMsg*agenttasks.Player*amqp.AMQPlainAuth*amqp.Acknowledger*amqp.Confirmation*amqp.basicConsume*amqp.basicDeliver*amqp.basicPublish*amqp.basicRecover*amqp.channelClose*amqp.exchangeBind*amqp.queueDeclare*amqp.queuePurgeOk*amqp.txRollbackOk*armor.lineBreaker*asn1.bytesEncoder*asn1.int64Encoder*asn1.multiEncoder*asn1.tagAndLength*auth.saslResponse*balancer.Balancer*balancer.DoneInfo*base.baseBalancer*bsoncore.Document*bsonx.KeyNotFound*buffruneio.Reader*bzip2.huffmanCode*bzip2.huffmanNode*bzip2.huffmanTree*chan *ssh.Request*chan *trace.trace*chan amqp.message*chan http.dialRes*chan interface {}*chan view.command*channelz.Severity*cipher.cbcDecAble*cipher.cbcEncAble*client.HttpClient*clog.discordEmbed*clog.rateLimitMsg*clog.slackPayload*command.Aggregate*command.Namespace*compressor.writer*config.AMQPConfig*config.Subsection*connection.Dialer*connection.Option*connection.config*context.cancelCtx*credentials.Value*crr.EndpointCache*crypto.PrivateKey*crypto.SignerOpts*cryptobyte.String*dnsmessage.Header*dnsmessage.OpCode*dnsmessage.Parser*dnsmessage.header*docker.APIVersion*docker.AuthStatus*docker.BlockLimit*docker.ChangeType*docker.DockerInfo*docker.HostConfig*docker.IPAMConfig*docker.NoSuchExec*docker.NoSuchNode*docker.NoSuchTask*docker.PluginArgs*docker.PluginUser*docker.closerFunc*docker.waiterFunc*dotgit.PackWriter*driver.WriteModel*duration.Duration*dynamodb.Capacity*dynamodb.DynamoDB*dynamodb.Endpoint*ed25519.PublicKey*elgamal.PublicKey*endpoints.Options*endpoints.Service*endpoints.regions*endpoints.service*envconfig.Decoder*errcode.ErrorCode*event.APIResponse*ext.stringTagName*filemode.FileMode*filepath.WalkFunc*fileutils.Pattern*flag.float64Value*flate.deflateFast*flate.dictDecoder*flate.literalNode*fsnotify.fdPoller*func() (int, int)*func() *list.List*func() [2]uintptr*func() []*any.Any*func() []big.Word*func() bidi.Class*func() bsonx.MDoc*func() clog.LEVEL*func() codes.Code*func() complex128*func() gob.typeId*func() net.IPMask*func() parse.Node*func() tar.Format*func() time.Month*func() url.Values*func(*pflag.Flag)*func(*uint8) bool*func([][32]uint8)*func([]uint8) int*func(bool) string*func(bool, error)*func(error) error*func(float64) int*func(func(error))*func(http.Header)*func(int) []int32*func(int) []uint8*func(int32) error*func(int32) int32*func(int64) error*func(int64) int64*func(log.Encoder)*func(logrus.Hook)*func(metadata.MD)*func(net.IP) bool*func(string) bool*func(string) uint*func(string, int)*func(uint) uint64*func(uint64) bool*func(uint8) error*gax.retryerOption*ghw.NICCapability*git.CommitOptions*gitignore.Matcher*gitignore.Pattern*gitignore.matcher*gitignore.pattern*grpc.ClientStream*grpc.Decompressor*grpc.MethodConfig*grpc.ServerStream*grpc.UnaryInvoker*grpc.channelzData*grpc.clientStream*hpack.HeaderField*http.RoundTripper*http.headerSorter*http.http2ErrCode*http.http2Setting*http.socksCommand*http.stringWriter*http.writeRequest*http2.FrameHeader*http2.GoAwayFrame*http2.StreamError*http2.frameParser*httpproxy.ipMatch*httpproxy.matcher*httputil.dumpConn*idna.sparseBlocks*idxfile.EntryIter*index.ResolveUndo*inject.TypeMapper*ioutil.readCloser*ioutil.readPeeker*iterator.PageInfo*json.arrayEncoder*json.floatEncoder*json.sliceEncoder*logging.Formatter*logrus.LevelHooks*macaron.staticMap*map[int64][]uint8*map[string]string*map[string]uint64*map[uint16]string*map[uint64]string*merkletrie.Action*merkletrie.Change*metricdata.Bucket*metricdata.Metric*mongo.WriteErrors*mongo.batchCursor*mongo.sessionImpl*mount.BindOptions*mount.Consistency*mount.Propagation*net.ipv6ZoneCache*nettrace.TraceKey*norm.sparseBlocks*object.CommitIter*object.ObjectIter*object.TreeWalker*options.Collation*packet.Compressed*packet.PrivateKey*packet.packetType*packet.signingKey*packet.spanReader*packfile.FSObject*packfile.Observer*packfile.Packfile*packp.UploadHaves*parse.CommandNode*pflag.ipMaskValue*pflag.stringValue*pflag.uint16Value*pflag.uint32Value*pflag.uint64Value*plumbing.Revision*poll.TimeoutError*polyfill.Polyfill*properties.Loader*properties.parser*proto.Unmarshaler*proto.discardInfo*proto.marshalInfo*proto.scalarField*proto.stringValue*proto.uint32Value*proto.uint64Value*proto.unmarshaler*ptypes.DynamicAny*pubsub.PushConfig*pubsub.pullStream*rand.lockedSource*readpref.ReadPref*reflect.StructTag*reflect.arrayType*reflect.bitVector*reflect.fieldScan*reflect.layoutKey*reflect.sliceType*regexp.inputBytes*request.Operation*request.Paginator*request.temporary*resolver.Resolver*resource.Resource*result.WriteError*revision.AtReflog*revision.CaretReg*revision.ColonReg*runtime._typePair*runtime.arenaHint*runtime.bitvector*runtime.elfVerdef*runtime.finalizer*runtime.gcTrigger*runtime.gclinkptr*runtime.heapArena*runtime.itimerval*runtime.mSpanList*runtime.memRecord*runtime.notInHeap*runtime.pollCache*runtime.profIndex*runtime.ptabEntry*runtime.spanClass*runtime.sweepdata*runtime.treapNode*scanner.ErrorList*scram.clientState*scram.derivedKeys*scram.serverState*setting.WebConfig*sideband.Progress*singleflight.call*sort.Float64Slice*sqs.TagQueueInput*ssh.TerminalModes*ssh.asn1Signature*ssh.channelEOFMsg*ssh.disconnectMsg*ssh.dsaPrivateKey*ssh.kexDHReplyMsg*ssh.ptyRequestMsg*ssh.setenvRequest*ssh.truncatingMAC*ssh.wrappedSigner*ssh_config.Config*stats.ConnTagInfo*stats.Measurement*strconv.floatInfo*strconv.leftCheat*struct { r1 int }*struct { r2 int }*struct { r3 int }*struct { r4 int }*struct { r5 int }*struct { r6 int }*struct { r7 int }*swarm.Annotations*swarm.ClusterInfo*swarm.IPAMOptions*swarm.InitRequest*swarm.JoinRequest*swarm.NetworkSpec*swarm.RuntimeType*swarm.ServiceMode*swarm.ServiceSpec*swarm.UpdateState*syscall.IfAddrmsg*syscall.IfInfomsg*tablewriter.Table*tabwriter.osError*tar.regFileWriter*template.HTMLAttr*template.Template*template.variable*testlog.Interface*time.runtimeTimer*toml.marshalOrder*topology.Topology*trace.SpanContext*trace.contextKeyT*trace.eventFamily*trace.lazySprintf*trace.traceBucket*transport.CallHdr*transport.Options*transport.recvMsg*unicode.CaseRange*view.viewInternal*wiremessage.Error*wiremessage.Query*wiremessage.Reply*x509.dsaSignature*x509.ecPrivateKey*xml.MarshalerAttr*yaml.yaml_break_t*yaml.yaml_event_t*yaml.yaml_style_t*yaml.yaml_token_tAddRecursiveDeleteAddRecursiveInsertAdvanceClusterTimeAlgo sshtype:"60"AllowIllegalWritesAppendCertsFromPEMApplyAuthToRequestBooleanDecodeValueBooleanEncodeValueCheckSignatureFromClientSessionCacheCommandPathPaddingCompressedByteSize ContextDirqs:"-"CopyValueFromBytesCreateQueueRequestCreateSubscriptionCreateTableRequestDefaultReadConcernDeleteMessageBatchDeleteQueueRequestDeleteSubscriptionDeleteTableRequestDescribeTimeToLiveDisableCompressionDisableFlagParsingDisableSuggestionsEndPageOnSameTokenExcludedDNSDomainsExcludedURIDomainsExemplarsPerBucketExpireAfterSecondsFParseErrWhitelistFileRotationConfigFindAllStringIndexFindStringSubmatchFlagEncryptStorageForeachBaggageItemFullCollectionNameGetClientStreamingGetConfigForClientGetCsharpNamespaceGetIdentifierValueGetItemWithContextGetLeadingCommentsGetObjcClassPrefixGetQueueAttributesGetQueueUrlRequestGetRequestMetadataGetServerStreamingGetStdoutThresholdGetStringMapStringHasHelpSubCommandsHasPersistentFlagsHealthCheckEnabled HostConfigqs:"-"IncrementTxnNumberIndexServerAddressInitDefaultHelpCmdInsecureSkipVerifyIsAvailableCommandIsLinkLocalUnicastItems type:"list"IterEncodedObjectsListBackupsRequestListTagsOfResourceListTopicSnapshotsLiveRestoreEnabledLookupTypeMapEntryMarshalWireMessageMaxConnIdleTimeSetMaxIdleNodesInTreeNegotiatedProtocolNewClientUnpreppedNewPipelineFromMapOrganizationalUnitOverrideServerNameParseMultipartFormPersistentPostRunEPreferredSymmetricProxyConnectHeaderPublicKeyAlgorithmPutItemWithContextReadAnyASN1ElementRecursionAvailableRegisterOnShutdownReportSpansByErrorResizeContainerTTYResolveCachedImageRotateManagerTokenSaslSupportedMechsSendMessageRequestServerHostKeyAlgosSetAttributesToGetSetBackupSizeBytesSetBackupSummariesSetCenterSeparatorSetColumnAlignmentSetColumnSeparatorSetDefaultLanguageSetFooterAlignmentSetGlobalTableNameSetHeaderAlignmentSetHostKeyCallbackSetKMSMasterKeyArnSetKeepAlivePeriodSetLatestStreamArnSetLinesForContentSetMaxStringLengthSetNoCursorTimeoutSetPathWithCommentSetPathWithOptionsSetPostTaskHandlerSetQueueAttributesSetQueueNamePrefixSetReplicaSettingsSetRestoreDateTimeSetScaleInCooldownSetScalingPoliciesSetSourceBackupArnSetSourceTableNameSetStdoutThresholdSetTargetTableNameSetUnprocessedKeysSetUploadChunkSizeSetVersionTemplateSetWaitTimeSecondsSetsockoptIPv6MreqSignatureAlgorithmSigningNameDerivedSkipAllAdditionalsSkipAllAuthoritiesStringToStringVarPTagResourceRequestTestIamPermissionsTransactWriteItemsTransactionRunningType sshtype:"80"UnknownExtKeyUsageUnmarshalBSONValueUpdateSubConnStateUpdateSubscriptionUpdateTableRequestUser sshtype:"50"VerifyKeySignatureVersionWithContextWaitForStateChangeWithNonceGeneratorWriteCodeWithScopeXXX_DiscardUnknownaffineFromJacobianallocatePromisedIDappendV1ExtensionsapplyServiceConfigassistBytesPerWorkawaitRequestCancelblockUntilWaitablebuildPackfileIterscanResolveEndpointcanWriteTwoRecordscheckForResumptioncheckNotFoundErrorclearCheckmarkSpanclientAuthenticatecommandsMaxNameLencompressionMethodscomputeDiscardInfocomputeMarshalInfocopyToExistingFilecreateHeaderFieldsdecodeIgnoredValuedecodeMapFromSlicedecodeReportStatusdecodeTypeSequencedefaultIsZeroValuedeleteSelfFromTreedisableCompressiondisableHealthCheckelementDecodeValueencodedDeltaObjectensureElementValueequalInterfaceDocsescapeTemplateBodyevalEmptyInterfaceexpectedAPIVersionflattenAndMergeMapflow_plain_allowedforceCgoLookupHostfractionalMarkTimeframeScratchBuffergetBodyWriterStategetExtensionReadergetIgnoreEnginePtrgetNextRequestBodygetStartDialLockedshouldThrottle@shouldThrottle@extensionsRead extensionsRead extensionsRead extensionsRead extensionsRead extensionsRead extensionsRead extensionsRead extensionsRead getCertificate$getCertificate$outgoingLength(outgoingLength(handleChannelOpenshandleForwardsOncehandleGlobalPackethandleWindowUpdatehasIncomingObjectshasNameConstraintshaveTemplateThreadhttp2PriorityParamincomingObjectPathincrCallsSucceededisHttpRule_PatternisSingleLineObjectisSupportedVersionkeepAliveDeadlineslazyPrintfInternallexRightCurlyBracelistenMulticastUDPlookupStringUnsafemaxHeaderStringLenmaxIdleNodesInTreemaxIncomingPayloadmaxSendMessageSizemergeWithEnvPrefixparseDSAPrivateKeyparseProjectionRHSparseRSAPrivateKeypartitionSizeBytespercentileBoundaryprintRowMergeCellsprobablyPrimeLucasprocessApp14MarkerprocessEqualsLinesprocessHeaderFieldprocessPushPromiseprocessResetStreamprocessServerHelloprojectNameElementproviderPathExistsputOrCloseIdleConnreadGitmodulesFilereadLengthPrefixedremoveServerByAddrreplaceReqCancelerreplayBufferLockedrequestKeyExchangeaddtimerLockedscanEscapeSequencescanUnicodeLiteralscheduleFrameWritesendTypeDescriptorsendWindowUpdate32serverAuthenticateserverCertificatessetMarkedNonAtomicshouldRetryRequestshouldTraceGetConnsignatureAlgorithmsimple_key_allowedsimple_key_contextstandaloneCommentssweepHeapLiveBasissystemConfigFindertag_directives_endtracebackancestorsunmarshalInterfaceupdateOrReplaceOnevalidateCollectionvalueFromTreeSlicewalkReferencesTreewriteDynamicHeaderwriteElementHeaderwriteThrottleLimitdatabase/sql/drivertext/template/parse**[2147483647]uint8**clog.rateLimitMsg**config.Subsection**dynamodb.Endpoint**fileutils.Pattern**ghw.NICCapability**metricdata.Metric**packet.PrivateKey**parse.CommandNode**proto.discardInfo**proto.marshalInfo**readpref.ReadPref**runtime.elfVerdef**runtime.heapArena**runtime.notInHeap**runtime.treapNode**template.Template**trace.eventFamily**view.viewInternal*<-chan *amqp.Error*<-chan ssh.forward*[0]*config.Section*[0]unicode.Range16*[1073741823]uint16*[10]*cobra.Command*[11]stringprep.Set*[12]*cobra.Command*[13]*cobra.Command*[15]runtime.dbgVar*[16]*reflect.rtype*[1]*ast.ObjectItem*[1]color.Attribute*[1]grpc.CallOption*[1]jmespath.jpType*[1]object.FileStat*[1]runewidth.table*[1]unicode.Range16*[1]unicode.Range32*[2][4]jpeg.huffman*[2]dnsmessage.Type*[2]jmespath.jpType*[2]runewidth.table*[2]runtime.evacDst*[2]syscall.Timeval*[2]unicode.Range16*[2]unicode.Range32*[32]*reflect.rtype*[3]jmespath.jpType*[3]runewidth.table*[3]unicode.Range16*[3]unicode.Range32*[4]jpeg.huffmanLUT*[4]unicode.Range16*[4]unicode.Range32*[512]*runtime.itab*[5]*runtime._defer*[5]unicode.Range16*[5]unicode.Range32*[64]*reflect.rtype*[6]abstract.Scheme*[6]unicode.Range16*[6]unicode.Range32*[7]unicode.Range16*[7]unicode.Range32*[7]unix.EpollEvent*[8]**gob.decEngine*[8]*fsnotify.watch*[8]*git.FileStatus*[8]*parse.TextNode*[8]*signal.handler*[8]*ssh.cipherMode*[8]*trace.traceSet*[8][]net.nssSource*[8][]reflect.Value*[8]address.Address*[8]anagent.TimerID*[8]color.Attribute*[8]docker.Endpoint*[8]http.http2Flags*[8]http2.FrameType*[8]http2.SettingID*[8]logrus.fieldKey*[8]map[string]bool*[8]proto.Extension*[8]runtime.typeOff*[8]unicode.Range16*[8]unicode.Range32*[8]viper.FlagValue*[9]unicode.Range16*[9]unicode.Range32*[]*agenttasks.Task*[]*channelz.server*[]*docker.NetIPNet*[]*proto.mergeInfo*[]*pubsub.Snapshot*[]*redis.fieldSpec*[]*ssh_config.Host*[]*tasks.Signature*[]*tasks.TaskState*[]*tls.Certificate*[]*tls.cipherSuite*[]*topology.Server*[]*trace.spanStore*[]*vagrantutil.Box*[]*view.measureRef*[]*xmlutil.XMLNode*[]*yaml.structInfo*[][]*cobra.Command*[][]*runtime._type*[][]tabwriter.cell*[]balancer.Builder*[]balancer.SubConn*[]bsoncore.Element*[]bsonrw.ejvwState*[]chan *amqp.Error*[]chan amqp.Return*[]chan<- os.Signal*[]context.canceler*[]digest.Algorithm*[]docker.APIImages*[]docker.HostMount*[]docker.PluginEnv*[]endpoints.Region*[]endpoints.region*[]flate.tableEntry*[]func() hash.Hash*[]ghw.Architecture*[]jmespath.ASTNode*[]jmespath.argSpec*[]jmespath.tokType*[]jpeg.huffmanSpec*[]json.encoderFunc*[]map[int32]string*[]map[string]int32*[]metricdata.Point*[]mongo.IndexModel*[]mongo.WriteModel*[]net.nssCriterion*[]object.TreeEntry*[]packet.parsedMPI*[]proto.extPropKey*[]resolver.Address*[]resolver.Builder*[]runtime.divMagic*[]runtime.guintptr*[]runtime.textsect*[]scram.KeyFactors*[]ssh.forwardEntry*[]ssh.kexAlgorithm*[]ssh_config.token*[]strconv.extFloat*[]swarm.IPAMConfig*[]swarm.PortConfig*[]syntax.charGroup*[]syscall.Timespec*[]template.context*[]template.element*[]trace.Annotation*[]tracestate.Entry*[]unicode.foldPair*[]utf8.acceptRange*[]x509.ExtKeyUsage*[]x509.rfc1423Algo*[]yaml.yaml_mark_t*[]yaml.yaml_node_t*agent.agentLockMsg*agent.ecdsaCertMsg*agenttasks.Handler*amqp.basicCancelOk*amqp.basicGetEmpty*amqp.channelFlowOk*amqp.channelOpenOk*amqp.confirmSelect*amqp.queueDeleteOk*amqp.queueUnbindOk*amqp.readDeadliner*archive.TarOptions*arraylist.Iterator*asn1.stringEncoder*asn1.taggedEncoder*auth.Authenticator*aws.RequestRetryer*base.PickerBuilder*bidirule.ruleState*binarylog.noopSink*bsoncodec.Registry*bsonrw.ArrayReader*bsonrw.ArrayWriter*bsonrw.BytesReader*bsonrw.BytesWriter*bsonrw.SliceWriter*bsonrw.ValueReader*bsonrw.ValueWriter*bsonrw.valueReader*bsonrw.valueWriter*cast5.keyScheduleA*cast5.keyScheduleB*chan *clog.Message*chan amqp.Blocking*chan amqp.Delivery*channelz.dbWrapper*clog.ConsoleConfig*clog.DiscordConfig*command.WriteBatch*common.ProfileConf*config.RedisConfig*config.Subsections*connectivity.State*context.CancelFunc*credentials.Bundle*description.Server*dnsmessage.Builder*dnsmessage.section*docker.BindOptions*docker.BlockWeight*docker.CloseWaiter*docker.ExecInspect*docker.GraphDriver*docker.HealthCheck*docker.IPAMOptions*docker.ImagePre012*docker.LogsOptions*docker.NetworkList*docker.PluginLinux*docker.PluginsInfo*docker.PortBinding*docker.PortMapping*docker.proxyReader*driver.BatchCursor*driver.UpdateModel*dynamodb.Condition*dynamodb.ScanInput*ecdsa.combinedMult*ed25519.PrivateKey*elgamal.PrivateKey*elliptic.p224Curve*elliptic.p256Curve*endpoints.Endpoint*endpoints.Resolver*endpoints.awsError*endpoints.endpoint*endpoints.services*errors.errorString*filesystem.Options*filesystem.Storage*flag.ErrorHandling*flag.durationValue*flate.decompressor*func() (int, bool)*func() *iam.Handle*func() *iam.Policy*func() *parse.Tree*func() *tls.Config*func() <-chan bool*func() []bsonx.Doc*func() billy.Basic*func() color.Model*func() crypto.Hash*func() gax.Retryer*func() http.Header*func() image.Point*func() metadata.MD*func() noder.Noder*func() os.FileInfo*func() os.FileMode*func() primitive.M*func() sync.Locker*func() token.Token*func() uuid.Domain*func() xml.Comment*func(*big.Int) int*func(*big.Rat) int*func(*http.Cookie)*func(*trace.trace)*func(*uint16) bool*func(*uint32) bool*func(*view.worker)*func(...log.Field)*func([]uint8) bool*func([]uint8, int)*func(chan<- error)*func(crr.Endpoint)*func(float64) bool*func(func() error)*func(iface.Broker)*func(int, []uint8)*func(int, int) int*func(interface {})*func(logrus.Level)*func(string) []int*func(string) error*func(string) int32*func(string) int64*func(string, bool)*func(trace.Status)*func(uint32) error*func(uint64) error*func(uintptr) bool*gob.gobEncoderType*grpc.ServiceConfig*grpc.StreamHandler*grpc.payloadFormat*grpc.pickerWrapper*grpc.scStateUpdate*hpack.dynamicTable*http.CloseNotifier*http.ProtocolError*http.bodyEOFSignal*http.connectMethod*http.http2dialCall*http.serverHandler*http.writeStringer*http2.HeadersFrame*http2.UnknownFrame*httpproxy.allMatch*inject.FastInvoker*io.ReadWriteCloser*ioutil.writeCloser*json.structEncoder*json.unquotedValue*jsonmessage.stream*knownhosts.matcher*macaron.BeforeFunc*map.bucket[int]int*map.hdr[string]int*map[*uint8][]uint8*map[int]*sync.Pool*map[int]codes.Code*map[ssh.Signal]int*map[string]*string*map[string][]uint8*map[uint32][]uint8*map[uint]chan uint*mapstructure.Error*mapstructure.field*merkletrie.Changes*metricdata.Summary*mongo.BSONAppender*mongo.ChangeStream*mongo.CommandError*mongo.DeleteResult*mongo.MarshalError*mongo.SingleResult*mongo.UpdateResult*mongo.returnResult*mount.TmpfsOptions*net.resolverConfig*norm.reorderBuffer*object.ChangeEntry*openpgp.EntityList*opentracing.Tracer*options.CursorType*packet.LiteralData*packet.PublicKeyV3*packet.SignatureV3*packet.seMDCReader*packfile.teeReader*packp.DepthCommits*packp.ReportStatus*packp.ulReqDecoder*packp.ulReqEncoder*parse.TemplateNode*parse.VariableNode*pflag.float32Value*pflag.float64Value*pflag.ipSliceValue*plumbing.HashSlice*plumbing.Reference*primitive.DateTime*primitive.ObjectID*printer.ByPosition*properties.stateFn*proto.float32Value*proto.float64Value*proto.mapKeySorter*proto.newMarshaler*proto.oneofMessage*pubsub.PullRequest*pubsub.SeekRequest*pubsub.TopicConfig*pubsub.pullOptions*readconcern.Option*reflect.ValueError*reflect.layoutType*reflect.structType*regexp.inputReader*regexp.inputString*regexp.onePassInst*regexp.onePassProg*request.Pagination*result.AsyncResult*result.EndSessions*result.KillCursors*revision.CaretPath*revision.CaretType*revision.ColonPath*revision.TildePath*runewidth.interval*runtime.PluginSpec*runtime.adjustinfo*runtime.bucketType*runtime.cgoCallers*runtime.cpuProfile*runtime.epollevent*runtime.gcSweepBuf*runtime.mSpanState*runtime.moduledata*runtime.modulehash*runtime.notifyList*runtime.pcExpander*runtime.plainError*runtime.profAtomic*runtime.randomEnum*runtime.sigactiont*runtime.sysmontick*runtime.traceAlloc*runtime.traceStack*runtime.waitReason*runtime.workbufhdr*semaphore.Weighted*singleflight.Group*sqs.TagQueueOutput*ssh.BannerCallback*ssh.channelDataMsg*ssh.channelOpenMsg*ssh.ecdsaPublicKey*ssh.kexECDHInitMsg*ssh_config.Include*ssh_config.Pattern*stats.Int64Measure*status.statusError*storer.Initializer*stringprep.Mapping*stringprep.Profile*swarm.EndpointSpec*swarm.Reachability*swarm.TaskDefaults*swarm.UpdateConfig*swarm.UpdateStatus*syscall.Credential*syscall.WaitStatus*tablewriter.Border*tablewriter.Colors*tagencoding.Values*tar.headerFileInfo*template.ErrorCode*template.ExecError*template.nameSpace*textproto.Pipeline*time.fileSizeError*timeseries.tsLevel*tls.ClientAuthType*tls.certificateMsg*tls.clientHelloMsg*tls.ecdsaSignature*tls.fixedNonceAEAD*tls.serverHelloMsg*trace.MessageEvent*trace.TraceOptions*trace.evictedQueue*trace.exportersMap*trace.internalOnly*transport.Endpoint*transport.itemList*transport.itemNode*transport.trInFlow*unicode.RangeTable*unix.GetRandomFlag*vagrantutil.Status*viper.FlagValueSet*warnings.Collector*wiremessage.Header*wiremessage.OpCode*x509.HostnameError*x509.InvalidReason*x509.VerifyOptions*x509.pssParameters*x509.publicKeyInfo*xml.UnmarshalError*yaml.yaml_parser_tAddMessageSendEventAllowPartialResultsAppendDocumentBytesAssignComputeBounds AuthConfigsqs:"-"BatchGetItemRequestBody type:"string"BundleByteThresholdCiphersClientServerCiphersServerClientColor json:"color" Containerjson:"-"CopyDocumentToBytesCreateBackupRequestDateTimeDecodeValueDateTimeEncodeValueDefaultWriteConcernDeleteBackupRequestDescribeGlobalTableDiffCleanupSemanticDocumentDecodeValueDocumentEncodeValueDpasn1:"optional"Dqasn1:"optional"Email form:"email"Error bson:"error"Error json:"error" ErrorStreamqs:"-"Event json:"event"ExtensionRangeArrayFillFromRDNSequenceFormDataContentTypeGetExpirationPolicyGetIdempotencyLevelGetNegativeIntValueGetPayloadTruncatedGetPluginPrivilegesGetPositiveIntValueGetPublicDependencyGetReceivedMessagesGetTrailingCommentsHandleResolvedAddrsHeaderBlockFragmentIndex bson:"index"InitDefaultHelpFlag InputStreamqs:"-"InspectDistributionInternalServerErrorIsPublishAppendModeLabels qs:"labels"ListFilteredPluginsLoadBalancingPolicyLogEventWithPayloadMaxIdleConnsPerHostMaxOutstandingBytesMemory qs:"memory"NamespaceRemovePathNewPipelineFromJsonNonce bson:"nonce"ObjectIDDecodeValueObjectIDEncodeValuePayload ssh:"rest"PermitWithoutStreamPermittedDNSDomainsPermittedURIDomainsQueueDeclarePassive RawTerminalqs:"-"RawValueDecodeValueRawValueEncodeValueReason sshtype:"1"Redis yaml:"redis"Remote qs:"remote"RemoveEventListenerRemoveImageExtendedResetConnectBackoffRetainAckedMessagesSelectedDescriptionSendTaskWithContext ServiceSpecqs:"-"SetAttributeUpdatesSetBinaryListValuesSetConsumedCapacitySetCreationDateTimeSetFilterExpressionSetGoogleClientInfoSetLanguageOverrideSetLastEvaluatedKeySetMD5OfMessageBodySetMaxReadFrameSizeSetNonKeyAttributesSetReplicationGroupSetSSESpecificationSetScaleOutCooldownSetScanIndexForwardSetStringListValuesSetTableDescriptionSetTimeToLiveStatusSetUnprocessedItemsSetUpdateExpressionSetsockoptInet4AddrShorthandDeprecatedState bson:"state"TLSHandshakeTimeoutTagQueueWithContextTarget gs:"target"Title json:"title"TransactionStartingUpdateBalancerStateUpdateResolverStateUploadArtefactRetryUploadNamespaceFileValidateWireMessageValue bson:"value"WithS3UseAccelerate_type:"structure"addClosedOrIdleNodeadobeTransformValidautomaticEnvAppliedblock_plain_allowedbytesFromFirstChunkcheckForStreamQuotacheckoutFileSymlinkcloseDoneChanLockedcommandStartedEventcommitAttemptLockedcompareAndSwapStatecompileIgnoreSingleconstructHTTPErrMsgconsumeCommentGroupconvertLegacyParamscreateNewObjectPackcreateServerSessioncurrentSubscriberIDdecodeCommandStatusdecodeDeepenCommitsdecodeDeltaObjectAtdecodeMapFromStructdecodeStructFromMapdecodeUnshallowLinedeleteOutdatedFilesdidCommitAfterStartdiffTreeWithStagingdoUpdateFileToIndexdocumentDecodeValueeffectiveWindowSizeenableWriteThrottleevalUnsignedIntegerfixTransferEncodinggetInterfacePointergetSubmodulesStatusclientHandshake$sendAlertLocked$serverHandshake$clientHandshake$sendAlertLocked$serverHandshake$extensionsWrite extensionsWrite extensionsWrite extensionsWrite extensionsWrite extensionsWrite extensionsWrite extensionsWrite extensionsWrite expectsContinue(expectsContinue(multipartReader(multipartReader(setReadDeadline setReadDeadline prepareForWritehandleRenegotiationhasSignatureAndHashhttp2clientConnPoolinFrameScheduleLoopinternalServerErrorlastCallStartedTimemaxIdleConnsPerHostmemTotalUsableBytesmergePendingUpdatesnLeadingNonStartersnetDeviceMacAddressnewWriterAndRequestnumTransientFailuresetReadDeadline setReadDeadline parseHeartbeatFrameparseSingleShortArgpartitionIsReadOnlypartitionMountPointprintRowsMergeCellsprintStringInternalprocessWindowUpdatereadByteStuffedByteredirectToPathSlashremoveLeadingRegexpremoveLeadingStringrequestBodyLimitHitrequestedAPIVersionresetConnectBackoffresetReadThresholdsresolveToCommitHashsecureRenegotiationsetAuthFromEndpointsetRawContentHeadersetupHTTP2_ServeTLSsliceWithReflectionspecialprofileallocstartBackgroundReadstream_end_producedsubscriptionsClosedtag_directives_datatemplateControl@PparseDefinition@PtemplateControl@PparseDefinition@PupdateParentsPflagsupdateRSFromPrimaryupdateResolverStatevalidateNoEmptyArgsvalueFromOtherSlicewaitUntilAllHandledwatchKeyValueConfigwriteOfsDeltaHeaderwriteRefDeltaHeaderxorKeyStreamGenericmime/quotedprintableruntime/internal/sys**[1073741823]uint16**bsoncodec.Registry**dynamodb.Condition**parse.TemplateNode**parse.VariableNode**plumbing.Reference**regexp.onePassProg**result.AsyncResult**runtime.moduledata**semaphore.Weighted**ssh_config.Pattern**timeseries.tsLevel*<-chan *ssh.Request*[0]*xmlutil.XMLNode*[10]unicode.Range16*[11]unicode.Range16*[128]*reflect.rtype*[128]*runtime.sudog*[12]unicode.Range16*[134]*runtime.mspan*[13]unicode.Range16*[13]unicode.Range32*[14]runtime.typeAlg*[14]unicode.Range16*[15]unicode.Range16*[15]unicode.Range32*[16]flate.levelInfo*[16]unicode.Range16*[16]unicode.Range32*[18]unicode.Range16*[18]unicode.Range32*[1]*ssh_config.Host*[1]*xmlutil.XMLNode*[1]jmespath.ASTNode*[1]jmespath.argSpec*[1]metricdata.Point*[1]mongo.IndexModel*[1]packet.parsedMPI*[1]resolver.Address*[1]x509.ExtKeyUsage*[20]unicode.Range16*[21]unicode.Range16*[22]unicode.Range16*[23]unicode.Range16*[24]unicode.Range32*[25]unicode.Range16*[28]unicode.Range16*[2]jmespath.ASTNode*[2]jmespath.argSpec*[2]packet.parsedMPI*[2]syscall.Timespec*[31]norm.Properties*[31]unicode.Range16*[31]unicode.Range32*[32]*runtime._defer*[32]norm.Properties*[32]unicode.Range16*[33]unicode.Range16*[33]unicode.Range32*[34]unicode.Range32*[35]unicode.Range32*[36]unicode.Range32*[37]unicode.Range16*[38]unicode.Range32*[39]unicode.Range32*[3]jmespath.ASTNode*[3]jmespath.tokType*[3]packet.parsedMPI*[40]unicode.Range16*[43]unicode.Range16*[43]unicode.Range32*[44]unicode.Range16*[48]unicode.Range32*[4]jpeg.huffmanSpec*[4]packet.parsedMPI*[512]*runtime.mspan*[58]unicode.Range32*[59]unicode.Range32*[5]utf8.acceptRange*[5]x509.rfc1423Algo*[62]unicode.Range32*[63]unicode.Range16*[64]unicode.Range32*[65]runtime.sigTabT*[66]unicode.Range16*[70]unicode.Range16*[72]unicode.Range32*[77]unicode.Range32*[8]*agenttasks.Task*[8]*channelz.server*[8]*proto.mergeInfo*[8]*redis.fieldSpec*[8]*tls.Certificate*[8]*topology.Server*[8]*trace.spanStore*[8]*view.measureRef*[8]*yaml.structInfo*[8][]*cobra.Command*[8][]*runtime._type*[8]balancer.Builder*[8]balancer.SubConn*[8]chan<- os.Signal*[8]context.canceler*[8]digest.Algorithm*[8]endpoints.Region*[8]endpoints.region*[8]ghw.Architecture*[8]jmespath.tokType*[8]map[int32]string*[8]map[string]int32*[8]proto.extPropKey*[8]resolver.Address*[8]resolver.Builder*[8]scram.KeyFactors*[8]ssh.kexAlgorithm*[8]strconv.extFloat*[8]syntax.charGroup*[8]template.context*[8]template.element*[91]unicode.Range32*[92]unicode.Range16*[97]unicode.Range16*[]*ast.CommentGroup*[]*capability.entry*[]*channelz.channel*[]*config.Submodule*[]*docker.IndexInfo*[]*dynamodb.Replica*[]*http.http2stream*[]*http.persistConn*[]*iam.BindingDelta*[]*object.TreeEntry*[]*openpgp.Identity*[]*packet.Signature*[]*parse.ActionNode*[]*proto.Properties*[]*redis.structSpec*[]*strings.trieNode*[]*swarm.ExternalCA*[]*tasks.TaskResult*[]*trace.bucketData*[]*transport.Stream*[]*x509.Certificate*[][8]idna.joinState*[][]*runtime._defer*[]amqp.Confirmation*[]bzip2.huffmanCode*[]bzip2.huffmanNode*[]connection.Option*[]docker.BlockLimit*[]docker.IPAMConfig*[]driver.WriteModel*[]endpoints.Service*[]endpoints.service*[]errcode.ErrorCode*[]flate.literalNode*[]gitignore.Pattern*[]grpc.MethodConfig*[]hpack.HeaderField*[]http.RoundTripper*[]http.http2ErrCode*[]http.http2Setting*[]http2.frameParser*[]httpproxy.matcher*[]map[string]string*[]merkletrie.Change*[]metricdata.Bucket*[]object.CommitIter*[]packfile.Observer*[]proto.scalarField*[]reflect.fieldScan*[]result.WriteError*[]runtime._typePair*[]runtime.finalizer*[]runtime.mSpanList*[]runtime.ptabEntry*[]scram.derivedKeys*[]stats.Measurement*[]strconv.leftCheat*[]template.variable*[]transport.recvMsg*[]unicode.CaseRange*[]yaml.yaml_event_t*[]yaml.yaml_token_t*agent.ExtendedAgent*agent.ed25519KeyMsg*agenttasks.Executor*agenttasks.Pipeline*amqp.Authentication*amqp.basicConsumeOk*amqp.basicRecoverOk*amqp.channelCloseOk*amqp.connectionOpen*amqp.connectionTune*amqp.exchangeBindOk*amqp.exchangeDelete*amqp.exchangeUnbind*amqp.heartbeatFrame*amqp.protocolHeader*amqp.queueDeclareOk*archive.Compression*archive.tarAppender*armor.openpgpReader*awserr.requestError*backoff.Exponential*balancer.ClientConn*balancer.V2Balancer*balancerload.Parser*bcryptsha256.scheme*binary.littleEndian*binaryheap.Iterator*bsoncodec.Marshaler*chan *amqp.Delivery*chan fsnotify.Event*chan net.dialResult*chan ssh.NewChannel*channelz.TraceEvent*channelz.channelMap*channelz.dummyEntry*channelz.int64Slice*channelz.subChannel*chroot.ChrootHelper*cipher.StreamReader*cipher.cbcDecrypter*cipher.cbcEncrypter*clog.discordPayload*command.DropIndexes*command.EndSessions*command.KillCursors*command.ListIndexes*config.RemoteConfig*connection.acquired*container.Isolation*crc32.slicing8Table*credentials.Expirer*crr.WeightedAddress*des.tripleDESCipher*diff.UnifiedEncoder*diff.hunksGenerator*diffmatchpatch.Diff*digest.hashVerifier*dnsmessage.Question*dnsmessage.Resource*docker.HealthConfig*docker.ImageHistory*docker.ImageSummary*docker.KeyValuePair*docker.NetworkStats*docker.NoSuchConfig*docker.NoSuchPlugin*docker.NoSuchSecret*docker.PluginConfig*docker.PluginDetail*docker.StatsOptions*docker.registryAuth*docker.tlsClientCon*dotgit.ObjectWriter*dotgit.syncedReader*dynamodb.Projection*dynamodb.PutRequest*dynamodb.QueryInput*dynamodb.ScanOutput*encoding.Compressor*endpoints.Partition*endpoints.boxedBool*endpoints.endpoints*endpoints.partition*flate.InternalError*func() (bool, bool)*func() (int, error)*func() *color.Color*func() *object.Tree*func() []*diff.hunk*func() []diff.Chunk*func() big.Accuracy*func() iface.Broker*func() interface {}*func() logrus.Level*func() packp.Action*func() reflect.Kind*func() reflect.Type*func() time.Weekday*func() uuid.Variant*func() uuid.Version*func() xml.CharData*func() xml.ProcInst*func(*[]uint8) bool*func(*bufio.Reader)*func(*bufio.Writer)*func(*bytes.Buffer)*func(*flag.FlagSet)*func(*http.Request)*func(*list.Element)*func(*runtime.itab)*func([]string) bool*func([]uint8) []int*func([]uint8) error*func(asn1.Tag) bool*func(float64) error*func(func() string)*func(iface.Backend)*func(int) token.Pos*func(int, int) bool*func(io.ReadSeeker)*func(logging.Level)*func(net.Addr) bool*func(packet.Packet)*func(plumbing.Hash)*func(proto.Message)*func(proto.pointer)*func(reflect.Value)*func(string) string*func(string) uint64*func(string, int32)*func(string, int64)*func(time.Duration)*func(token.Pos) int*func(uintptr) uint8*ghw.MemoryCacheType*git.CheckoutOptions*git.SubmoduleStatus*git.buildTreeHelper*git.sortableEntries*grpc.addrConnStream*grpc.funcDialOption*grpc.retryThrottler*hpack.DecodingError*hpack.pairNameValue*http.ResponseWriter*http.badStringError*http.countingWriter*http.http2DataFrame*http.http2FrameType*http.http2PingFrame*http.http2SettingID*http.http2Transport*http.http2connError*http.http2httpError*http.http2writeData*http.initNPNRequest*http.maxBytesReader*http.requestAndChan*http.transferReader*http.transferWriter*http2.PriorityFrame*http2.PriorityParam*http2.SettingsFrame*http2.serverMessage*httpproxy.cidrMatch*httputil.ClientConn*iam.IAMPolicyClient*iam.iAMPolicyClient*idxfile.MemoryIndex*iface.TaskProcessor*jmespath.jpFunction*jmespath.sliceParam*json.MarshalerError*knownhosts.KeyError*knownhosts.KnownKey*logging.BaseHandler*macaron.ComboRouter*macaron.DummyRender*macaron.HTMLOptions*macaron.RequestBody*macaron.patternType*map.hdr[string]bool*map.hdr[uint64]bool*map.iter[string]int*map[*yaml.node]bool*map[codes.Code]bool*map[float64]float64*map[gob.typeId]bool*map[int64]struct {}*map[string][2]int32*map[string][]string*measurable.HookFunc*metadata.ClientInfo*metricdata.Exemplar*metricdata.LabelKey*metricdata.Snapshot*mount.VolumeOptions*namespace.Namespace*net.hostLookupOrder*opentracing.LogData*options.FindOptions*packet.EncryptedKey*packet.kdfAlgorithm*packfile.deltaIndex*packfile.objectInfo*packfile.objectIter*packp.CommandStatus*packp.ShallowUpdate*packp.UploadRequest*packp.updReqDecoder*pflag.ErrorHandling*pflag.bytesHexValue*pflag.durationValue*pflag.intSliceValue*plumbing.ObjectType*poly1305.macGeneric*primitive.DBPointer*primitive.Timestamp*primitive.Undefined*properties.Encoding*properties.itemType*proto.ExtensionDesc*proto.TextMarshaler*proto.unmarshalInfo*protocol.EscapeMode*pubsub.PullResponse*pubsub.SeekResponse*pubsub.Subscription*reflect.StructField*reflect.methodValue*reflect.sliceHeader*reflect.structField*regexp.queueOnePass*request.HandlerList*request.WaiterDelay*request.WaiterState*resolver.ClientConn*revision.AtCheckout*revision.AtUpstream*revision.Revisioner*roundrobin.rrPicker*runewidth.Condition*runtime.blockRecord*runtime.errorString*runtime.gcBitsArena*runtime.inlinedCall*runtime.linearAlloc*runtime.randomOrder*runtime.structfield*runtime.traceBufPtr*setting.AgentConfig*singleflight.Result*sqs.ListQueuesInput*sqs.PurgeQueueInput*sqs.UntagQueueInput*ssh.HostKeyCallback*ssh.RejectionReason*ssh.channelCloseMsg*ssh.connectionState*ssh.genericCertData*ssh.handshakeMagics*ssh.kexECDHReplyMsg*ssh.keyingTransport*ssh.windowAdjustMsg*ssh_config.Position*ssh_config.sshLexer*stats.recordOptions*storer.bareIterator*struct { N string }*swarm.ContainerSpec*swarm.GlobalService*swarm.ManagerStatus*swarm.RestartPolicy*syscall.RawSockaddr*syscall.SysProcAttr*tar.numberFormatter*tar.stringFormatter*template.writeError*textproto.dotReader*textproto.sequencer*timestamp.Timestamp*tls.ClientHelloInfo*tls.ConnectionState*tls.SignatureScheme*tls.helloRequestMsg*tls.rsaKeyAgreement*toml.tomlLexStateFn*transport.Transport*transport.bufWriter*transport.dataFrame*transport.outStream*vagrantutil.Vagrant*vagrantutil.command*viper.pflagValueSet*wiremessage.GetMore*wiremessage.MsgFlag*wiremessage.Section*writeconcern.Option*x509.ecdsaSignature*x509.pkcs1PublicKey*x509.rfc2821Mailbox*x509.tbsCertificate*xml.UnmarshalerAttr*yaml.resolveMapItem*yaml.yaml_emitter_tAddPermissionRequestAdvanceOperationTimeAdvertisedReferencesBOOLtype:"boolean"BrokerMessageGroupIdBundleCountThresholdByteSliceDecodeValueByteSliceEncodeValueCheckAndSetReferenceCloseIdleConnectionsCommandFinishedEventConfigureBucketSizesConstraintExtensionsCookie sshtype:"20"DBPointerDecodeValueDBPointerEncodeValueDeleteMessageRequestDescribeTableRequestDisableServiceConfigExpected type:"map"ExportKeyingMaterialFilteredListNetworksFindAllSubmatchIndexGenZshCompletionFileGetCcGenericServicesGetClientCertificateGetJavaMultipleFilesGetPyGenericServicesGetReturnImmediatelyGetStoredCredentialsGetSuperSecureCookieGotFirstResponseByteGreaterThanOrEqualToHandleCacheImagePushHeartbeatIntervalSetIDjson:"partition"Infojson:"network"IsLinkLocalMulticastListQueueTagsRequestMarshalerEncodeValueMaxAttributesPerSpanMaxClosedNodesInTreeMaxConcurrentStreamsMaxRequestsSucceededMessageStoragePolicyNULLtype:"boolean"NewCustomQueueWorkerNewReadCloserWrapperNewUploadPackSessionNextBoundaryInStringNoOverwriteDirNonDirNumkeys sshtype:"2"ObjType json:"type"OnlyObjectsOlderThan OutputStreamqs:"-"ParseErrorsWhitelistPatchDeleteThresholdPreferredCompressionReadASN1Int64WithTagRegisterTypeMapEntryReplaceAllStringFuncReportSpansByLatencyReportSpansPerMethodRetryableStatusCodesReturnFieldsSelectorRevocationReasonTextS3Disable100ContinueSaveOriginalMetadataScanPagesWithContextSendChainWithContextSendChordWithContextSendGroupWithContextService sshtype:"5"Service sshtype:"6"SetAutoFormatHeadersSetBackupDescriptionSetCausalConsistencySetExclusiveStartKeySetGlobalTableStatusSetItemCollectionKeySetKeepAlivesEnabledSetLatestStreamLabelSetMessageAttributesSetReadCapacityUnitsSetRestoreInProgressSetSessionTicketKeysSetStreamDescriptionSetSuperSecureCookieSetVisibilityTimeoutSource qs:"fromSrc"StartAtOperationTimeStartExecNonBlockingTaskUUID bson:"_id"TimestampDecodeValueTimestampEncodeValueTransactionCommittedTransportCredentialsUncompressedByteSizeUndefinedDecodeValueUndefinedEncodeValueUnmarshalWireMessageUnmarshalWithContextUntagResourceRequestVerifyKeySignatureV3WaitUntilTableExistsWithEndpointResolverWithS3ForcePathStyleWriteDocumentElementbufferForRetryLockedbuildCommitSignaturecheckNameConstraintscheckResourceSectionchunkHeaderAvailablecleanupStreamHandlerclearTransactionOptscloseConnIfStillIdlecloseIdleConnectionscloseImplicitSessioncloseListenersLockedcommandFinishedEventcommonNameAsHostnamecomputeUnmarshalInfoconnPerHostAvailabledefaultServiceConfigdeleteFromFilesystemdisableServiceConfigencodeAditionalWantstryGrowByResliceqfindObjectInPackfilefindPackedRefsInFilefindPotentialParentsfindRunnableGCWorkerfixAndBreakChainsOnegcFractionalMarkTimecurvePreferences$curvePreferences$decodeVarintSlow setWriteDeadline setWriteDeadline goLookupIPCNAMEOrderhandleGlobalRequestshasNameOrAliasPrefixinitialReadLimitSizeinvalidTransitionErrisSeekRequest_TargetmarshalTextInterfacemaxClosedNodesInTreemaxConcurrentStreamsmergePersistentFlagsmodSqrtTonelliShanksnTrailingNonStartersnewRecordHeaderErrornewUploadPackRequestnumExpectedResponsesobjectHeaderAtOffsetsetWriteDeadline setWriteDeadline parseECDSAPrivateKeyparseHeaderFieldReprparseIndexExpressionparseMultiSelectHashparseMultiSelectListparsePerlClassEscapeparseSliceExpressionpathSysBusPciDevicespublishMessageBundleremoveEmptyDirectoryremoveIdleConnLockedresetWriteThresholdsretryableStatusCodesserverResumedSessionsetInfiniteReadLimitstandardStatusActiontag_directives_startunreadDataSizeLockedvalidateFullRevisionversionedAuthConfigswaitForResolvedAddrswantsHttp10KeepAlivewriteDataFromHandlerinternal/singleflightinternal/syscall/unix**agenttasks.Pipeline**channelz.TraceEvent**config.RemoteConfig**git.SubmoduleStatus**metricdata.Exemplar**options.FindOptions**packfile.objectInfo**packp.CommandStatus**proto.unmarshalInfo**pubsub.PullResponse**pubsub.SeekResponse**pubsub.Subscription**transport.outStream**vagrantutil.Vagrant*<-chan amqp.Delivery*[0]merkletrie.Change*[0]metricdata.Bucket*[0]reflect.fieldScan*[100]unicode.Range16*[102]unicode.Range16*[103]unicode.Range16*[109]unicode.Range16*[112]unicode.Range16*[117]unicode.Range16*[123]unicode.Range16*[126]unicode.Range16*[128]bidi.Properties*[147]unicode.Range16*[150]unicode.Range32*[176]unicode.Range16*[178]unicode.Range16*[189]unicode.Range32*[190]unicode.Range16*[1]*x509.Certificate*[1]driver.WriteModel*[1]httpproxy.matcher*[1]packfile.Observer*[1]reflect.fieldScan*[1]stats.Measurement*[1]template.variable*[22]*tls.cipherSuite*[282]unicode.Range16*[28]jmespath.tokType*[2]http.http2Setting*[359]unicode.Range16*[3]connection.Option*[4]http.http2Setting*[4]runtime.mSpanList*[5][]*runtime._defer*[67]runtime.divMagic*[682]norm.valueRange*[6][8]idna.joinState*[869]norm.valueRange*[87]strconv.extFloat*[88]unicode.foldPair*[8]*ast.CommentGroup*[8]*capability.entry*[8]*channelz.channel*[8]*config.Submodule*[8]*docker.IndexInfo*[8]*http.http2stream*[8]*http.persistConn*[8]*object.TreeEntry*[8]*openpgp.Identity*[8]*parse.ActionNode*[8]*proto.Properties*[8]*redis.structSpec*[8]*transport.Stream*[8]*x509.Certificate*[8]amqp.Confirmation*[8]endpoints.Service*[8]endpoints.service*[8]errcode.ErrorCode*[8]grpc.MethodConfig*[8]http.RoundTripper*[8]http.http2ErrCode*[8]http2.frameParser*[8]map[string]string*[8]runtime._typePair*[8]scram.derivedKeys*[]*clog.discordEmbed*[]*config.Subsection*[]*dynamodb.Capacity*[]*dynamodb.Endpoint*[]*fileutils.Pattern*[]*ghw.NICCapability*[]*metricdata.Metric*[]*parse.CommandNode*[]*proto.discardInfo*[]*proto.marshalInfo*[]*runtime.heapArena*[]*singleflight.call*[]*ssh_config.Config*[]*template.Template*[]*trace.eventFamily*[]*trace.traceBucket*[]*view.viewInternal*[][]*xmlutil.XMLNode*[]chan amqp.Blocking*[]connectivity.State*[]description.Server*[]dnsmessage.section*[]docker.BlockWeight*[]docker.HealthCheck*[]docker.PortBinding*[]docker.PortMapping*[]endpoints.Endpoint*[]endpoints.endpoint*[]macaron.BeforeFunc*[]mapstructure.field*[]readconcern.Option*[]regexp.onePassInst*[]result.EndSessions*[]runewidth.interval*[]runtime.epollevent*[]runtime.gcSweepBuf*[]runtime.modulehash*[]stringprep.Mapping*[]tablewriter.Colors*[]trace.MessageEvent*agent.SignatureFlags*agent.agentUnlockMsg*agent.ed25519CertMsg*amqp.confirmSelectOk*amqp.connectionClose*amqp.connectionStart*amqp.consumerBuffers*amqp.exchangeDeclare*annotations.HttpRule*annotations.Resource*asn1.StructuralError*asn1.fieldParameters*auth.plainSaslClient*awserr.BatchedErrors*balancer.PickOptions*bidirule.Transformer*bson.PrimitiveCodecs*bsoncodec.StructTags*bsoncodec.ValueCodec*bsonrw.jsonTokenType*chan *resolver.State*chan *ssh.pendingKex*chan *trace.eventLog*chan http.readResult*chan properties.item*chan<- *docker.Stats*channelz.idGenerator*clog.ErrConfigObject*clog.ErrInvalidLevel*clog.slackAttachment*cobra.PositionalArgs*command.DropDatabase*common.AMQPConnector*common.CommandKiller*common.ServerCommand*config.MongoDBConfig*connection.PoolError*connection.TLSConfig*credentials.AuthInfo*credentials.Provider*crypto.DecrypterOpts*description.Topology*diffmatchpatch.Patch*dnsmessage.AResource*docker.APIContainers*docker.NoSuchNetwork*docker.NoSuchService*docker.PluginNetwork*docker.RestartPolicy*docker.ServiceConfig*docker.TempfsOptions*docker.VolumeOptions*docker.hijackOptions*docker.streamOptions*dynamodb.GlobalTable*dynamodb.QueryOutput*ecdsa.ecdsaSignature*elliptic.CurveParams*event.CommandMonitor*field_mask.FieldMask*flate.huffmanDecoder*flate.huffmanEncoder*func() (bool, error)*func() (int32, bool)*func() (int64, bool)*func() (string, int)*func() *list.Element*func() *mongo.Client*func() *pubsub.Topic*func() *tar.headerV7*func() []openpgp.Key*func() []trace.event*func() bson.RawValue*func() bsontype.Type*func() digest.Digest*func() iface.Backend*func() ini.TokenType*func() io.ReadCloser*func() io.ReadSeeker*func() io.ReadWriter*func() plumbing.Hash*func() readpref.Mode*func() reflect.Value*func() runtime.Frame*func() ssh.PublicKey*func() stats.Measure*func() time.Duration*func() toml.Position*func() xml.Directive*func(*big.Float) int*func(*client.Client)*func(*cobra.Command)*func(*config.Config)*func(*grpc.callInfo)*func(*http.Response)*func(*io.PipeWriter)*func(*os.file) error*func(*pflag.FlagSet)*func(*view.Row) bool*func(...*aws.Config)*func([]string) error*func([]tag.Tag) bool*func([]uint8) string*func([]uint8) uint16*func([]uint8) uint32*func([]uint8) uint64*func(bson.Raw) error*func(bsonx.Arr) bool*func(bsonx.Val) bool*func(fsnotify.Event)*func(int, ...string)*func(int, int) error*func(int64) *big.Int*func(int64) *big.Rat*func(int64, []uint8)*func(log.LazyLogger)*func(macaron.Params)*func(noder.Path) int*func(resolver.State)*func(string) float64*func(string, ...int)*func(string, string)*func(string, uint32)*func(string, uint64)*func(time.Time) bool*func(token.Pos) bool*func(uint32) []uint8*func(uint64, uint64)*func(unsafe.Pointer)*func(xml.Attr) error*git.CreateTagOptions*git.SubmodulesStatus*grpc.jsonRetryPolicy*hex.InvalidByteError*http.badRequestError*http.cancelTimerBody*http.http2ClientConn*http.http2dataBuffer*http.http2frameCache*http.http2gzipReader*http.http2pipeBuffer*http.http2serverConn*http.http2writeQueue*http.redirectHandler*http.socksAuthMethod*http2.RSTStreamFrame*httputil.neverEnding*internal.CommandInfo*internal.IDGenerator*ioutil.readerOnError*ioutil.writerOnError*jmespath.SyntaxError*jmespath.astNodeType*jmespath.byExprFloat*json.condAddrEncoder*jsonmessage.termInfo*knownhosts.hostKeyDB*knownhosts.keyDBLine*logrus.TextFormatter*map.bucket[uint8]int*map.hdr[int64]string*map.hdr[string][]int*map.hdr[uint8]uint32*map.iter[string]bool*map.iter[uint64]bool*map[int32]bidi.Class*map[reflect.Type]int*map[string]*http.Dir*map[string]struct {}*map[string]time.Time*map[tls.alert]string*mapstructure.Decoder*measurable.HookEvent*merkletrie.remaining*mongo.BulkWriteError*mongo.DeleteOneModel*mongo.InsertOneModel*mongo.SessionContext*mongo.UpdateOneModel*mongo.WriteException*mongo.sessionContext*multipart.FileHeader*multipart.partReader*net.byPriorityWeight*net.policyTableEntry*object.textFilePatch*object.treeEntryIter*opentracing.noopSpan*options.ArrayFilters*options.CountOptions*options.FullDocument*options.IndexOptions*packet.SignatureType*packet.UserAttribute*packet.ocfbDecrypter*packp.DepthReference*packp.ServerResponse*packp.advRefsDecoder*packp.advRefsEncoder*packp.decoderStateFn*packp.encoderStateFn*parse.IdentifierNode*pflag.NormalizedName*pflag.boolSliceValue*pflag.uintSliceValue*pkix.CertificateList*plumbing.DeltaObject*primitive.Decimal128*primitive.JavaScript*proto.ExtensionRange*proto.defaultMessage*proto.mergeFieldInfo*proto.newUnmarshaler*pubsub.PublishResult*pubsub.PubsubMessage*pubsub.TopicIterator*rand.hideAgainReader*reflect.stringHeader*reflect.uncommonType*request.NamedHandler*request.WaiterOption*request.offsetReader*resolver.AddressType*resolver.BuildOption*result.CreateIndexes*result.FindAndModify*result.ListDatabases*runtime.ancestorInfo*runtime.forcegcstate*runtime.gcDrainFlags*runtime.gsignalStack*runtime.pcvalueCache*runtime.stringStruct*runtime.timersBucket*runtime.uncommontype*scanner.ErrorHandler*sdkrand.lockedSource*session.ClusterClock*setting.BrokerConfig*sqs.CreateQueueInput*sqs.DeleteQueueInput*sqs.GetQueueUrlInput*sqs.ListQueuesOutput*sqs.PurgeQueueOutput*sqs.SendMessageInput*sqs.UntagQueueOutput*ssh.ExitMissingError*ssh.OpenChannelError*ssh.channelDirection*ssh.curve25519sha256*ssh.ed25519PublicKey*ssh.globalRequestMsg*ssh.publickeyAuthMsg*ssh.serviceAcceptMsg*ssh_config.sshParser*ssh_config.tokenType*stats.Float64Measure*storer.ReferenceIter*strconv.decimalSlice*stringprep.RuneRange*strings.byteReplacer*strings.stringFinder*strings.stringWriter*struct { io.Writer }*swarm.CredentialSpec*swarm.LocalNodeState*swarm.ResolutionMode*swarm.SELinuxContext*syscall.SockaddrUnix*syscall.SysProcIDMap*template.contentType*textproto.MIMEHeader*tls.constantTimeHash*tls.handshakeMessage*token.serializedFile*toml.valueComplexity*topology.MonitorMode*transport.AuthMethod*transport.TargetInfo*transport.recvBuffer*transport.writeQuota*url.InvalidHostError*view.AggregationData*viper.RemoteProvider*viper.RemoteResponse*x509.pkcs1PrivateKey*yaml.yaml_document_t*yaml.yaml_encoding_tAddClientCertFromFileAttachContainerReportBasicConstraintsValidBatchWriteItemRequestCRLDistributionPointsChanges qs:"changes"CheckAbortTransactionCheckStartTransactionCopyDocumentFromBytesCounttype:"integer"CreateRemoteAnonymousCreateSharedImageNameDecimal128DecodeValueDecimal128EncodeValueDefaultReadPreferenceDeleteItemWithContextDescribeBackupRequestDescribeLimitsRequestDiffCleanupEfficiencyDigest json:"digest"DisableFlagsInUseLineDisallowUnknownFieldsDownloadFromContainerDroppedAttributeCountEmbeds json:"embeds"ExpectContinueTimeoutFindAllStringSubmatchFirstBoundaryInStringGenBashCompletionFileGetAckDeadlineSecondsGetAdditionalBindingsGetJavaOuterClassnameGetMainLegacyDocumentGetPhpGenericServicesHandleUploadLargeFileHostKey sshtype:"31"HostKeyCallbackHelperIDjson:"EndpointID"InitialConnWindowSizeInsecureRegistryCIDRsIsCAasn1:"optional"IssuingCertificateURLJSONNumberDecodeValueJSONNumberEncodeValueJavaScriptDecodeValueJavaScriptEncodeValueKeyBlob sshtype:"13"KeyBlob sshtype:"18"Labels json:"Labels"LanguagesClientServerLanguagesServerClientListQueuesWithContextListTablesWithContextMemory json:"Memory"Memswap qs:"memswap"Message qs:"comment"Message sshtype:"53"Methods sshtype:"51"MustGetParsedDurationNewReceivePackSessionNewWriteCloserWrapperNoCache qs:"nocache"NoPrune qs:"noprune"NumKeys sshtype:"12"OSjson:",omitempty"PeersID sshtype:"91"PeersID sshtype:"92"PeersID sshtype:"93"PeersID sshtype:"94"PeersID sshtype:"96"PeersID sshtype:"97"PeersID sshtype:"98"PeersID sshtype:"99"PurgeQueueWithContextPuttype:"structure"Qinvasn1:"optional"QueryPagesWithContext RawJSONStreamqs:"-"ReadPreferenceTagSetsReceiveMessageRequestRegion json:"region" RemoveVolumesqs:"v" Repository qs:"repo"RequestImmediateCheckResolveUnknownServiceResponseHeaderTimeout Responses type:"map"SessionTimeoutMinutesSetAttributeValueListSetAutoScalingRoleArnSetBillingModeSummarySetClientRequestTokenSetComparisonOperatorSetDefaultReadConcernSetExpireAfterSecondsSetSourceTableDetailsSetTypeByDefaultValueSetWriteCapacityUnitsSigBlob sshtype:"14"Status json:"status"SubscriptionInProjectSumOfSquaredDeviationTimeout qs:"timeout"TransactionInProgressTypesshtype:"17|25"UnmarshalWithRegistryUntagQueueWithContextUpdateItemWithContextUseSessionWithOptionsVerifyPeerCertificateVerifyUserIdSignatureWTimeoutSetFromOptionWebHookDeletePipelineWebHookPipelineUpdateWithEndpointDiscoveryabortRequestBodyWriteaddChannelzTraceEventaddIndexFromTreeEntryaddOrUpdateReferencesaddReferencesToUpdateaddRefsFromPackedRefsassignEncodingAndSizeawaitGracefulShutdowncachedClientHelloInfoclientFinishedIsFirstcloseWithErrorAndCodecomputeOneofFieldInfodecodeDeepenReferencedecodeTimeAndTimeZonediffCommitWithStagingdiffLinesToRunesMungedisallowUnknownFieldsdiscardObjectIfNeededenableEventMonitoringencodeTimeAndTimeZoneexcludeIgnoredChangesexpectContinueTimeoutflattenWithReflectiongcMarkWorkerStartTimegetTreeFromCommitHashwriteRecordLocked$handshakeComplete$writeRecordLocked$handshakeComplete$incomingGoAwayHandlerincrementSectionCountipv4MappedIPv6EnabledlastStreamCreatedTimelegacyCommandDocumentmaxHeaderResponseSizemaxReceiveMessageSizemaxRetryRPCBufferSizemaxSendHeaderListSizememSupportedPageSizesmemTotalPhysicalBytesneedToSendSettingsAcknetDeviceCapabilitiesopenAndLockPackedRefspathNodeCPUCacheIndexpeerMaxHeaderListSizeprocessTrailerHeadersprojectWithReflectionputFrameScratchBufferreadCipherPacketLeakyregisterStreamHandlerresponseHeaderTimeoutsendExpectationFailedserverHeaderBinloggedsetMethodMethodLoggershouldRedirectRLockedshouldReuseConnectionsingle_quoted_allowedskipContinuationBytesspecialfinalizerallocstartGracefulShutdownstream_start_producedstreamsQuotaAvailablestringWidthZeroJoinerparseTemplateName@PparseTemplateName@PtokenPrepareForDecodeunreadByteStuffedByteupdateConnectionErrorvalidateRequiredFlagswriteFrameFromHandler**http.http2ClientConn**http.http2serverConn**http.http2writeQueue**multipart.FileHeader**object.treeEntryIter**pubsub.PubsubMessage*<-chan ssh.NewChannel*[0]*config.Subsection*[0]*ghw.NICCapability*[0]description.Server*[0]mapstructure.field*[1915]idna.valueRange*[19]runtime.mSpanList*[1]*clog.discordEmbed*[256]runtime.guintptr*[2]connectivity.State*[2]endpoints.endpoint*[2]runtime.gcSweepBuf*[2]stringprep.Mapping*[3]runewidth.interval*[61]hpack.HeaderField*[61]strconv.leftCheat*[65528]runtime.gcBits*[8]*dynamodb.Capacity*[8]*proto.discardInfo*[8]*proto.marshalInfo*[8]*singleflight.call*[8]*ssh_config.Config*[8]*template.Template*[8]*trace.eventFamily*[8]*view.viewInternal*[8][]*xmlutil.XMLNode*[8]connectivity.State*[8]dnsmessage.section*[8]docker.PortMapping*[8]endpoints.Endpoint*[8]endpoints.endpoint*[9]*trace.traceBucket*[]*command.WriteBatch*[]*dynamodb.Condition*[]*grpc.scStateUpdate*[]*http.http2dialCall*[]*parse.TemplateNode*[]*parse.VariableNode*[]*plumbing.Reference*[]*reflect.structType*[]*result.AsyncResult*[]*runtime.moduledata*[]*ssh_config.Pattern*[]*timeseries.tsLevel*[]*unicode.RangeTable*[][32]*runtime._defer*[][]*http.persistConn*[][]*x509.Certificate*[]agenttasks.Pipeline*[]amqp.Authentication*[]chan *amqp.Delivery*[]chan ssh.NewChannel*[]diffmatchpatch.Diff*[]dnsmessage.Question*[]dnsmessage.Resource*[]docker.ImageHistory*[]docker.KeyValuePair*[]docker.NetworkStats*[]docker.PluginDetail*[]docker.registryAuth*[]encoding.Compressor*[]endpoints.partition*[]ghw.MemoryCacheType*[]hpack.pairNameValue*[]http.http2FrameType*[]http.http2SettingID*[]jmespath.sliceParam*[]knownhosts.KnownKey*[]macaron.HTMLOptions*[]measurable.HookFunc*[]metricdata.LabelKey*[]net.hostLookupOrder*[]opentracing.LogData*[]plumbing.ObjectType*[]properties.itemType*[]reflect.structField*[]revision.Revisioner*[]runtime.inlinedCall*[]tls.SignatureScheme*[]transport.Transport*[]wiremessage.Section*[]writeconcern.Option*[]yaml.resolveMapItem*agent.failureAgentMsg*agent.successAgentMsg*amqp.connectionOpenOk*amqp.connectionSecure*amqp.connectionTuneOk*amqp.exchangeDeleteOk*amqp.exchangeUnbindOk*asn1.ObjectIdentifier*asn1.bitStringEncoder*auth.SaslClientCloser*auth.scramSaslAdapter*awserr.RequestFailure*balancer.BuildOptions*balancer.SubConnState*blowfish.KeySizeError*bsoncodec.CodecZeroer*bsoncodec.StructCodec*bsoncodec.Unmarshaler*bsonrw.DocumentReader*bsonrw.DocumentWriter*bsonrw.jsonParseState*bsonrw.sortableString*bsonx.PrimitiveCodecs*bzip2.StructuralError*capability.Capability*chan ssh.packetCipher*chan ssh_config.token*channelz.ChannelTrace*channelz.ServerMetric*channelz.SocketMetric*channelz.channelTrace*channelz.dummyChannel*channelz.listenSocket*channelz.normalSocket*client.DefaultRetryer*command.CreateIndexes*command.ListDatabases*command.ResponseError*compressor.Compressor*config.DynamoDBConfig*connection.Connection*connection.Handshaker*connection.connection*connstring.ConnString*crr.WeightedAddresses*dnsmessage.MXResource*dnsmessage.NSResource*docker.APIImageSearch*docker.EndpointConfig*docker.PluginSettings*driver.BulkWriteError*driver.DeleteOneModel*driver.InsertOneModel*driver.UpdateOneModel*driver.bulkWriteBatch*dynamodb.GetItemInput*dynamodb.ItemResponse*dynamodb.PutItemInput*dynamodb.WriteRequest*endpoints.regionRegex*errors.SignatureError*func() (int32, error)*func() (int64, error)*func() (int64, int64)*func() (string, bool)*func() (uint8, error)*func() *cobra.Command*func() *config.Config*func() *io.PipeWriter*func() *pflag.FlagSet*func() *reflect.rtype*func() *regexp.Regexp*func() *status.Status*func() *syntax.Regexp*func() *tar.headerGNU*func() *time.Location*func() []*http.Cookie*func() []*iam.Binding*func() []iam.RoleName*func() []interface {}*func() []logrus.Level*func() bsoncore.Value*func() diff.Operation*func() parse.NodeType*func() syntax.EmptyOp*func() syscall.Signal*func() xml.EndElement*func(*[32]uint8) bool*func(*ast.ObjectItem)*func(*logging.Record)*func(*session.Server)*func(*time.Time) bool*func(*trace.SpanData)*func(...interface {})*func(...string) error*func([]uint8) []uint8*func([]uint8, uint16)*func([]uint8, uint32)*func([]uint8, uint64)*func(anagent.Handler)*func(anagent.TimerID)*func(bool) *big.Float*func(bool, ...string)*func(bsonx.Elem) bool*func(bsonx.IDoc) bool*func(bufio.SplitFunc)*func(complex128) bool*func(context.Context)*func(expvar.KeyValue)*func(inject.Injector)*func(int) *aws.Config*func(int) image.Point*func(int32, int) bool*func(io.Reader) error*func(io.Writer) error*func(logging.Handler)*func(macaron.Handler)*func(net.IPAddr) bool*func(os.Signal) error*func(string) []string*func(string, []uint8)*func(string, float32)*func(string, float64)*func(string, int) int*func(time.Time) error*func(uint) *big.Float*func(uint64) *big.Int*func(viper.FlagValue)*func(xml.Token) error*ghw.StorageController*gitignore.MatchResult*grpc.pickfirstBuilder*http.connectMethodKey*http.http2FrameHeader*http.http2GoAwayError*http.http2GoAwayFrame*http.http2StreamError*http.http2addConnCall*http.http2bodyReadMsg*http.http2chunkWriter*http.http2clientTrace*http.http2closeWaiter*http.http2frameParser*http.http2pushOptions*http.http2requestBody*http.http2resAndError*http.http2streamState*http.http2writeFramer*http.http2writeGoAway*http.requestTooLarger*http.responseAndError*http.transportRequest*http2.ConnectionError*httpproxy.domainMatch*httptrace.ClientTrace*httptrace.DNSDoneInfo*httptrace.GotConnInfo*index.EndOfIndexEntry*ioutil.writeNopCloser*jmespath.byExprString*jpeg.UnsupportedError*jsonmessage.JSONError*knownhosts.hashedHost*logging.WriterHandler*macaron.BeforeHandler*macaron.LoggerInvoker*macaron.ReturnHandler*map.bucket[int32]bool*map.bucket[int]string*map.bucket[string]int*map.hdr[string]string*map.iter[int64]string*map.iter[string][]int*map.iter[uint8]uint32*map[*trace.trace]bool*map[clog.LEVEL]string*map[ini.TokenType]int*map[int]toml.sortNode*map[reflect.Type]bool*map[string]*flag.Flag*map[string]*yaml.node*map[string]billy.File*map[string]codes.Code*map[tar.Format]string*map[uint8]*pflag.Flag*mapstructure.Metadata*measurable.Measurable*merkletrie.comparison*merkletrie.doubleIter*metricdata.Descriptor*metricdata.LabelValue*metricdata.TimeSeries*mongo.BulkWriteResult*mongo.DeleteManyModel*mongo.InsertOneResult*mongo.ReplaceOneModel*mongo.UpdateManyModel*oauth2.AuthCodeOption*object.commitFileIter*opentracing.LogRecord*options.DeleteOptions*options.RunCmdOptions*options.UpdateOptions*packet.CipherFunction*packfile.ObjectHeader*packfile.ObjectToPack*packfile.offsetWriter*plumbing.MemoryObject*polyfill.capabilities*pools.BufioReaderPool*pools.BufioWriterPool*properties.Properties*proto.OneofProperties*proto.extendableProto*proto.extensionsBytes*proto.generatedMerger*proto.marshalElemInfo*proto.messageTypeIder*proto.oneofFuncsIface*pubsub.PublishRequest*pubsub.SnapshotConfig*pubsub.StringIterator*pubsub.bundledMessage*pubsub.defaultRetryer*pubsub.flowController*reflect.interfaceType*rsa.PrecomputedValues*runtime.gcTriggerKind*runtime.interfacetype*runtime.itabTableType*runtime.stackExpander*runtime.stackfreelist*runtime.traceStackPtr*runtime.vdsoSymbolKey*schema.RouteGenerator*session.ClientOptions*setting.GeneralConfig*setting.StorageConfig*sha2crypt.sha2Crypter*sqs.CreateQueueOutput*sqs.DeleteQueueOutput*sqs.GetQueueUrlOutput*sqs.SendMessageOutput*ssh.channelForwardMsg*ssh.channelRequestMsg*ssh.curve25519KeyPair*ssh.optionsTupleValue*ssh.publicKeyCallback*ssh.serviceRequestMsg*ssh.userAuthBannerMsg*stats.outgoingTagsKey*storer.PackfileWriter*swarm.ConfigReference*swarm.ContainerStatus*swarm.GenericResource*swarm.NodeDescription*swarm.SecretReference*syscall.SockaddrInet4*syscall.SockaddrInet6*timeseries.Observable*timeseries.timeSeries*tls.RecordHeaderError*tls.ecdheKeyAgreement*topology.ServerOption*topology.Subscription*topology.serverConfig*tracestate.Tracestate*transport.decodeState*transport.headerFrame*transport.http2Client*transport.loopyWriter*transport.streamState*view.DistributionData*wiremessage.ErrorType*wiremessage.QueryFlag*wiremessage.ReplyFlag*x509.SystemRootsError*x509.basicConstraints*yaml.yaml_node_item_t*yaml.yaml_node_pair_t*yaml.yaml_node_type_tAddMessageReceiveEvent Attributes type:"map"BashCompletionFunctionBuildNameToCertificateChanType sshtype:"90"CheckCommitTransactionCreateQueueWithContextCreateTableWithContextDefaultCompressionAlgoDeleteQueueWithContextDeleteTableWithContext DeletedCountbson:"n"Dirjson:",omitempty"DisableFollowRedirectsDisableLevelTruncationDisableParamValidationDroppedAnnotationCountEnvjson:",omitempty"Errjson:",omitempty"EstimatedDocumentCountExchangeDeclarePassiveExcludedEmailAddressesExiststype:"boolean"FailOnNonTempDialErrorGetJavaGenericServicesGetJavaStringCheckUtf8GetQueueUrlWithContextGetRegisteredTaskNamesGetRetainAckedMessagesGetServiceAccountEmailGetUninterpretedOptionHasAvailableLocalFlags HasDualStackjson:"-"HostIDjson:"host_id"InitDefaultVersionFlag ItemCount type:"long"ListBackupsWithContextListTopicSubscriptionsLocalFlowControlWindowMarshalAppendBSONValue MatchedCountbson:"n"MaxOutstandingMessagesMaxRequestMessageBytesMaxResponseHeaderBytesMessage type:"string"OnInflatedObjectHeader OutputStreamjson:"-"PasswordHashIterationsPeersID sshtype:"100"ReadContinuedLineBytesRegisterDefaultDecoderRegisterDefaultEncoderResolveArtefactsMountsRestoreTableFromBackupRootRotationInProgress ScanFilter type:"map"SendMessageWithContextServerSelectionTimeoutSessionTicketsDisabledSetAllowPartialResultsSetAutoScalingDisabledSetConditionExpressionSetConditionalOperatorSetDefaultCookieSecretSetDefaultWriteConcernSetMaxDynamicTableSizeSetMaxNumberOfMessagesSetRegisteredTaskNamesSetScalingPolicyUpdateSetSizeEstimateRangeGBSetStreamSpecificationSetTimeRangeLowerBoundSetTimeRangeUpperBoundSkipServerVersionCheckSuppressOutputqs:"q"TTYjson:",omitempty"TableId type:"string"TagResourceWithContextUnmarshalerDecodeValueUpdateTableWithContextVisitDistributionValueWriteBinaryWithSubtypeaddCountsAndClearFlagsaddOrUpdateFileToIndexcertificateAuthoritiescheckForHeaderListSizeclientProtocolFallbackclosedRequestBodyEarlycopyToCappedAttributesdisableEventMonitoringdiscardHandshakeBufferexecutionTracerTaskEndinitializeNativeClientinvalidTransitionErrorisGrpcLogEntry_PayloadlexInsideTableArrayKeylookupInterfaceDecoderlookupInterfaceEncodermaxPayloadSizeForWritemaxSpansPerErrorBucketonInflatedObjectHeaderparseElGamalPrivateKeyprocessCertsFromClientprocessFrameFromReaderreadContinuedLineSlicereadLoopPeekFailLockedserverSelectionTimeoutsetDefaultMethodLoggersetFingerPrintAndKeyIdsetServiceMethodLoggertestHookPrePendingDialunmarshalTextInterfaceupcomingHeaderNewlinesupdateRSWithoutPrimaryupdateTopologyCallback**channelz.normalSocket**packfile.ObjectToPack**properties.Properties*[0]diffmatchpatch.Diff*[0]dnsmessage.Question*[0]revision.Revisioner*[100000]unsafe.Pointer*[128]runtime.mSpanList*[12]runewidth.interval*[1]*ssh_config.Pattern*[1]amqp.Authentication*[1]diffmatchpatch.Diff*[1]docker.registryAuth*[1]macaron.HTMLOptions*[1]tls.SignatureScheme*[204]runtime.finalizer*[2]*plumbing.Reference*[2]diffmatchpatch.Diff*[2]docker.registryAuth*[2]properties.itemType*[2]writeconcern.Option*[304]unicode.CaseRange*[3]diffmatchpatch.Diff*[3]endpoints.partition*[3]jmespath.sliceParam*[3]properties.itemType*[5]*unicode.RangeTable*[5][32]*runtime._defer*[7]tls.SignatureScheme*[8]*dynamodb.Condition*[8]*http.http2dialCall*[8]*parse.TemplateNode*[8]*plumbing.Reference*[8]*reflect.structType*[8]*unicode.RangeTable*[8][]*http.persistConn*[8]chan *amqp.Delivery*[8]chan ssh.NewChannel*[8]docker.NetworkStats*[8]encoding.Compressor*[8]ghw.MemoryCacheType*[8]hpack.pairNameValue*[8]http.http2FrameType*[8]http.http2SettingID*[8]knownhosts.KnownKey*[8]measurable.HookFunc*[8]net.hostLookupOrder*[8]plumbing.ObjectType*[8]tls.SignatureScheme*[8]transport.Transport*[8]yaml.resolveMapItem*[]*channelz.TraceEvent*[]*channelz.subChannel*[]*config.RemoteConfig*[]*docker.ImageSummary*[]*knownhosts.KnownKey*[]*metricdata.Exemplar*[]*options.FindOptions*[]*packfile.deltaIndex*[]*packfile.objectInfo*[]*packp.CommandStatus*[]*proto.ExtensionDesc*[]*proto.unmarshalInfo*[]*pubsub.Subscription*[]*transport.outStream*[]*vagrantutil.Vagrant*[][]docker.PortBinding*[]bsonrw.jsonTokenType*[]clog.slackAttachment*[]diffmatchpatch.Patch*[]docker.APIContainers*[]http.socksAuthMethod*[]internal.CommandInfo*[]knownhosts.keyDBLine*[]mongo.BulkWriteError*[]net.policyTableEntry*[]pflag.NormalizedName*[]proto.ExtensionRange*[]proto.defaultMessage*[]proto.mergeFieldInfo*[]request.NamedHandler*[]request.WaiterOption*[]runtime.ancestorInfo*[]stringprep.RuneRange*[]syscall.SysProcIDMap*[]template.contentType*[]token.serializedFile*[]view.AggregationData*agenttasks.Instruction*agenttasks.TaskHandler*amqp.basicRecoverAsync*amqp.connectionBlocked*amqp.connectionCloseOk*amqp.connectionStartOk*amqp.exchangeDeclareOk*archive.WhiteoutFormat*aws.ReaderSeekerCloser*binarylog.ClientHeader*binarylog.MethodLogger*binarylog.ServerHeader*bsoncodec.ErrNoDecoder*bsoncodec.ErrNoEncoder*bsoncodec.PointerCodec*bsoncodec.ValueDecoder*bsoncodec.ValueEncoder*bsonrw.TransitionError*bsonx.ElementTypeError*chan *docker.APIEvents*chan *http.persistConn*chan amqp.Confirmation*chan http.writeRequest*chan transport.recvMsg*channelz.ChannelMetric*channelz.tracedChannel*cipher.gcmFieldElement*client.teeReaderCloser*command.CountDocuments*command.DropCollection*config.GCPPubSubConfig*connstring.ConnectMode*container.HealthConfig*description.ServerKind*descriptor.EnumOptions*descriptor.FileOptions*dnsmessage.PTRResource*dnsmessage.SOAResource*dnsmessage.SRVResource*dnsmessage.TXTResource*dnsmessage.nestedError*docker.BlkioStatsEntry*docker.NetworkSettings*docker.NoSuchContainer*docker.PluginInterface*docker.PluginPrivilege*docker.TagImageOptions*driver.DeleteManyModel*driver.ReplaceOneModel*driver.UpdateManyModel*dynamodb.BackupDetails*dynamodb.BackupSummary*dynamodb.DeleteRequest*dynamodb.GetItemOutput*dynamodb.PutItemOutput*dynamodb.ReplicaUpdate*encoding.TextMarshaler*errors.StructuralError*exec.prefixSuffixSaver*filesystem.deltaObject*filesystem.objectsIter*flate.compressionLevel*flate.huffmanBitWriter*func() (float32, bool)*func() (float64, bool)*func() (int, int, int)*func() (string, error)*func() (uint16, error)*func() (uint32, error)*func() (uint64, error)*func() *amqp.PlainAuth*func() *ast.ObjectList*func() *http.Transport*func() *mongo.Database*func() *parse.ListNode*func() *parse.PipeNode*func() *tar.headerSTAR*func() []*pubsub.Topic*func() []idtools.IDMap*func() []reflect.Value*func() address.Address*func() context.Context*func() digest.Digester*func() digest.Verifier*func() dnsmessage.Type*func() flowrate.Status*func() image.Rectangle*func() measurable.Type*func() mongo.IndexView*func() reflect.ChanDir*func() stack.CallStack*func() tar.sparseArray*func(*anagent.Anagent)*func(*bool, bool) bool*func(*macaron.Context)*func(*net.netFD) error*func(*request.Request)*func(*tasks.Signature)*func(*token.File) bool*func(*xmlutil.XMLNode)*func(...[]uint8) error*func(...string) string*func([][]string) error*func([]uint8) *big.Int*func([]uint8, []uint8)*func(amqp.frame) error*func(balancer.SubConn)*func(bool) *aws.Config*func(bool, bool) error*func(diff.Patch) error*func(float64) *big.Rat*func(fmt.State, int32)*func(func(*flag.Flag))*func(http2.Flags) bool*func(image.Point) bool*func(int) (int, error)*func(int) (int32, int)*func(int) reflect.Type*func(int, string, int)*func(int64) *big.Float*func(interface {}) int*func(logrus.Formatter)*func(noder.Path) error*func(opentracing.Span)*func(redis.Conn) error*func(ssh.Signal) error*func(strconv.extFloat)*func(string) *http.Dir*func(string) bsonx.Doc*func(string) time.Time*func(string, []string)*func(string, bool) int*func(utils.Comparator)*grpc.acBalancerWrapper*grpc.ccBalancerWrapper*grpc.ccResolverWrapper*grpc.healthCheckConfig*grpc.pickfirstBalancer*grpc.rpcInfoContextKey*hpack.headerFieldTable*http.connCloseListener*http.http2HeadersFrame*http.http2RoundTripOpt*http.http2UnknownFrame*http.http2clientStream*http.http2priorityNode*http.http2requestParam*http.http2writeContext*http.http2writePingAck*http.onceCloseListener*http.persistConnWriter*http2.MetaHeadersFrame*http2.PushPromiseFrame*http2.PushPromiseParam*httptrace.DNSStartInfo*index.ResolveUndoEntry*internal.HealthChecker*internal.chunkedReader*internal.chunkedWriter*jmespath.functionEntry*json.reflectWithString*jsonmessage.noTermInfo*knownhosts.hostPattern*macaron.ContextInvoker*macaron.ResponseWriter*macaron.responseWriter*map.bucket[int32]int32*map.bucket[string]bool*map.bucket[uint64]bool*map.hdr[string]*string*map.iter[string]string*map[*gob.typeInfo]bool*map[*http.Request]uint*map[ghw.BusType]string*map[http2.Flags]string*map[int64]interface {}*map[plumbing.Hash]bool*map[reflect.visit]bool*map[string]*git.Remote*map[string]*index.node*map[string]*parse.Tree*map[string]crypto.Hash*metadata.mdOutgoingKey*metricdata.Attachments*metricproducer.Manager*mongo.InsertManyResult*opentracing.NoopTracer*opentracing.contextKey*options.FindOneOptions*options.ReplaceOptions*options.ReturnDocument*options.SessionOptions*packet.CompressionAlgo*packet.OpaqueSubpacket*packet.kdfHashFunction*packet.outputSubpacket*packfile.byTypeAndSize*packfile.deltaSelector*pflag.bytesBase64Value*pflag.flagValueWrapper*pflag.stringArrayValue*pflag.stringSliceValue*pflag.stringToIntValue*plumbing.EncodedObject*plumbing.ReferenceName*plumbing.ReferenceType*proto.StructProperties*proto._MessageSet_Item*proto.discardFieldInfo*proto.extensionAdapter*proto.invalidUTF8Error*proto.marshalFieldInfo*pubsub.GetTopicRequest*pubsub.PublishResponse*pubsub.PublishSettings*pubsub.PublisherClient*pubsub.ReceiveSettings*pubsub.ReceivedMessage*pubsub.messageIterator*quotedprintable.Reader*reflect.funcTypeFixed4*reflect.funcTypeFixed8*request.ErrParamMinLen*request.WaiterAcceptor*request.temporaryError*runtime.cgothreadstart*runtime.memRecordCycle*runtime.traceBufHeader*runtime.vdsoVersionKey*scram.CredentialLookup*scram.HashGeneratorFcn*setting.DatabaseConfig*sqs.AddPermissionInput*sqs.DeleteMessageInput*sqs.ListQueueTagsInput*ssh.PublicKeysCallback*ssh.handshakeTransport*ssh.ptyWindowChangeMsg*ssh.streamPacketCipher*ssh.userAuthFailureMsg*ssh.userAuthRequestMsg*ssh.userAuthSuccessMsg*stats.outgoingTraceKey*storer.ReferenceStorer*struct { Port uint32 }*struct { Window uint }*swarm.DispatcherConfig*swarm.EncryptionConfig*swarm.NodeAvailability*sync.poolLocalInternal*syscall.NetlinkMessage*syscall.RawSockaddrAny*tasks.signatureCtxType*tls.ClientSessionCache*tls.ClientSessionState*tls.serverHelloDoneMsg*toml.tomlParserStateFn*trace.MessageEventType*trace.SamplingDecision*tracing.consumerOption*tracing.producerOption*transport.GoAwayReason*transport.bdpEstimator*transport.channelzData*viper.ConfigParseError*wiremessage.Compressed*wiremessage.ReadWriter*x509.distributionPoint*x509.policyInformation*yaml.yaml_alias_data_t*yaml.yaml_error_type_t*yaml.yaml_event_type_t*yaml.yaml_simple_key_t*yaml.yaml_token_type_tAddSecureRemoteProviderAddrjson:",omitempty"Argsjson:",omitempty"Attrjson:",omitempty"AuthMechanismPropertiesBatchGetItemWithContextCPUQuota qs:"cpuquota"ChangeMessageVisibilityCompressionClientServerCompressionServerClientConfigsjson:"configs" Constraints ssh:"rest"CoreDocumentDecodeValueCoreDocumentEncodeValueCreateBackupWithContextCreatedjson:"Created"Createdjson:"created"Datajson:",omitempty"DeleteBackupWithContextDisableComputeChecksumsElementSliceDecodeValueElementSliceEncodeValueEnableEndpointDiscoveryEnabledtype:"boolean"EnforceShouldRetryCheckFilejson:",omitempty"FindReaderSubmatchIndexFindStringSubmatchIndexGetAuthenticationMethodGetMessageSetWireFormatGetMessageStoragePolicyGetModifyDeadlineAckIdsGetPhpMetadataNamespaceGetSequenceIdWithinCallGetStringMapStringSliceGlobalNormalizationFuncHasAvailableSubCommandsIDjson:"ID" form:"ID"IDjson:"id" form:"id"IDjson:"id,omitempty"IndexArn type:"string"Initjson:",omitempty"Kindjson:",omitempty"ListGlobalTablesRequestLocalNonPersistentFlagsMakeOrganizationVisibleMarkShorthandDeprecatedMaxMessageEventsPerSpanMaxResponseMessageBytesMebson:"me,omitempty"Messagejson:"message"Modejson:",omitempty"Namejson:",omitempty"OnInflatedObjectContentPartialFilterExpressionPayloadbson:"payload"PermittedEmailAddresses QueryFilter type:"map"QueueUrl type:"string"Raftjson:",omitempty"RawSubjectPublicKeyInfoReadASN1GeneralizedTimeReadOptionalASN1BooleanReadOptionalASN1IntegerReadUint8LengthPrefixedRegionsjson:"regions"RegisterDefaultDecodersRegisterDefaultEncodersRegisterPrimitiveCodecsRemoteFlowControlWindowRemovePermissionRequestRemoveVolumeWithOptionsReplaceAllLiteralStringResultsbson:"results"RmTmpContainerqs:"rm"Rolejson:",omitempty"Segmenttype:"integer"SendMessageBatchRequestServicejson:"service"SetAttributeDefinitionsSetBackupExpiryDateTimeSetCachePeriodInMinutesSetLastDecreaseDateTimeSetLastIncreaseDateTimeSetProjectionExpressionSetReflowDuringAutoWrapSetStartAtOperationTimeSlotjson:",omitempty"Specjson:",omitempty"Tabletype:"structure"TableArn type:"string" TableNames type:"list"Testjson:",omitempty"Textjson:",omitempty"TransactGetItemsRequestTypejson:",omitempty"UpdateContinuousBackupsUpdateTimeToLiveRequestUserjson:",omitempty"Valuetype:"structure"VerifyUserIdSignatureV3WaitUntilTableNotExistsWebmapstructure:"web" XXX_sizecachejson:"-"arraysOneElementPerLineawaitOpenSlotForRequestcanTakeNewRequestLockedcheckoutChangeSubmodulecomputeMarshalFieldInfoconnectMethodForRequestconsumeQuotedIdentifierconsumeRawStringLiteralcontainsUnstagedChangesdiffStagingWithWorktreeescapeListConditionallyhandleRenegotiation$handleRenegotiation$handleAdvRefDecodeErrorincomingSettingsHandlerisBoundaryDelimiterLineisChannelzSecurityValueisPathShadowedInAutoEnvisPathShadowedInDeepMapisPathShadowedInFlatMaplocalNonPersistentFlagslookupAndEscapeTemplatememoryCacheSharedCPUMapnoteBodyReadFromHandlernumRetriesSincePushbackonInflatedObjectContentoutgoingSettingsHandlerparseContentDispositionreadObjectTypeAndLengthresponseMessageReceivedserializeWithoutHeadersshouldSendContentLengthtestHookPostPendingDialupdateConnectivityStatewrite100ContinueHeaderscrypto/internal/randutil**dynamodb.ReplicaUpdate**grpc.acBalancerWrapper**http.http2clientStream**packet.OpaqueSubpacket**proto._MessageSet_Item**proto.marshalFieldInfo**pubsub.PublishResponse*[0]diffmatchpatch.Patch*[106]runewidth.interval*[128]runtime.epollevent*[142]runewidth.interval*[16384]flate.tableEntry*[179999]*runtime.bucket*[179]runewidth.interval*[1]*options.FindOptions*[1]clog.slackAttachment*[1]diffmatchpatch.Patch*[1]proto.ExtensionRange*[1]request.NamedHandler*[1]stringprep.RuneRange*[250]runewidth.interval*[2]http.socksAuthMethod*[2]stringprep.RuneRange*[3]stringprep.RuneRange*[5]stringprep.RuneRange*[637]runewidth.interval*[8]*channelz.subChannel*[8]*config.RemoteConfig*[8]*knownhosts.KnownKey*[8]*packfile.deltaIndex*[8]*packfile.objectInfo*[8]*proto.ExtensionDesc*[8]*proto.unmarshalInfo*[8]*transport.outStream*[8][]docker.PortBinding*[8]bsonrw.jsonTokenType*[8]internal.CommandInfo*[8]pflag.NormalizedName*[8]proto.defaultMessage*[8]template.contentType*[8]view.AggregationData*[9]net.policyTableEntry*[]*annotations.HttpRule*[]*annotations.Resource*[]*docker.APIContainers*[]*dynamodb.GlobalTable*[]*http.http2ClientConn*[]*http.http2serverConn*[]*http.http2writeQueue*[]*multipart.FileHeader*[]*object.treeEntryIter*[]*options.CountOptions*[]*pubsub.PubsubMessage*[][][]*x509.Certificate*[]asn1.ObjectIdentifier*[]bsonrw.jsonParseState*[]capability.Capability*[]compressor.Compressor*[]docker.APIImageSearch*[]driver.BulkWriteError*[]driver.bulkWriteBatch*[]ghw.StorageController*[]http.connectMethodKey*[]http.http2frameParser*[]macaron.BeforeHandler*[]map[ini.TokenType]int*[]measurable.Measurable*[]metricdata.LabelValue*[]opentracing.LogRecord*[]runtime.stackfreelist*[]runtime.traceStackPtr*[]runtime.vdsoSymbolKey*[]swarm.GenericResource*[]timeseries.Observable*[]topology.ServerOption*[]yaml.yaml_node_item_t*[]yaml.yaml_node_pair_t*agent.extensionAgentMsg*agenttasks.StateRequest*agenttasks.TaskExecutor*amqp.connectionSecureOk*amqp.messageWithContent*auth.PlainAuthenticator*auth.ScramAuthenticator*bcrypt.InvalidCostError*bidirule.ruleTransition*binarylog.ClientMessage*binarylog.ServerMessage*binarylog.ServerTrailer*bsoncodec.DecodeContext*bsoncodec.EncodeContext*bsoncore.sortableString*buffruneio.runeWithSize*chan []resolver.Address*chan amqp.readDeadliner*chan description.Server*channelz.RefChannelType*channelz.TraceEventDesc*clog.FileRotationConfig*command.ListCollections*config.QueueBindingArgs*connection.NetworkError*credentials.Credentials*curve25519.fieldElement*descriptor.FieldOptions*descriptor.OneofOptions*diffmatchpatch.equality*dnsmessage.AAAAResource*dnsmessage.ResourceBody*docker.ContainerNetwork*docker.DiskUsageOptions*docker.InitSwarmOptions*docker.JoinSwarmOptions*docker.ListNodesOptions*docker.ListTasksOptions*docker.LoadImageOptions*docker.NetworkingConfig*docker.PullImageOptions*docker.PushImageOptions*docker.StartExecOptions*dynamodb.AttributeValue*dynamodb.ConditionCheck*dynamodb.RestoreSummary*dynamodb.SSEDescription*errcode.ErrorDescriptor*errors.UnsupportedError*filesystem.IndexStorage*filesystem.packfileIter*flate.CorruptInputError*func() ([]uint8, []int)*func() ([]uint8, error)*func() (bson.Raw, bool)*func() (float64, error)*func() (string, string)*func() (uint16, uint16)*func() (uint32, uint32)*func() (uint64, uint64)*func() (uint8, []uint8)*func() *base64.Encoding*func() *grpc.ClientConn*func() *object.FileIter*func() *pubsub.Snapshot*func() *request.Request*func() *tar.headerUSTAR*func() *tasks.TaskState*func() *topology.Server*func() <-chan struct {}*func() []*cobra.Command*func() []diff.FilePatch*func() []docker.APIPort*func() []trace.logEntry*func() aws.LogLevelType*func() big.RoundingMode*func() billy.Capability*func() billy.Filesystem*func() crypto.PublicKey*func() digest.Algorithm*func() idtools.Identity*func() object.FileStats*func() pkix.RDNSequence*func() request.Handlers*func() scanner.Position*func() xml.StartElement*func(*big.Int) *big.Int*func(*big.Int) *big.Rat*func(*big.Rat) *big.Rat*func(*color.Color) bool*func(*docker.Container)*func(*flate.compressor)*func(*gax.CallSettings)*func(*grpc.dialOptions)*func(*index.Tree) error*func(*machinery.Server)*func(*object.Tag) error*func(*os.Process) error*func(*pkix.RDNSequence)*func(*strings.Replacer)*func(*tar.Header) error*func(*trace.trace) bool*func(*transport.Stream)*func(*url.URL) *url.URL*func(*x509.Certificate)*func(...*cobra.Command)*func(...request.Option)*func([]tasks.Arg) error*func([]uint8) [][]uint8*func([]uint8) hash.Hash*func([]uint8, []uint32)*func([]uint8, bool) int*func(amqp.Confirmation)*func(balancer.DoneInfo)*func(bool) (int, error)*func(client.HttpClient)*func(func(*pflag.Flag))*func(hpack.HeaderField)*func(int) *scram.Client*func(int) http2.Setting*func(int) reflect.Value*func(int) time.Duration*func(int, interface {})*func(int, string) error*func(int32, int32) bool*func(interface {}) bool*func(logging.Formatter)*func(logrus.Level) bool*func(merkletrie.Change)*func(metadata.MD) error*func(net.IPMask) net.IP*func(norm.Form, string)*func(os.FileMode) error*func(proto.Message) int*func(reflect.Type) bool*func(string) *flag.Flag*func(string) *view.View*func(string, ...string)*func(string, bool) bool*func(string, uint) uint*func(token.Pos, string)*func(uint64) *big.Float*func(uint8, int) string*hpack.InvalidIndexError*http.http2PriorityFrame*http.http2PriorityParam*http.http2ServeConnOpts*http.http2SettingsFrame*http.http2goroutineLock*http.http2serverMessage*http.http2writeSettings*http.transferBodyReader*http2.ContinuationFrame*http2.HeadersFrameParam*http2.WindowUpdateFrame*http2.pseudoHeaderError*httputil.delegateReader*iam.BindingDelta_Action*iam.GetIamPolicyRequest*iam.SetIamPolicyRequest*idtools.IdentityMapping*idxfile.entriesByOffset*jmespath.functionCaller*json.UnmarshalTypeError*jsonmessage.JSONMessage*knownhosts.RevokedError*knownhosts.hostPatterns*logging.LoggerInterface*map.bucket[int32]string*map.bucket[int64]string*map.bucket[string][]int*map.bucket[string]error*map.bucket[string]int16*map.bucket[string]int32*map.bucket[string]int64*map.bucket[uint32]int32*map.bucket[uint8]string*map.bucket[uint8]uint32*map.hdr[int64]struct {}*map.hdr[string][]string*map.iter[string]*string*map[crypto.Hash][]uint8*map[int32]*trace.bucket*map[int64]*list.Element*map[int64]plumbing.Hash*map[interface {}]string*map[plumbing.Hash]int64*map[reflect.Type]string*map[string]*object.Tree*map[string]*ssh.macMode*map[string]interface {}*map[string]reflect.Type*map[string]schema.Route*map[uint8]gotty.stacker*map[view.AggType]string*memory.ReferenceStorage*metricdata.Distribution*metricdata.ValueVisitor*metricproducer.Producer*mongo.WriteConcernError*net.UnknownNetworkError*net.ipStackCapabilities*network.ConfigReference*object.storerCommitIter*opentracing.SpanContext*options.DatabaseOptions*options.DistinctOptions*packet.OCFBResyncOption*packet.OnePassSignature*packfile.bufferedSeeker*packfile.readerResetter*packp.ErrUnexpectedData*packp.UploadPackRequest*pkix.RevokedCertificate*pkix.TBSCertificateList*plumbing.PermanentError*primitive.CodeWithScope*proto.cachedProtoBuffer*proto.extendableProtoV1*pubsub.ExpirationPolicy*pubsub.SeekRequest_Time*pubsub.SnapshotIterator*pubsub.SubscriberClient*readconcern.ReadConcern*reflect.funcTypeFixed16*reflect.funcTypeFixed32*reflect.funcTypeFixed64*request.ErrInvalidParam*request.WaiterMatchMode*request.errInvalidParam*result.ChainAsyncResult*result.ChordAsyncResult*revision.ColonStagePath*runtime.PluginPrivilege*runtime.cgoTracebackArg*runtime.pcvalueCacheEnt*runtime.persistentAlloc*runtime.traceStackTable*scram.NonceGeneratorFcn*scram.StoredCredentials*simplelru.EvictCallback*sqs.AddPermissionOutput*sqs.DeleteMessageOutput*sqs.ListQueueTagsOutput*sqs.ReceiveMessageInput*ssh.directionAlgorithms*ssh.forwardedTCPPayload*ssh.subsystemRequestMsg*ssh.userAuthPubKeyOkMsg*ssh_config.UserSettings*ssh_config.configFinder*stats.measureDescriptor*strings.genericReplacer*swarm.EndpointVirtualIP*swarm.EngineDescription*swarm.NetworkAttachment*swarm.PluginDescription*swarm.ReplicatedService*syscall.RawSockaddrUnix*syscall.SockaddrNetlink*tasks.ErrRetryTaskLater*template.missingValType*textproto.ProtocolError*timeseries.defaultClock*tls.newSessionTicketMsg*token.serializedFileSet*topology.SelectedServer*transport.cleanupStream*transport.controlBuffer*transport.outStreamList*user.UnknownUserIdError*viper.RemoteConfigError*wiremessage.KillCursors*wiremessage.SectionBody*wiremessage.SectionType*wiremessage.WireMessage*x509.PublicKeyAlgorithm*x509.SignatureAlgorithmAddPermissionWithContextAddRecurringTimerSecondsArgsjson:"runtimeArgs" BinaryValue type:"blob"BypassDocumentValidationCodeWithScopeDecodeValueCodeWithScopeEncodeValueCreatetype:"structure"CreateGlobalTableRequestDelayjson:",omitempty"Deletetype:"structure"DeleteMessageWithContextDescribeEndpointsRequestDescribeTableWithContextDownloadArtefactsGenericDroppedMessageEventCountGetEnableMessageOrderingGetModifyDeadlineSecondsHandleSubConnStateChangeHostsjson:",omitempty"Imagejson:",omitempty"Indexjson:",omitempty"IsHTTP2NoCachedConnErrorLastCallStartedTimestampLastMessageSentTimestampListQueueTagsWithContext MD5OfBody type:"string"MaxUploadBufferPerStream MessageId type:"string"ModifyEndpointIfRedirectNetworkingConfigqs:"-" NextToken type:"string"Nodesjson:",omitempty"OnlyDeletePacksOlderThan Passphrase sshtype:"22" Passphrase sshtype:"23"Portsjson:",omitempty"PreferServerCipherSuitesProcessWriteConcernErrorRangejson:",omitempty"ReadASN1BitStringAsBytesReadASN1ObjectIdentifierReadUint16LengthPrefixedReadUint24LengthPrefixedRequireTransportSecurityScopejson:",omitempty"SerializeSignaturePrefixSetDefaultReadPreferenceSetItemCollectionMetricsSetLocalSecondaryIndexesSetMessageAttributeNamesSetProvisionedThroughputSetReplicaSettingsUpdateSetTableCreationDateTimeSetTimeToLiveDescriptionStatejson:",omitempty"StopContainerWithContextSupportedCriticalOptionsThrottleOutOfOrderWritesUntagResourceWithContextUpdatetype:"structure"UpdateGlobalTableRequestValuejson:",omitempty"WaitContainerWithContextWithS3Disable100ContinueautoPortListenWorkaroundfetchAndUpdateReferencesfillRegularObjectContentgetPCIDeviceModaliasPathnewRecordHeaderError$newRecordHeaderError$clearTransactionOptsYclearTransactionOptsYwantsHttp10KeepAlive(wantsHttp10KeepAlive(handleSubConnStateChangehashForClientCertificatelexLiteralStringAsStringmaxConstraintComparisonsonceSetNextProtoDefaultspathSysDevicesSystemNodepathSysKernelMMHugepagesprobablyPrimeMillerRabinprocessClientKeyExchangeprocessServerKeyExchangesetSupportedCapabilitieswriteExtendedSingleValue**readconcern.ReadConcern**runtime.PluginPrivilege*<-chan amqp.Confirmation*[0]metricdata.LabelValue*[1024]*runtime.heapArena*[15]stringprep.RuneRange*[16]stringprep.RuneRange*[17]stringprep.RuneRange*[18]stringprep.RuneRange*[1]*options.CountOptions*[1]runtime.vdsoSymbolKey*[34]stringprep.RuneRange*[3]capability.Capability*[4]runtime.stackfreelist*[8]*http.http2ClientConn*[8]*http.http2serverConn*[8]*http.http2writeQueue*[8][][]*x509.Certificate*[8]bsonrw.jsonParseState*[8]capability.Capability*[8]compressor.Compressor*[8]ghw.StorageController*[8]http.connectMethodKey*[8]http.http2frameParser*[8]map[ini.TokenType]int*[8]measurable.Measurable*[]*channelz.ServerMetric*[]*channelz.SocketMetric*[]*channelz.listenSocket*[]*channelz.normalSocket*[]*docker.EndpointConfig*[]*dynamodb.ItemResponse*[]*dynamodb.WriteRequest*[]*http.http2addConnCall*[]*metricdata.TimeSeries*[]*options.DeleteOptions*[]*options.RunCmdOptions*[]*options.UpdateOptions*[]*packfile.ObjectToPack*[]*proto.OneofProperties*[]*proto.marshalElemInfo*[]*pubsub.bundledMessage*[]*session.ClientOptions*[]*swarm.ConfigReference*[]*swarm.SecretReference*[]bsoncodec.ValueDecoder*[]bsoncodec.ValueEncoder*[]chan *http.persistConn*[]chan amqp.Confirmation*[]cipher.gcmFieldElement*[]docker.BlkioStatsEntry*[]docker.PluginPrivilege*[]flate.compressionLevel*[]index.ResolveUndoEntry*[]jmespath.functionEntry*[]json.reflectWithString*[]map[http2.Flags]string*[]packet.outputSubpacket*[]plumbing.ReferenceName*[]proto.discardFieldInfo*[]request.WaiterAcceptor*[]runtime.memRecordCycle*[]syscall.NetlinkMessage*[]x509.distributionPoint*[]x509.policyInformation*[]yaml.yaml_alias_data_t*[]yaml.yaml_simple_key_t*agent.agentKeyringSigner*agent.agentV1IdentityMsg*amqp.connectionUnblocked*annotations.HttpRule_Get*annotations.HttpRule_Put*base64.CorruptInputError*binarylog.LogEntryConfig*bsoncodec.ValueMarshaler*bzip2.moveToFrontDecoder*chan *grpc.scStateUpdate*chan http.requestAndChan*chan singleflight.Result*chan<- *docker.APIEvents*cobra.FParseErrWhitelist*command.AbortTransaction*command.FindOneAndDelete*command.FindOneAndUpdate*command.WriteCommandKind*credentials.ProtocolInfo*description.TopologyDiff*description.TopologyKind*description.VersionRange*description.serverSorter*descriptor.MethodOptions*diffmatchpatch.Operation*dnsmessage.CNAMEResource*docker.AuthConfiguration*docker.BuildImageOptions*docker.CreateExecOptions*docker.ExecProcessConfig*docker.LeaveSwarmOptions*docker.ListImagesOptions*docker.NetworkFilterOpts*docker.PushPluginOptions*docker.RemoveNodeOptions*docker.UpdateNodeOptions*dynamodb.DeleteItemInput*dynamodb.ListTablesInput*dynamodb.TransactGetItem*dynamodb.UpdateItemInput*dynamodbattribute.Number*encoding.BinaryMarshaler*encoding.TextUnmarshaler*errors.keyIncorrectError*event.CommandFailedEvent*filesystem.ConfigStorage*filesystem.ModuleStorage*filesystem.ObjectStorage*fileutils.PatternMatcher*func() (*os.File, error)*func() (*url.URL, error)*func() ([]string, error)*func() (bson.Raw, error)*func() (bsonx.Arr, bool)*func() (bsonx.Doc, bool)*func() (net.Conn, error)*func() (time.Time, bool)*func() *config.Submodule*func() *emission.Emitter*func() *http.http2Framer*func() *machinery.Server*func() bsoncore.Document*func() driver.WriteModel*func() errcode.ErrorCode*func() filemode.FileMode*func() http2.FrameHeader*func() map[string]string*func() object.CommitIter*func() trace.SpanContext*func(*[]uint8, int) bool*func(*endpoints.Options)*func(*index.Index) error*func(*object.Blob) error*func(*object.File) error*func(*object.Tree) error*func(...anagent.Handler)*func(...macaron.Handler)*func(...trace.Attribute)*func([]resolver.Address)*func(bool) *toml.Encoder*func(bson.RawValue) bool*func(description.Server)*func(float64) *big.Float*func(fmt.Stringer, bool)*func(func(interface {}))*func(int) reflect.Method*func(int) syntax.EmptyOp*func(int) tar.sparseElem*func(int, []uint8) error*func(int32) (int, error)*func(interface {}) error*func(io.RuneReader) bool*func(macaron.BeforeFunc)*func(net.Listener) error*func(norm.Form, []uint8)*func(proto.Message) bool*func(reflect.Value) bool*func(ssh.PublicKey) bool*func(string) *aws.Config*func(string) *pflag.Flag*func(string, bool) error*func(string, int) string*func(string, string) int*func(string, uint) error*func(tablewriter.Border)*func(time.Duration) bool*func(uint64, bool) error*grpc.scStateUpdateBuffer*http.finishAsyncByteRead*http.http2ClientConnPool*http.http2RSTStreamFrame*http.http2WriteScheduler*http.http2badStringError*http.http2bufferedWriter*http.http2clientConnPool*http.http2contextContext*http.http2responseWriter*http.http2writeQueuePool*http.nothingWrittenError*idxfile.idxfileEntryIter*index.resolveUndoDecoder*jmespath.treeInterpreter*jsonmessage.JSONProgress*logging.DefaultFormatter*logging.defaultFormatter*map.bucket[int32][]int32*map.bucket[int64][]uint8*map.bucket[string]string*map.bucket[string]uint64*map.bucket[uint16]string*map.bucket[uint64]string*map.hdr[reflect.Type]int*map.hdr[string]bsonx.Val*map.hdr[string]struct {}*map.hdr[string]time.Time*map.iter[int64]struct {}*map.iter[string][]string*map[*http.conn]struct {}*map[ghw.DriveType]string*map[gob.typeId]gob.decOp*map[http2.ErrCode]string*map[http2.SettingID]bool*map[int32]unsafe.Pointer*map[jmespath.tokType]int*map[logging.Level]string*map[logging.level]string*map[string]*macaron.Leaf*map[string]*macaron.Tree*map[string]*trace.family*map[string]http.muxEntry*map[string]plumbing.Hash*map[string]proto.Message*map[string]reflect.Value*map[string]toml.sortNode*map[string]user.Identity*map[uint16]*amqp.Channel*map[unsafe.Pointer]int32*metricdata.BucketOptions*mongo.BulkWriteException*object.bfsCommitIterator*object.commitAllIterator*object.commitPreIterator*options.AggregateOptions*options.BulkWriteOptions*options.InsertOneOptions*packet.CompressionConfig*packfile.trackableReader*packp.UploadPackResponse*pflag.durationSliceValue*pkix.AlgorithmIdentifier*plumbing.UnexpectedError*proto.generatedDiscarder*proto.oneofWrappersIface*proto.unmarshalFieldInfo*pubsub.ListTopicsRequest*pubsub.streamingPullFunc*reflect.funcTypeFixed128*request.ErrInvalidParams*request.ErrParamMinValue*request.ErrParamRequired*result.TransactionResult*result.WriteConcernError*runtime.cgoSymbolizerArg*runtime.gcMarkWorkerMode*runtime.semaProfileFlags*runtime.specialfinalizer*schema.APIRouteGenerator*scram.ClientConversation*scram.ServerConversation*sqs.ReceiveMessageOutput*ssh.channelOpenDirectMsg*ssh_config.sshLexStateFn*storer.DeltaObjectStorer*storer.EncodedObjectIter*storer.LooseObjectStorer*struct { Node ast.Node }*struct { atomic uint64 }*swarm.ExternalCAProtocol*swarm.PortConfigProtocol*syscall.NetlinkRouteAttr*syscall.RawSockaddrInet4*syscall.RawSockaddrInet6*tasks.ErrUnsupportedType*tls.RenegotiationSupport*tls.certificateStatusMsg*tls.certificateVerifyMsg*tls.clientHandshakeState*tls.clientKeyExchangeMsg*tls.serverHandshakeState*tls.serverKeyExchangeMsg*trace.SamplingParameters*trace.defaultIDGenerator*transport.ConnectOptions*transport.incomingGoAway*transport.outStreamState*transport.registerStream*transport.transportState*user.UnknownGroupIdError*viper.ConfigMarshalError*wiremessage.CompressorID*x509.authorityInfoAccess*xml.UnsupportedTypeError*yaml.yaml_parser_state_t*yaml.yaml_read_handler_t*yaml.yaml_scalar_style_tAllowedPersistenceRegionsAuxjson:"aux,omitempty"BatchWriteItemWithContext CPUPeriodqs:"cpuperiod"CPUQuotajson:"CpuQuota" CPUSharesqs:"cpushares"CopyBytesToDocumentWriterCriticalasn1:"optional"Defaultsjson:"defaults"DeleteMessageBatchRequestDescribeBackupWithContextDescribeContinuousBackupsDescribeLimitsWithContextDescribeTimeToLiveRequestDisableEndpointHostPrefixDownloadArtefactsFromTaskDriverjson:",omitempty"DynamoDByaml:"dynamodb"EmptyInterfaceDecodeValueEmptyInterfaceEncodeValueEnginejson:",omitempty"EnvironmentOverrideColorsFlagEncryptCommunicationsGetQueueAttributesRequestGlobaljson:",omitempty" GlobalTables type:"list"Groupsjson:",omitempty"Hostnamejson:"hostname"Idasn1:"optional,tag:0"InactivityTimeoutqs:"-"IsInterfaceLocalMulticast KeyConditions type:"map"Labelsjson:",omitempty"Leaderjson:",omitempty" LifetimeSecs sshtype:"1"Limitsjson:",omitempty"ListTagsOfResourceRequestLocalebson:",omitempty"MaxConstraintComparisionsMountsjson:",omitempty"Msgbson:"msg,omitempty"NoCopyjson:",omitempty"NodeIDjson:",omitempty"ParentIDjson:"ParentId"Passwordform:"password"ReceiveMessageWithContext RegionName type:"string"RepoTagsjson:"RepoTags"RestoreTableToPointInTimeSearchjson:",omitempty"ServerSelectionTimeoutSetServicesjson:"services"SetBackupCreationDateTimeSetGlobalSecondaryIndexesSetGlobalTableBillingModeSetGlobalTableDescriptionSetKeyConditionExpressionSetLastEvaluatedBackupArnSetLastEvaluatedTableNameSetMD5OfMessageAttributesSetMessageDeduplicationIdSetNumberOfDecreasesTodaySetQueueAttributesRequestSetQueueOwnerAWSAccountIdSetReturnConsumedCapacitySourcejson:",omitempty"StartContainerWithContextStatusjson:",omitempty"Subnetjson:",omitempty"Targetjson:",omitempty"TransactWriteItemsRequestTypemapstructure:"type"UpdateGlobalTableSettingsUpsertedbson:"upserted"ValueMarshalerEncodeValueVerifyRevocationSignatureWaitmapstructure:"wait"Windowjson:",omitempty"addRefsFromPackedRefsFileautoAddModifiedAndDeletedcheckReferenceAndTruncatecheckoutChangeRegularFilecommandsMaxCommandPathLenconsumeUnquotedIdentifierdoCalculateHashForRegulardoCalculateHashForSymlinkfillEncodedObjectFromFilefillOFSDeltaObjectContentfillREFDeltaObjectContentfractionalUtilizationGoalfullyQualifiedProjectNamegenerateClientKeyExchangegenerateServerKeyExchangegetServerAPIVersionStringinitialConnRecvWindowSizenewReferenceUpdateRequestnewWriterAndRequestNoBodyopenAndLockPackedRefsModepromoteUndeclaredTrailerssearchMapWithPathPrefixesupdateEffectiveWindowSize**dynamodb.TransactGetItem**result.WriteConcernError*<-chan description.Server*<-chan grpc.ServiceConfig*[0]*metricdata.TimeSeries*[113]template.contentType*[134217727]runtime.elfSym*[1]*packfile.ObjectToPack*[1]*session.ClientOptions*[1]request.WaiterAcceptor*[268435455]runtime.elfDyn*[2]request.WaiterAcceptor*[360]stringprep.RuneRange*[396]stringprep.RuneRange*[3]runtime.memRecordCycle*[8]*channelz.listenSocket*[8]*channelz.normalSocket*[8]*docker.EndpointConfig*[8]*http.http2addConnCall*[8]*packfile.ObjectToPack*[8]*proto.OneofProperties*[8]*proto.marshalElemInfo*[8]bsoncodec.ValueDecoder*[8]bsoncodec.ValueEncoder*[8]chan *http.persistConn*[8]jmespath.functionEntry*[8]map[http2.Flags]string*[8]plumbing.ReferenceName*[]*channelz.ChannelMetric*[]*dynamodb.BackupSummary*[]*dynamodb.ReplicaUpdate*[]*grpc.acBalancerWrapper*[]*http.http2clientStream*[]*http.http2priorityNode*[]*options.FindOneOptions*[]*options.ReplaceOptions*[]*options.SessionOptions*[]*packet.OpaqueSubpacket*[]*proto.StructProperties*[]*proto._MessageSet_Item*[]*proto.marshalFieldInfo*[]*pubsub.ReceivedMessage*[][]*http.http2ClientConn*[][]*multipart.FileHeader*[]bidirule.ruleTransition*[]chan description.Server*[]docker.ContainerNetwork*[]errcode.ErrorDescriptor*[]logging.LoggerInterface*[]map[string]interface {}*[]metricproducer.Producer*[]pkix.RevokedCertificate*[]request.ErrInvalidParam*[]runtime.pcvalueCacheEnt*[]swarm.EndpointVirtualIP*[]swarm.NetworkAttachment*[]swarm.PluginDescription*[]wiremessage.WireMessage*agent.ConstraintExtension*agent.signRequestAgentMsg*agenttasks.DockerExecutor*annotations.FieldBehavior*annotations.HttpRule_Post*auth.AuthenticatorFactory*auth.DefaultAuthenticator*binarylog.ClientHalfClose*binarylog.callIDGenerator*bsoncodec.RegistryBuilder*bsoncodec.StructTagParser*bsoncore.DocumentSequence*bsoncore.ElementTypeError*bsonrw.extJSONValueWriter*chan description.Topology*channelz.SocketOptionData*channelz.SubChannelMetric*cobra.commandSorterByName*command.CommitTransaction*command.FindOneAndReplace*command.QueryFailureError*compressor.ZlibCompressor*descriptor.MessageOptions*descriptor.ServiceOptions*descriptor.SourceCodeInfo*dnsmessage.ResourceHeader*docker.AuthConfigurations*docker.EndpointIPAMConfig*docker.ExportImageOptions*docker.ImportImageOptions*docker.ListConfigsOptions*docker.ListSecretsOptions*docker.ListVolumesOptions*docker.LogsServiceOptions*docker.PluginLinuxDevices*docker.PruneImagesOptions*docker.PruneImagesResults*docker.RemoveImageOptions*docker.UpdateSwarmOptions*docker.VolumeDriverConfig*driver.BulkWriteException*dynamodb.ConsumedCapacity*dynamodb.CreateTableInput*dynamodb.DeleteItemOutput*dynamodb.DeleteTableInput*dynamodb.KeySchemaElement*dynamodb.ListBackupsInput*dynamodb.ListTablesOutput*dynamodb.SSESpecification*dynamodb.TableDescription*dynamodb.TagResourceInput*dynamodb.UpdateItemOutput*dynamodb.UpdateTableInput*edwards25519.FieldElement*elliptic.p224FieldElement*emission.RecoveryListener*endpoints.credentialScope*errors.unknownIssuerError*event.CommandStartedEvent*filesystem.ShallowStorage*func() (*ast.File, error)*func() (bsonx.Doc, error)*func() (bsonx.MDoc, bool)*func() (io.Reader, error)*func() (string, bson.Raw)*func() (time.Time, error)*func() (xml.Token, error)*func() *amqp.AMQPlainAuth*func() *duration.Duration*func() *iterator.PageInfo*func() *pubsub.PushConfig*func() *readpref.ReadPref*func() *setting.WebConfig*func() []*pubsub.Snapshot*func() []tracestate.Entry*func() arraylist.Iterator*func() connectivity.State*func() description.Server*func() flag.ErrorHandling*func() opentracing.Tracer*func() primitive.ObjectID*func(*big.Int) *big.Float*func(*big.Rat) *big.Float*func(*flate.decompressor)*func(*git.Worktree) error*func(*http.Request) error*func(*logrus.Entry) error*func(*metricdata.Summary)*func(*regexp.Regexp) bool*func(*syntax.Regexp) bool*func(...string) bsonx.Val*func([]big.Word) *big.Int*func([]int) reflect.Value*func([]string, bool) bool*func([]uint8, int) string*func(agenttasks.Executor)*func(bool, []uint8) error*func(bsoncore.Value) bool*func(chan bool) chan bool*func(crr.WeightedAddress)*func(error) *logrus.Entry*func(func(uintptr)) error*func(http.ResponseWriter)*func(http2.Setting) error*func(int) image.Rectangle*func(int) trace.traceList*func(int, func(int, int))*func(int, int) color.CMYK*func(int, int) color.Gray*func(int, int) color.RGBA*func(int, int, int) error*func(int64, int64, int64)*func(io.ReadCloser) error*func(io.Reader) io.Reader*func(io.RuneReader) []int*func(net.IPAddr) net.Addr*func(object.Object) error*func(opentracing.LogData)*func(plumbing.Hash) error*func(plumbing.ObjectType)*func(proto.Message) error*func(reflect.Value) error*func(ssh.PublicKey) error*func(string) (int, error)*func(string) *index.Entry*func(string) *sqs.Message*func(string) *viper.Viper*func(string) interface {}*func(string) net.sockaddr*func(string) schema.Route*func(string, int) [][]int*func(string, int64) int64*func(string, string) *int*func(string, string) bool*func(time.Duration) error*func(uint32, []bool) bool*git.SubmoduleRescursivity*grpc_binarylog_v1.Address*grpc_binarylog_v1.Message*grpc_binarylog_v1.Trailer*http.checkConnErrorWriter*http.expectContinueReader*http.globalOptionsHandler*http.http2ConnectionError*http.http2bodyWriterState*http.http2goAwayFlowError*http.http2handlerPanicRST*http.http2readFrameResult*http.http2stickyErrWriter*http.http2writeResHeaders*http.requestBodyReadError*http.tcpKeepAliveListener*image.YCbCrSubsampleRatio*internal.PerMethodSummary*ioutils.ReadCloserWrapper*json.UnsupportedTypeError*jwalterweatherman.Notepad*logging.ColouredFormatter*map.bucket[*uint8][]uint8*map.bucket[int]*sync.Pool*map.bucket[int]codes.Code*map.bucket[ssh.Signal]int*map.bucket[string]*string*map.bucket[string][]uint8*map.bucket[uint32][]uint8*map.bucket[uint]chan uint*map.hdr[*trace.trace]bool*map.hdr[int]toml.sortNode*map.hdr[reflect.Type]bool*map.hdr[string]*flag.Flag*map.hdr[string]billy.File*map.iter[string]bsonx.Val*map.iter[string]time.Time*map[*trace.Span]struct {}*map[docker.Port]struct {}*map[gob.typeId]*gob.decOp*map[http.ConnState]string*map[int32]proto.Extension*map[interface {}][]string*map[string]*config.Branch*map[string][]*http.Cookie*map[string][]interface {}*map[string]common.Profile*map[string]docker.Runtime*map[string]encoding.Codec*map[string]map[string]int*map[string]parse.itemType*map[string]yaml.fieldInfo*mongo.ListDatabasesResult*object.changeEntryWrapper*object.commitPostIterator*openpgp.canonicalTextHash*opentracing.BuiltinFormat*opentracing.FinishOptions*opentracing.SpanReference*options.CollectionOptions*options.InsertManyOptions*packet.PublicKeyAlgorithm*pflag.stringToStringValue*properties.LogHandlerFunc*proto.InternalMessageInfo*proto.RequiredNotSetError*pubsub.AcknowledgeRequest*pubsub.DeleteTopicRequest*pubsub.GetSnapshotRequest*pubsub.ListTopicsResponse*pubsub.SubscriptionConfig*pubsub.UpdateTopicRequest*resolver.ResolveNowOption*runtime.gcControllerState*sqs.BatchResultErrorEntry*sqs.MessageAttributeValue*sqs.RemovePermissionInput*sqs.SendMessageBatchInput*ssh.HostKeyCallbackHelper*ssh.channelOpenConfirmMsg*ssh.channelOpenFailureMsg*storer.PackedObjectStorer*storer.ReferenceSliceIter*strings.appendSliceWriter*strings.stringWriterIface*struct { StatusCode int }*swarm.OrchestrationConfig*swarm.PlacementPreference*syscall.SockaddrLinklayer*template.missingKeyAction*tls.certificateRequestMsg*transport.ClientTransport*transport.ConnectionError*transport.ServerTransport*transport.transportReader*vagrantutil.CommandOutput*viper.DecoderConfigOption*viper.remoteConfigFactory*writeconcern.WriteConcern*yaml.yaml_emitter_state_t*yaml.yaml_mapping_style_t*yaml.yaml_tag_directive_t*yaml.yaml_write_handler_tAliasesjson:",omitempty" ClientPubKey sshtype:"30"Clusterjson:",omitempty"Commandjson:",omitempty"Configsjson:",omitempty"DescribeGlobalTableRequestFindAllStringSubmatchIndexGatewayjson:",omitempty"GetLeadingDetachedCommentsGidMappingsEnableSetgroupsHasAvailableInheritedFlagsIPRangejson:",omitempty"Ingressjson:",omitempty"Keyjson:"key" form:"key"ListDeadLetterSourceQueuesListTablesPagesWithContextMGFasn1:"explicit,tag:1"MarkPersistentFlagFilenameMarkPersistentFlagRequiredMaxAnnotationEventsPerSpanMessagejson:",omitempty"Monitorjson:",omitempty"Namejson:"partitionName"NegotiatedProtocolIsMutualNetworkjson:",omitempty"Optionsjson:",omitempty"Pluginsjson:",omitempty" Repositoryqs:"fromImage"Retriesjson:",omitempty"Runtimejson:",omitempty"Secretsjson:",omitempty"SetContinuousBackupsStatusSetExclusiveStartBackupArnSetExclusiveStartTableNameSetGlobalNormalizationFuncSetPartialFilterExpressionSetReceiveRequestAttemptIdSetTimeToLiveSpecificationSetUseLatestRestorableTime StringValue type:"string"SuggestionsMinimumDistanceSysctlsjson:",omitempty"TLSInfojson:",omitempty"TaskNamebson:"task_name"Timeoutjson:",omitempty"URLjson:"url" form:"url"Versionjson:",omitempty"WatchRemoteConfigOnChannelWithDisableParamValidationXXX_unrecognizedjson:"-"applyToReplicaSetNoPrimarycheckSupportedCapabilitiescloseAllStreamsOnConnClosecopyTreeToStorageRecursivededicatedMarkWorkersNeededdiskPhysicalBlockSizeBytesmaxPayloadSizeForWrite$maxPayloadSizeForWrite$interfaceArrayToLinksArrayinvalidDocumentLengthErrorupdateRemoteConfigIfNeeded**[134217727]runtime.elfSym**bsoncore.DocumentSequence**dynamodb.KeySchemaElement**options.InsertManyOptions**pubsub.ListTopicsResponse**sqs.MessageAttributeValue**writeconcern.WriteConcern*<-chan singleflight.Result*[10]flate.compressionLevel*[16]cipher.gcmFieldElement*[1]*options.SessionOptions*[2]bidirule.ruleTransition*[2]map[string]interface {}*[8]*grpc.acBalancerWrapper*[8]*http.http2clientStream*[8]*http.http2priorityNode*[8]*proto.StructProperties*[8][]*http.http2ClientConn*[8][]*multipart.FileHeader*[8]chan description.Server*[8]docker.ContainerNetwork*[8]errcode.ErrorDescriptor*[8]logging.LoggerInterface*[8]metricproducer.Producer*[]*dynamodb.AttributeValue*[]*options.DatabaseOptions*[]*options.DistinctOptions*[]*runtime.PluginPrivilege*[]*stats.measureDescriptor*[][]*dynamodb.WriteRequest*[]chan<- *docker.APIEvents*[]docker.AuthConfiguration*[]func(*endpoints.Options)*[]map[string]*macaron.Leaf*[]proto.unmarshalFieldInfo*[]storer.EncodedObjectIter*[]syscall.NetlinkRouteAttr*[]wiremessage.CompressorID*[]x509.authorityInfoAccess*[]yaml.yaml_parser_state_t*agent.signResponseAgentMsg*agenttasks.ArtefactMapping*agenttasks.ExecutorContext*agenttasks.VagrantExecutor*annotations.HttpRule_Patch*balancer.NewSubConnOptions*bsoncodec.ValueDecoderFunc*bsoncodec.ValueEncoderFunc*bsoncodec.ValueUnmarshaler*bsoncodec.fieldDescription*bsonrw.BSONValueWriterPool*chan http.http2bodyReadMsg*chan http.http2resAndError*chan http.responseAndError*chan<- singleflight.Result*connection.commandMetadata*credentials.StaticProvider*description.SelectedServer*description.ServerSelector*descriptor.DescriptorProto*docker.ContainerNotRunning*docker.CreateConfigOptions*docker.CreatePluginOptions*docker.CreateSecretOptions*docker.CreateVolumeOptions*docker.EnablePluginOptions*docker.ExportImagesOptions*docker.ListServicesOptions*docker.PruneVolumesOptions*docker.PruneVolumesResults*docker.RemoveConfigOptions*docker.RemovePluginOptions*docker.RemoveSecretOptions*docker.RemoveVolumeOptions*docker.UpdateConfigOptions*docker.UpdateSecretOptions*dynamodb.BackupDescription*dynamodb.BatchGetItemInput*dynamodb.CreateBackupInput*dynamodb.CreateTableOutput*dynamodb.DeleteBackupInput*dynamodb.DeleteTableOutput*dynamodb.KeysAndAttributes*dynamodb.ListBackupsOutput*dynamodb.TagResourceOutput*dynamodb.TransactWriteItem*dynamodb.UpdateTableOutput*encoding.BinaryUnmarshaler*endpoints.ResolvedEndpoint*event.CommandFinishedEvent*func() ([][]string, error)*func() ([]bson.Raw, error)*func() ([]net.Addr, error)*func() (amqp.frame, error)*func() (billy.File, error)*func() (git.Status, error)*func() (int32, int, error)*func() (json.Token, error)*func() (noder.Noder, bool)*func() (noder.Path, error)*func() (string, bsonx.Doc)*func() *bsoncodec.Registry*func() []*iam.BindingDelta*func() []hpack.HeaderField*func() binaryheap.Iterator*func() endpoints.Partition*func() plumbing.ObjectType*func() ssh_config.Position*func() tls.ConnectionState*func(*asn1.BitString) bool*func(*cobra.Command) error*func(*config.Branch) error*func(*config.Config) error*func(*grpc.callInfo) error*func(*int, string, string)*func(*object.Commit) error*func(*packp.AdvRefs) error*func(*pflag.FlagSet) error*func(*proto.Extension) int*func(...interface {}) bool*func(...string) bsonx.Elem*func([]uint8) (int, error)*func([]uint8, int) [][]int*func([]uint8, int) []uint8*func([]uint8, uint8) error*func(agent.AddedKey) error*func(bool) trace.traceList*func(bool, [8]uint8) error*func(bsoncore.Value) error*func(client.Request) error*func(context.Context) bool*func(func(*cobra.Command))*func(func(fsnotify.Event))*func(http.Header) []string*func(http.http2Flags) bool*func(image.Rectangle) bool*func(int) ([]uint8, error)*func(int, ...interface {})*func(int, int) color.Color*func(int, int) color.YCbCr*func(int, int, bool) error*func(int, int, color.CMYK)*func(int, int, color.Gray)*func(int, int, color.RGBA)*func(int, int64, bool) int*func(int64) (int64, error)*func(knownhosts.addr) bool*func(logging.level) string*func(primitive.Regex) bool*func(proto.Message) string*func(request.NamedHandler)*func(string) (bool, error)*func(string) (int8, error)*func(string) (uint, error)*func(string) *dynamodb.Get*func(string) *dynamodb.Put*func(string) *dynamodb.Tag*func(string) *pubsub.Topic*func(string) *toml.Decoder*func(string) *toml.Encoder*func(string) digest.Digest*func(string) errcode.Error*func(string) map[uint8]int*func(string) reflect.Value*func(string) time.Duration*func(string) toml.Position*func(string, http.Handler)*func(string, iam.RoleName)*func(string, int) []string*func(string, interface {})*func(string, string) error*func(time.Duration) string*func(uint) bson.RawElement*func(uint32) (bool, error)*func(uint32) io.ReadWriter*func(uint32, uint32) error*func(uint64) []openpgp.Key*git.SubmoduleUpdateOptions*grpc.retryThrottlingPolicy*grpc_binarylog_v1.Metadata*http.http2MetaHeadersFrame*http.http2PushPromiseFrame*http.http2PushPromiseParam*http.http2connectionStater*http.http2flushFrameWriter*http.http2frameWriteResult*http.http2startPushRequest*http.http2writePushPromise*http.http2writeSettingsAck*http.socksUsernamePassword*http2.headerFieldNameError*httptrace.WroteRequestInfo*httputil.failureToReadBody*index.treeExtensionDecoder*ioutils.writeCloserWrapper*json.InvalidUnmarshalError*json.UnsupportedValueError*jwalterweatherman.Feedback*keepalive.ClientParameters*macaron.handlerFuncInvoker*map.bucket[*yaml.node]bool*map.bucket[codes.Code]bool*map.bucket[float64]float64*map.bucket[gob.typeId]bool*map.bucket[int64]struct {}*map.bucket[string][2]int32*map.bucket[string][]string*map.hdr[*gob.typeInfo]bool*map.hdr[int64]interface {}*map.hdr[plumbing.Hash]bool*map.hdr[reflect.visit]bool*map.hdr[string]*index.node*map.hdr[string]*parse.Tree*map.iter[*trace.trace]bool*map.iter[string]*flag.Flag*map.iter[string]billy.File*map[clog.MODE]clog.Factory*map[gob.typeId]gob.gobType*map[http.http2Flags]string*map[http2.FrameType]string*map[http2.SettingID]string*map[int32]jmespath.tokType*map[int64]*channelz.server*map[interface {}]struct {}*map[string]*fsnotify.watch*map[string]*ssh.cipherMode*map[string]*trace.traceSet*map[string][]net.nssSource*map[string]agenttasks.Task*map[string]docker.Endpoint*map[string]map[string]bool*map[string]viper.FlagValue*map[tag.Key]tag.tagContent*mapstructure.DecoderConfig*merkletrie.noderToChangeFn*options.DropIndexesOptions*options.ListIndexesOptions*options.TransactionOptions*packet.partialLengthReader*packfile.deltaIndexScanner*pflag.ParseErrorsWhitelist*pkix.AttributeTypeAndValue*proto.slowExtensionAdapter*pubsub.TopicConfigToUpdate*request.HandlerListRunItem*roundrobin.rrPickerBuilder*rsa.PKCS1v15DecryptOptions*runtime.TypeAssertionError*runtime.traceAllocBlockPtr*scrypt.scryptSHA256Crypter*session.TransactionOptions*sqs.RemovePermissionOutput*sqs.SendMessageBatchOutput*ssh.chacha20Poly1305Cipher*storer.EncodedObjectStorer*strings.byteStringReplacer*swarm.NamedGenericResource*swarm.ResourceRequirements*syscall.RawSockaddrNetlink*tls.CertificateRequestInfo*transport.incomingSettings*transport.outgoingSettings*transport.parsedHeaderData*transport.recvBufferReader*x509.UnknownAuthorityError*x509.distributionPointName*yaml.yaml_sequence_style_tAgentmapstructure:"agent"ArraysWithOneElementPerLine Backfillingtype:"boolean"CAConfigjson:",omitempty" CPUPeriodjson:"CpuPeriod" CPUSetCPUsqs:"cpusetcpus" CPUSharesjson:"CpuShares"Childrenjson:",omitempty"Codejson:"code,omitempty" DNSSuffixjson:"dnsSuffix"Databasemapstructure:"db"Debugmapstructure:"debug"DeleteOldObjectPackAndIndexDescribeGlobalTableSettingsDiffCleanupSemanticLossless Dockerfileqs:"dockerfile"DualStackHostnamejson:"-"DynamicRecordSizingDisabledEndpointjson:",omitempty" Endpointsjson:"endpoints" ExtensionType sshtype:"27" Extensionsasn1:"optional"Fromjson:"from,omitempty"GetMessageRetentionDurationGetStreamAckDeadlineSeconds HTTPProxyjson:"HttpProxy"HasAvailablePersistentFlagsHashasn1:"explicit,tag:0"Hostnamejson:",omitempty"IndexSizeBytes type:"long"InspectContainerWithContextInternaljson:",omitempty"Intervaljson:",omitempty"ListGlobalTablesWithContextManagersjson:",omitempty"NanoCPUsjson:",omitempty"Networksjson:",omitempty" NextUpdateasn1:"optional" Parametersasn1:"optional"Pathjson:"Path,omitempty"PermittedDNSDomainsCriticalPlatformjson:",omitempty" Processedjson:"processed"Protocoljson:",omitempty" Protocolsjson:"protocols"Ratejson:"Rate,omitempty"ReadOnlyjson:",omitempty"ReadOptionalASN1OctetStringRemovePermissionWithContextReplicasjson:",omitempty"SSLClientCertificateKeyFileSendMessageBatchWithContextSetBypassDocumentValidationSetExpressionAttributeNamesSetLatestRestorableDateTimeSetMaxDynamicTableSizeLimitSignedCertificateTimestampsSizejson:"size,omitempty"Strengthbson:",omitempty"TableSizeBytes type:"long"Tagsbson:"tags,omitempty"Timejson:"time,omitempty" Timestampjson:"timestamp" TotalSizebson:"totalSize"TransactGetItemsWithContextTypejson:"type,omitempty"URLsjson:"urls,omitempty"UnhandledCriticalExtensionsUpdateTimeToLiveWithContextValueUnmarshalerDecodeValueWarningsjson:",omitempty"WithDisableComputeChecksumsdefaultServiceConfigRawJSONincomingWindowUpdateHandlerinitialStreamRecvWindowSizeinitialStreamSendWindowSizelruAttributesToAttributeMapoutgoingWindowUpdateHandlerparseDynamicTableSizeUpdatereconstructProgressiveImagerewritePackedRefsWithoutRefupdateLocalReferenceStorageupdateUnknownWithStandalonevendor/golang_org/x/net/idna**dynamodb.KeysAndAttributes**dynamodb.TransactWriteItem*<-chan description.Topology*[16]runtime.pcvalueCacheEnt*[8192]runtime.traceStackPtr*[8]*dynamodb.AttributeValue*[8]*stats.measureDescriptor*[8][]*dynamodb.WriteRequest*[8]docker.AuthConfiguration*[8]map[string]*macaron.Leaf*[8]proto.unmarshalFieldInfo*[8]wiremessage.CompressorID*[]*[1024]*runtime.heapArena*[]*dynamodb.TransactGetItem*[]*options.AggregateOptions*[]*options.BulkWriteOptions*[]*options.InsertOneOptions*[][]errcode.ErrorDescriptor*[]agent.ConstraintExtension*[]annotations.FieldBehavior*[]auth.AuthenticatorFactory*[]chan description.Topology*[]docker.PluginLinuxDevices*[]func(string, string) bool*[]internal.PerMethodSummary*[]opentracing.SpanReference*[]swarm.PlacementPreference*[]viper.DecoderConfigOption*[]yaml.yaml_emitter_state_t*[]yaml.yaml_tag_directive_t*annotations.HttpRule_Custom*annotations.HttpRule_Delete*auth.MongoDBCRAuthenticator*bsoncodec.ErrNoTypeMapEntry*bsoncodec.ValueDecoderError*bsoncodec.ValueEncoderError*bsoncodec.structDescription*compressor.SnappyCompressor*connection.pooledConnection*description.latencySelector*descriptor.EnumValueOptions*docker.CreateNetworkOptions*docker.CreateServiceOptions*docker.DisablePluginOptions*docker.InstallPluginOptions*docker.KillContainerOptions*docker.PruneNetworksOptions*docker.PruneNetworksResults*docker.RemoveServiceOptions*docker.UpdateServiceOptions*docker.eventMonitoringState*dynamodb.BatchGetItemOutput*dynamodb.BillingModeSummary*dynamodb.CreateBackupOutput*dynamodb.DeleteBackupOutput*dynamodb.DescribeTableInput*dynamodb.ReplicaDescription*dynamodb.SourceTableDetails*dynamodb.UntagResourceInput*errors.InvalidArgumentError*event.CommandSucceededEvent*filesystem.ReferenceStorage*func() (*docker.Env, error)*func() (*object.Tag, error)*func() (http2.Frame, error)*func() (int, string, error)*func() (interface {}, bool)*func() (metadata.MD, error)*func() (os.FileInfo, error)*func() (os.FileMode, error)*func() *config.RemoteConfig*func() *macaron.RequestBody*func() *primitive.Timestamp*func() *pubsub.Subscription*func() *setting.AgentConfig*func() *timestamp.Timestamp*func() []*fileutils.Pattern*func() []*metricdata.Metric*func() []*template.Template*func() description.Topology*func() primitive.Decimal128*func() view.AggregationData*func(*big.Float) *big.Float*func(*git.Repository) error*func(*grpc.csAttempt) error*func(*http.Response, error)*func(*http.http2ClientConn)*func(*http.http2serverConn)*func(*int64, asn1.Tag) bool*func(*proto.Extension) bool*func(*request.Request) bool*func(*ssh.Certificate) bool*func(*syscall.Stat_t) error*func(...tablewriter.Colors)*func([]plumbing.Hash) error*func([]string) interface {}*func([]uint8) cipher.Stream*func([]uint8) digest.Digest*func([]uint8, []uint8) bool*func(aws.LogLevelType) bool*func(bool) ([]uint8, error)*func(capability.Capability)*func(context.Context) error*func(func(viper.FlagValue))*func(httptrace.DNSDoneInfo)*func(httptrace.GotConnInfo)*func(iam.RoleName) []string*func(int) ([]string, error)*func(int) *emission.Emitter*func(int) http.http2Setting*func(int, int, color.Color)*func(int, int, uint8) error*func(int32) ([]int32, bool)*func(int64) ([]uint8, bool)*func(int64, channelz.entry)*func(int64, int64) *big.Int*func(int64, int64) *big.Rat*func(interface {}, uintptr)*func(io.Writer, bool) error*func(macaron.BeforeHandler)*func(primitive.Binary) bool*func(string) ([]int, error)*func(string) (bool, string)*func(string) (int16, error)*func(string) (int32, error)*func(string) (int64, error)*func(string) (string, bool)*func(string) (uint8, error)*func(string) *config.Config*func(string, string) string*func(string, string, error)*func(string, uint64) uint64*func(timeseries.Observable)*func(token.Pos) *token.File*func(uint) bsoncore.Element*func(uint8) (string, error)*func(uintptr) (string, int)*grpc.UnaryClientInterceptor*http.http2ContinuationFrame*http.http2FrameWriteRequest*http.http2HeadersFrameParam*http.http2OpenStreamOptions*http.http2WindowUpdateFrame*http.http2noCachedConnError*http.http2priorityNodeState*http.http2pseudoHeaderError*http.http2writeWindowUpdate*http2.headerFieldValueError*http2.headersOrContinuation*internal.ErrorBucketSummary*jwalterweatherman.Threshold*map.bucket[int32]bidi.Class*map.bucket[reflect.Type]int*map.bucket[string]*http.Dir*map.bucket[string]bsonx.Val*map.bucket[string]struct {}*map.bucket[string]time.Time*map.bucket[tls.alert]string*map.hdr[int32]*trace.bucket*map.hdr[interface {}]string*map.hdr[string]interface {}*map.iter[int64]interface {}*map.iter[plumbing.Hash]bool*map.iter[string]*parse.Tree*map[*net.Listener]struct {}*map[*parse.TextNode][]uint8*map[*reflect.structType]int*map[[8]uint8]chan struct {}*map[ghw.Architecture]string*map[int64]*channelz.channel*map[plumbing.Hash]struct {}*map[reflect.Type]*gob.decOp*map[reflect.Type]*gob.encOp*map[reflect.Type]gob.typeId*map[reflect.Value]struct {}*map[string]*redis.fieldSpec*map[string]*tls.Certificate*map[string]*trace.spanStore*map[string]*view.measureRef*map[string][]*cobra.Command*map[string]balancer.Builder*map[string]endpoints.Region*map[string]map[int32]string*map[string]map[string]int32*map[string]resolver.Builder*map[string]ssh.kexAlgorithm*map[string]syntax.charGroup*map[string]template.context*map[string]template.element*map[uint32][]*runtime._type*map[view.Exporter]struct {}*mapstructure.DecodeHookFunc*mongo.DatabaseSpecification*multipart.sectionReadCloser*multipart.stickyErrorReader*opentracing.StartSpanOption*opentracing.noopSpanContext*options.ChangeStreamOptions*properties.ErrorHandlerFunc*pubsub.ListSnapshotsRequest*pubsub.MessageStoragePolicy*pubsub.PublisherCallOptions*pubsub.PushConfig_OidcToken*pubsub.SeekRequest_Snapshot*pubsub.StreamingPullRequest*pubsub.SubscriptionIterator*pubsub.isSeekRequest_Target*pubsub.streamingPullRetryer*revision.ErrInvalidRevision*sqs.DeleteMessageBatchInput*sqs.GetQueueAttributesInput*sqs.SetQueueAttributesInput*ssh.globalRequestFailureMsg*ssh.globalRequestSuccessMsg*ssh_config.sshParserStateFn*swarm.NetworkAttachmentSpec*swarm.PortConfigPublishMode*syscall.NetlinkRouteRequest*timeseries.MinuteHourSeries*topology.ServerSubscription*transport.UploadPackSession*viper.defaultRemoteProvider*x509.InsecureAlgorithmError*x509.dsaAlgorithmParameters Addressesjson:",omitempty" Alternatebson:",omitempty"AttachToContainerNonBlockingAttributeUpdates type:"map"BackupSizeBytes type:"long"BackupSummaries type:"list" Backwardsbson:",omitempty"BatchGetItemPagesWithContext CanEnablejson:"can_enable" CapacityUnits type:"double" CaseFirstbson:",omitempty" CaseLevelbson:",omitempty"ChangeMessageVisibilityBatch Conditionjson:",omitempty"CreateGlobalTableWithContext CreatedAtbson:"created_at" CreatedAtjson:",omitempty" DNSConfigjson:",omitempty" DelaySecondstype:"integer"DescribeEndpointsWithContextDownloadArtefactsFromStorageGetAllowedPersistenceRegionsGetJavaGenerateEqualsAndHash InputStreamjson:"-" qs:"-"IsAdditionalHelpTopicCommand IsEnabledjson:"is_enabled" IsVirtualjson:"is_virtual" Isolationjson:",omitempty"Itemprotobuf:"group,1,rep"LastEvaluatedKey type:"map"LastMessageReceivedTimestamp LogDriverjson:",omitempty"MaxUploadBufferPerConnection NetworkIDjson:",omitempty" OpenStdinjson:",omitempty"PermitProhibitedCipherSuites Placementjson:",omitempty" Platformsjson:",omitempty" Projectiontype:"structure" PutRequesttype:"structure" ReceiptHandle type:"string"ReplicaSettings type:"list" Resourcesjson:",omitempty"ScalingPolicies type:"list" ScannedCounttype:"integer" ServiceIDjson:",omitempty"SetClientCertDecryptPasswordSetExpressionAttributeValuesSetPointInTimeRecoveryStatusSetReplicaBillingModeSummarySetSourceTableFeatureDetailsSetTableMaxReadCapacityUnits SizeBytesjson:",omitempty" StartedAtjson:",omitempty" Timestampjson:",omitempty" TrustRootjson:",omitempty"TypeSpecificData ssh:"rest"UpdateGlobalTableWithContext UpdatedAtjson:",omitempty"Usermapstructure:"db_user"addReferenceIfRefSpecMatchesapplyToReplicaSetWithPrimarycalculateRemoteHeadReferencecopyTrailersToHandlerRequestcreateHeadIfCorrectReferencedecodeCommandAndCapabilitiesfillEncodedObjectFromSymlinkgetCommitFromCheckoutOptionsrewritePackedRefsWhileLockedsecureRenegotiationSupportedshouldConfigureHTTP2ForServeshouldSendChunkedRequestBodysupportedSignatureAlgorithmsupdateRemoteReferenceStoragevalidateConflictCapabilitiesvalidateRequiredCapabilitieswatchKeyValueConfigOnChannel**connection.pooledConnection**viper.defaultRemoteProvider*<-chan *viper.RemoteResponse*[1048576]runtime.inlinedCall*[1]*[1024]*runtime.heapArena*[1]*options.AggregateOptions*[2]yaml.yaml_tag_directive_t*[8][]errcode.ErrorDescriptor*[8]auth.AuthenticatorFactory*[8]chan description.Topology*[8]internal.PerMethodSummary*[]*dynamodb.ConsumedCapacity*[]*dynamodb.KeySchemaElement*[]*options.CollectionOptions*[]*options.InsertManyOptions*[]*sqs.BatchResultErrorEntry*[]*sqs.MessageAttributeValue*[][2]bidirule.ruleTransition*[]bsoncodec.fieldDescription*[]chan<- singleflight.Result*[]description.ServerSelector*[]map[http.http2Flags]string*[]pkix.AttributeTypeAndValue*agent.agentRemoveIdentityMsg*archive.tarWhiteoutConverter*binarylog.methodLoggerConfig*descriptor.FileDescriptorSet*descriptor.GeneratedCodeInfo*docker.AuthConfigurations119*docker.ListContainersOptions*docker.createNetworkResponse*dynamodb.AttributeDefinition*dynamodb.BatchWriteItemInput*dynamodb.CreateReplicaAction*dynamodb.DeleteReplicaAction*dynamodb.DescribeBackupInput*dynamodb.DescribeLimitsInput*dynamodb.DescribeTableOutput*dynamodb.LocalSecondaryIndex*dynamodb.StreamSpecification*dynamodb.UntagResourceOutput*filesystem.lazyPackfilesIter*func() (*index.Index, error)*func() (*net.TCPConn, error)*func() (*object.Blob, error)*func() (*object.File, error)*func() (*object.Tree, error)*func() (*ssh.Session, error)*func() ([]*agent.Key, error)*func() ([]ssh.Signer, error)*func() (crr.Endpoint, error)*func() (driver.Value, error)*func() (int64, big.Accuracy)*func() (interface {}, error)*func() (reflect.Value, bool)*func() (runtime.Frame, bool)*func() (time.Duration, bool)*func() *connection.TLSConfig*func() *elliptic.CurveParams*func() *field_mask.FieldMask*func() *pubsub.PubsubMessage*func() *reflect.uncommonType*func() *setting.BrokerConfig*func() func(...interface {})*func() http.http2FrameHeader*func() opentracing.LogRecord*func() packet.CipherFunction*func() timeseries.Observable*func(*agenttasks.Task) error*func(*git.PullOptions) error*func(*git.PushOptions) error*func(*hpack.Encoder, uint32)*func(*logging.Record) string*func(*properties.Properties)*func(*request.Request) error*func(*tasks.Signature) error*func(*x509.Certificate) bool*func(...http2.Setting) error*func(...interface {}) string*func([]string) toml.Position*func([]string, interface {})*func([]uint8, []int) []uint8*func([]uint8, int) [][]uint8*func(agenttasks.Instruction)*func(aws.Logger) *aws.Config*func(chan amqp.Confirmation)*func(docker.APIVersion) bool*func(func() *http.Transport)*func(func(*request.Request))*func(func(*tasks.Signature))*func(func(*token.File) bool)*func(git.PruneOptions) error*func(httptrace.DNSStartInfo)*func(int, int) reflect.Value*func(int, interface {}) bool*func(int32) *base64.Encoding*func(opentracing.Span, bool)*func(plumbing.EncodedObject)*func(string) ([]bool, error)*func(string) ([]uint, error)*func(string) (net.IP, error)*func(string) (string, error)*func(string) (uint16, error)*func(string) (uint32, error)*func(string) (uint64, error)*func(string) *common.Profile*func(string) *config.Section*func(string) *git.FileStatus*func(string) norm.Properties*func(string, *user.Identity)*func(string, []string) error*func(string, int) [][]string*func(string, int, int) error*func(tag.Key) (string, bool)*func(token.Position, string)*func(transport.GoAwayReason)*func(uint32, []uint8) uint32*func(uint8) ([]uint8, error)*func(uintptr, uintptr) error*grpc.StreamClientInterceptor*http.http2clientConnReadLoop*http.http2erringRoundTripper*index.endOfIndexEntryDecoder*interface { Timeout() bool }*internal.BucketConfiguration*map.bucket[*trace.trace]bool*map.bucket[clog.LEVEL]string*map.bucket[ini.TokenType]int*map.bucket[int]toml.sortNode*map.bucket[reflect.Type]bool*map.bucket[string]*flag.Flag*map.bucket[string]*yaml.node*map.bucket[string]billy.File*map.bucket[string]codes.Code*map.bucket[tar.Format]string*map.bucket[uint8]*pflag.Flag*map.hdr[*http.conn]struct {}*map.hdr[http2.SettingID]bool*map.hdr[string]*trace.family*map.hdr[string]http.muxEntry*map.hdr[string]plumbing.Hash*map.hdr[string]reflect.Value*map.hdr[string]toml.sortNode*map.hdr[uint16]*amqp.Channel*map.iter[int32]*trace.bucket*map.iter[interface {}]string*map.iter[string]interface {}*map[*grpc.addrConn]struct {}*map[*reflect.structType]bool*map[codes.Code]http2.ErrCode*map[gob.typeId]*gob.wireType*map[http.http2ErrCode]string*map[http.http2SettingID]bool*map[http2.ErrCode]codes.Code*map[interface {}]*sync.entry*map[plumbing.ObjectType]bool*map[reflect.Kind]gcfg.setter*map[reflect.Type]gcfg.setter*map[reflect.Type]gob.gobType*map[string]*config.Submodule*map[string]*docker.IndexInfo*map[string]*object.TreeEntry*map[string]*openpgp.Identity*map[string]endpoints.Service*map[string]grpc.MethodConfig*map[string]http.RoundTripper*map[string]map[string]string*map[uint32]*http.http2stream*map[uint32]*transport.Stream*map[uint64]amqp.Confirmation*object.commitIteratorByCTime*opentracing.StartSpanOptions*opentracing.registeredTracer*options.CreateIndexesOptions*options.ListDatabasesOptions*packet.SymmetricKeyEncrypted*packp.ReferenceUpdateRequest*proto.XXX_InternalExtensions*pubsub.CreateSnapshotRequest*pubsub.DeleteSnapshotRequest*pubsub.ListSnapshotsResponse*pubsub.PushConfig_OidcToken_*pubsub.StreamingPullResponse*pubsub.SubscriberCallOptions*pubsub.UpdateSnapshotRequest*registry.DistributionInspect*sqs.DeleteMessageBatchOutput*sqs.GetQueueAttributesOutput*sqs.SetQueueAttributesOutput*ssh.channelRequestFailureMsg*ssh.channelRequestSuccessMsg*storer.bareReferenceIterator*storer.referenceFilteredIter*strings.singleStringReplacer*swarm.RestartPolicyCondition*syscall.RawSockaddrLinklayer*transport.ReceivePackSession*viper.UnsupportedConfigError*x509.CertificateInvalidError*x509.pkcs1AdditionalRSAPrimeActorjson:"actor,omitempty"ApiKeymapstructure:"apikey" AppSubURLmapstructure:"url" Attachablejson:",omitempty"Brokermapstructure:"broker" ConfigFromjson:",omitempty"ConsumedCapacity type:"list" Containersjson:"Containers" CpusetCpusjson:"CpusetCpus" CpusetMemsjson:"CpusetMems"CredentialsChainVerboseErrorsDatassh:"rest" sshtype:"81"Datassh:"rest" sshtype:"82"DeleteMessageBatchWithContextDescribeTimeToLiveWithContext Dispatcherjson:",omitempty" DriverOptsjson:",omitempty"Emailjson:"email,omitempty" EnableIPv6json:"EnableIPv6"ExclusiveStartKey type:"map"GetQueueAttributesWithContextGlobalTableArn type:"string"HTTPPortmapstructure:"port" HTTPSProxyjson:"HttpsProxy"Hostsbson:"hosts,omitempty"ItemCollectionKey type:"map"KMSMasterKeyId type:"string"Limitmin:"1" type:"integer"ListTagsOfResourceWithContextMastermapstructure:"master" MemorySwapjson:"MemorySwap"MessageGroupId type:"string"Nameform:"name" json:"name"Namejson:"name" form:"name" NetworkModeqs:"networkmode" OutputStreamjson:"-" qs:"-"Passjson:"pass" form:"pass"Pathjson:"path" form:"path" PluginSpecjson:",omitempty" PortStatusjson:",omitempty" Privilegesjson:",omitempty"Queuesmapstructure:"queues"Reasonasn1:"optional,tag:1" Replicatedjson:",omitempty"ReplicationGroup type:"list"RestoreTableFromBackupRequestS3DisableContentMD5Validation SecurityOptqs:"securityopt"SequenceNumber type:"string"SetAllowedMaxDynamicTableSizeSetEarliestRestorableDateTimeSetPointInTimeRecoveryEnabledSetQueueAttributesWithContextSetTableMaxWriteCapacityUnits SharedSizejson:"SharedSize" SizeOnDiskbson:"sizeOnDisk"SourceTableArn type:"string"Startjson:"start,omitempty" StopSignaljson:",omitempty" StreamEnabledtype:"boolean" TargetPortjson:",omitempty" Templatingjson:",omitempty"Totaljson:"total,omitempty"TransactWriteItemsWithContextTypejson:"type" form:"type"Unitsjson:"units,omitempty"Userjson:"user" form:"user" VirtualIPsjson:",omitempty"WithDisableEndpointHostPrefixdecodeElemsFromDocumentReaderencodedObjectSizeFromPackfileencodedObjectSizeFromUnpackedstartGracefulShutdownInternalupdateRSWithPrimaryFromMember**dynamodb.AttributeDefinition**dynamodb.LocalSecondaryIndex**pubsub.ListSnapshotsResponse**pubsub.StreamingPullResponse*[1]chan<- singleflight.Result*[1]pkix.AttributeTypeAndValue*[2]description.ServerSelector*[6][2]bidirule.ruleTransition*[8]*sqs.MessageAttributeValue*[8]bsoncodec.fieldDescription*[8]map[http.http2Flags]string*[]*connection.commandMetadata*[]*descriptor.DescriptorProto*[]*dynamodb.KeysAndAttributes*[]*dynamodb.TransactWriteItem*[]*options.DropIndexesOptions*[]*options.ListIndexesOptions*[]*options.TransactionOptions*[]func(*grpc.csAttempt) error*[]http.http2FrameWriteRequest*[]internal.ErrorBucketSummary*[]jwalterweatherman.Threshold*[]mapstructure.DecodeHookFunc*[]mongo.DatabaseSpecification*[]opentracing.StartSpanOption*agenttasks.DefaultInstruction*annotations.CustomHttpPattern*auth.MongoDBX509Authenticator*base64.newlineFilteringReader*bcrypt.HashVersionTooNewError*bcrypt.InvalidHashPrefixError*bsoncodec.StructTagParserFunc*bsonrw.ExtJSONValueWriterPool*bzip2.huffmanSymbolLengthPair*channelz.ServerInternalMetric*channelz.SocketInternalMetric*context.deadlineExceededError*credentials.PerRPCCredentials*description.compositeSelector*descriptor.FieldOptions_CType*diffmatchpatch.DiffMatchPatch*docker.CommitContainerOptions*docker.ConfigurePluginOptions*docker.CreateContainerOptions*docker.ExportContainerOptions*docker.PruneContainersOptions*docker.PruneContainersResults*docker.RemoveContainerOptions*docker.RenameContainerOptions*docker.UpdateContainerOptions*dynamodb.AttributeValueUpdate*dynamodb.BatchWriteItemOutput*dynamodb.DescribeBackupOutput*dynamodb.DescribeLimitsOutput*dynamodb.GlobalSecondaryIndex*endpoints.UnknownServiceError*errors.UnknownPacketTypeError*func() (*amqp.Channel, error)*func() (*git.Worktree, error)*func() (*net.UnixConn, error)*func() (*object.Patch, error)*func() (*pubsub.Topic, error)*func() ([]*git.Remote, error)*func() ([]noder.Noder, error)*func() ([]uint8, bool, error)*func() (bson.RawValue, error)*func() (diff.File, diff.File)*func() (int, time.Month, int)*func() (io.ReadCloser, error)*func() (object.Object, error)*func() (packet.Packet, error)*func() (plumbing.Hash, error)*func() (result.Delete, error)*func() (result.Insert, error)*func() (result.Update, error)*func() (string, string, bool)*func() (uint32, uint32, bool)*func() (uint64, big.Accuracy)*func() (uint8, []uint8, bool)*func() *channelz.channelTrace*func() *setting.GeneralConfig*func() *setting.StorageConfig*func() []*pubsub.Subscription*func() []proto.ExtensionRange*func() packet.CompressionAlgo*func() plumbing.EncodedObject*func() plumbing.ReferenceName*func() plumbing.ReferenceType*func() transport.GoAwayReason*func(*[]uint8, asn1.Tag) bool*func(*big.Int, *big.Int) bool*func(*big.Int, uint) *big.Int*func(*bzip2.bitReader) uint16*func(*cryptobyte.String) bool*func(*git.CleanOptions) error*func(*git.FetchOptions) error*func(*git.RepackConfig) error*func(*git.ResetOptions) error*func(*macaron.Context, error)*func(*packet.Signature) error*func(*regexp.Regexp, int) int*func(*sha512.digest, []uint8)*func(*url.URL) []*http.Cookie*func(*x509.Certificate) error*func(...request.WaiterOption)*func(...string) bson.RawValue*func([]uint8) agenttasks.Plan*func([]uint8) agenttasks.Task*func([]uint8) norm.Properties*func([]uint8, string) []uint8*func(bsonrw.ValueWriter) bool*func(chan string) chan string*func(color.Color) color.Color*func(func(hpack.HeaderField))*func(func(int, interface {}))*func(hpack.HeaderField) error*func(http.http2Setting) error*func(image.Point) image.Point*func(int) reflect.StructField*func(int, error) (int, error)*func(int, int, int) time.Time*func(int64) stats.Measurement*func(interface {}, bool) bool*func(interface {}, int) error*func(io.Reader) *bufio.Reader*func(io.Reader, string) error*func(io.Writer) *bufio.Writer*func(jsonmessage.JSONMessage)*func(map[string]interface {})*func(metricdata.ValueVisitor)*func(metricproducer.Producer)*func(packfile.Observer) error*func(request.ErrInvalidParam)*func(string) (*big.Rat, bool)*func(string) ([]uint8, error)*func(string) (float32, error)*func(string) (float64, error)*func(string) *dynamodb.Delete*func(string) *dynamodb.Update*func(string) *pubsub.Snapshot*func(string) opentracing.Span*func(string, ...interface {})*func(string, ...string) error*func(string, bool, time.Time)*func(string, float64) float64*func(string, string) []string*func(string, string, int) int*func(time.Duration) time.Time*func(time.Time) *logrus.Entry*func(time.Time) time.Duration*func(uint16) tls.keyAgreement*grpc.MaxRecvMsgSizeCallOption*grpc.MaxSendMsgSizeCallOption*grpc.connectivityStateManager*http.http2clientConnIdleState*http.http2responseWriterState*http.http2serverInternalState*http.tlsHandshakeTimeoutError*iam.TestIamPermissionsRequest*interface { String() string }*internal.LatencyBucketSummary*jwalterweatherman.LogListener*map.bucket[*gob.typeInfo]bool*map.bucket[*http.Request]uint*map.bucket[ghw.BusType]string*map.bucket[http2.Flags]string*map.bucket[int64]interface {}*map.bucket[plumbing.Hash]bool*map.bucket[reflect.visit]bool*map.bucket[string]*git.Remote*map.bucket[string]*index.node*map.bucket[string]*parse.Tree*map.bucket[string]crypto.Hash*map.hdr[*trace.Span]struct {}*map.hdr[gob.typeId]*gob.decOp*map.hdr[int32]proto.Extension*map.hdr[interface {}][]string*map.hdr[string]*config.Branch*map.hdr[string][]*http.Cookie*map.hdr[string][]interface {}*map.hdr[string]common.Profile*map.iter[*http.conn]struct {}*map.iter[string]*trace.family*map.iter[string]http.muxEntry*map.iter[string]plumbing.Hash*map.iter[string]reflect.Value*map.iter[uint16]*amqp.Channel*map[*http.Request]func(error)*map[bsonrw.jsonTokenType]bool*map[dnsmessage.section]string*map[http.connectMethodKey]int*map[index.Stage]plumbing.Hash*map[int64]plumbing.ObjectType*map[interface {}]interface {}*map[reflect.Type][]yaml.field*map[string]*dynamodb.Capacity*map[string]*singleflight.call*map[string]*ssh_config.Config*map[string]*template.Template*map[string]*trace.eventFamily*map[string]*view.viewInternal*map[string][]*xmlutil.XMLNode*map[string]docker.PortMapping*map[string]endpoints.Endpoint*opentracing.SpanReferenceType*packet.SymmetricallyEncrypted*packet.signatureSubpacketType*pubsub.GetSubscriptionRequest*pubsub.SnapshotConfigIterator*runtime.neverCallThisFunction*storer.MultiEncodedObjectIter*swarm.DiscreteGenericResource*swarm.NetworkAttachmentConfig*viper.ConfigFileNotFoundError*x509.ConstraintViolationError*yaml.yaml_version_directive_tApiKeymapstructure:"api_key" BindOptionsjson:",omitempty"ChangeMessageVisibilityRequest CompletedAtjson:",omitempty" Consistencyjson:",omitempty"ConsistentReadtype:"boolean" Constraintsjson:",omitempty"DBPathmapstructure:"db_path"Delayedjson:"eta" form:"eta"DescribeGlobalTableWithContext Descriptionjson:",omitempty"DisableRestProtocolURICleaningDisableScaleIntype:"boolean"DownloadArtefactsFromNamespace DriverStatejson:",omitempty" ExternalCAsjson:",omitempty" ForceRotatejson:",omitempty" Healthcheckjson:",omitempty" IPAMOptionsjson:",omitempty" IPv4Addressjson:",omitempty" IPv6Addressjson:",omitempty" IPv6Enabledjson:",omitempty"KMSMasterKeyArn type:"string" KeySchemamin:"1" type:"list" MacAddressjson:"mac_address" MaxAttemptsjson:",omitempty" MaxReplicasjson:",omitempty" MaxVariablebson:",omitempty" MemoryBytesjson:",omitempty" Nameserversjson:",omitempty" Preferencesjson:",omitempty" Propagationjson:",omitempty" PublishModejson:",omitempty"QueueNamePrefix type:"string"ReadCapacityUnits type:"long" Responsesmin:"1" type:"list" RetryAfterjson:"retry_after"SSLClientCertificateKeyFileSetSetAccountMaxReadCapacityUnitsSetGlobalSecondaryIndexUpdatesSetReturnItemCollectionMetrics StartPeriodjson:",omitempty"TLSKeymapstructure:"tls_key"UpdateContinuousBackupsRequestXXX_NoUnkeyedLiteraljson:"-"doGetHostWithPortFromSSHConfigfallbackToDefaultServiceConfigfilterProjectionWithReflectiononceSetNextProtoDefaults_Serve**dynamodb.GlobalSecondaryIndex**yaml.yaml_version_directive_t*[2]mapstructure.DecodeHookFunc*[2]opentracing.StartSpanOption*[3]opentracing.StartSpanOption*[8]*connection.commandMetadata*[8]*dynamodb.KeysAndAttributes*[8]jwalterweatherman.Threshold*[]*bsoncodec.structDescription*[]*connection.pooledConnection*[]*dynamodb.ReplicaDescription*[]*options.ChangeStreamOptions*[]*viper.defaultRemoteProvider*[]func(...interface {}) string*[]internal.BucketConfiguration*[]x509.pkcs1AdditionalRSAPrime*agent.identitiesAnswerAgentMsg*annotations.isHttpRule_Pattern*bsoncodec.DefaultValueDecoders*bsoncodec.DefaultValueEncoders*bsoncore.DocumentSequenceStyle*bsoncore.MalformedElementError*chan http.http2readFrameResult*channelz.ChannelInternalMetric*description.ServerSelectorFunc*descriptor.EnumDescriptorProto*descriptor.FieldOptions_JSType*descriptor.FileDescriptorProto*descriptor.UninterpretedOption*docker.ContainerAlreadyRunning*dynamodb.ItemCollectionMetrics*dynamodb.ListGlobalTablesInput*dynamodb.ProvisionedThroughput*dynamodb.ReplicaSettingsUpdate*dynamodb.TimeToLiveDescription*dynamodb.TransactGetItemsInput*dynamodb.UpdateTimeToLiveInput*elliptic.p224LargeFieldElement*endpoints.UnknownEndpointError*func() (*cobra.Command, error)*func() (*config.Config, error)*func() (*idxfile.Entry, error)*func() (*object.Commit, error)*func() (*packp.AdvRefs, error)*func() ([]uint8, uint8, error)*func() (bsoncore.Value, error)*func() (float32, big.Accuracy)*func() (float64, big.Accuracy)*func() (git.Submodules, error)*func() (io.WriteCloser, error)*func() (multipart.File, error)*func() (string, string, error)*func() (uint32, uint32, error)*func() *descriptor.EnumOptions*func() *descriptor.FileOptions*func() *setting.DatabaseConfig*func() []*annotations.HttpRule*func() []*pubsub.PubsubMessage*func() []capability.Capability*func() errcode.ErrorDescriptor*func() iam.BindingDelta_Action*func() map[string]interface {}*func() opentracing.SpanContext*func() wiremessage.SectionType*func(*cobra.Command, []string)*func(*http.Client) *aws.Config*func(*index.ResolveUndo) error*func(*json.scanner, uint8) int*func(*metricdata.Distribution)*func(*norm.reorderBuffer) bool*func(*plumbing.Reference) bool*func(*scanner.Scanner, string)*func(*time.Location) time.Time*func(*transport.Stream, error)*func(*url.URL, []*http.Cookie)*func(...string) bsoncore.Value*func([]uint8) ([]uint8, error)*func([]uint8) cipher.BlockMode*func([]uint8, []uint8) []uint8*func([]uint8, int) [][][]uint8*func(amqp.properties, []uint8)*func(binarylog.LogEntryConfig)*func(bool) *dynamodb.ScanInput*func(bsonrw.ValueReader) error*func(bsonrw.ValueWriter) error*func(docker.LogsOptions) error*func(func(uintptr) bool) error*func(int) (int, string, error)*func(int) (interface {}, bool)*func(int, int, [4]uint8) error*func(int64) *dynamodb.Endpoint*func(io.Reader) (int64, error)*func(io.Reader, []uint8) error*func(io.Writer) (int64, error)*func(io.Writer) io.WriteCloser*func(io.Writer, []uint8) error*func(map[string]string) string*func(metadata.MD) interface {}*func(net.Conn, http.ConnState)*func(opentracing.Span, string)*func(primitive.DBPointer) bool*func(primitive.ObjectID) error*func(primitive.Timestamp) bool*func(string) (*url.URL, error)*func(string) ([]net.IP, error)*func(string) ([]string, error)*func(string) *dynamodb.Replica*func(string) []*trace.SpanData*func(string) grpc.MethodConfig*func(string) map[string]string*func(string, ...string) string*func(string, bool, bool) error*func(string, int, string) *int*func(token.Pos) token.Position*func(uint64, bool, bool) error*func(viper.FlagValueSet) error*grpc_binarylog_v1.Address_Type*grpc_binarylog_v1.ClientHeader*grpc_binarylog_v1.GrpcLogEntry*grpc_binarylog_v1.ServerHeader*http.http2headerFieldNameError*http.http2noDialClientConnPool*http.http2noDialH2RoundTripper*http.http2randomWriteScheduler*iam.TestIamPermissionsResponse*idxfile.idxfileEntryOffsetIter*interface { Temporary() bool }*internal.FlushAfterChunkWriter*map.bucket[crypto.Hash][]uint8*map.bucket[int32]*trace.bucket*map.bucket[int64]*list.Element*map.bucket[int64]plumbing.Hash*map.bucket[interface {}]string*map.bucket[plumbing.Hash]int64*map.bucket[reflect.Type]string*map.bucket[string]*object.Tree*map.bucket[string]*ssh.macMode*map.bucket[string]interface {}*map.bucket[string]reflect.Type*map.bucket[string]schema.Route*map.bucket[uint8]gotty.stacker*map.bucket[view.AggType]string*map.hdr[gob.typeId]gob.gobType*map.hdr[int64]*channelz.server*map.hdr[interface {}]struct {}*map.hdr[string]*git.FileStatus*map.hdr[string]*trace.traceSet*map.hdr[string]agenttasks.Task*map.hdr[string]viper.FlagValue*map.hdr[tag.Key]tag.tagContent*map.iter[*trace.Span]struct {}*map.iter[int32]proto.Extension*map.iter[interface {}][]string*map.iter[string]*config.Branch*map.iter[string][]*http.Cookie*map.iter[string][]interface {}*map.iter[string]common.Profile*map[*parse.ActionNode][]string*map[*parse.TemplateNode]string*map[bsontype.Type]reflect.Type*map[capability.Capability]bool*map[context.canceler]struct {}*map[ghw.MemoryCacheType]string*map[gob.typeId]**gob.decEngine*map[hpack.pairNameValue]uint64*map[http.http2FrameType]string*map[http.http2SettingID]string*map[int32]*proto.ExtensionDesc*map[int64]*channelz.subChannel*map[int64]*packfile.objectInfo*map[interface {}]*list.Element*map[net.hostLookupOrder]string*map[reflect.Kind]gob.decHelper*map[reflect.Kind]gob.encHelper*map[reflect.Type]*gob.typeInfo*map[reflect.Type]reflect.Value*map[reflect.Type]types.IntMode*map[resolver.Address]struct {}*map[string]*dynamodb.Condition*map[string]*http.http2dialCall*map[string]*plumbing.Reference*map[string]*unicode.RangeTable*map[string]chan ssh.NewChannel*map[string]docker.NetworkStats*map[string]encoding.Compressor*map[string]knownhosts.KnownKey*map[string]transport.Transport*map[string]yaml.resolveMapItem*options.ListCollectionsOptions*passthrough.passthroughBuilder*pubsub.ModifyPushConfigRequest*revision.runeCategoryValidator*storer.EncodedObjectLookupIter*struct { F uintptr; s string }*struct { F uintptr; size int }*transport.incomingWindowUpdate*transport.outgoingWindowUpdateActionjson:"action,omitempty" Architecturejson:",omitempty" Attachmentsjson:"attachments"AttributeValueList type:"list"Authorjson:"author,omitempty" Availabilityjson:",omitempty" BackupDetailstype:"structure" BlkioWeightjson:"BlkioWeight" BrokerPassmapstructure:"pass" BrokerUsermapstructure:"user" CPUCfsQuotajson:"CpuCfsQuota" CgroupParentqs:"cgroupparent"Configjson:"config,omitempty"DBEnginemapstructure:"engine" DeleteRequesttype:"structure" Descriptionjson:"description" DesiredStatejson:",omitempty"Detailjson:"detail,omitempty" DriverConfigjson:",omitempty" EndpointSpecjson:",omitempty"FilterExpression type:"string"FullNameasn1:"optional,tag:0"Generalmapstructure:"general"GetFullyDecodeReservedExpansionGetNoStandardDescriptorAccessorHiddenbson:"hidden,omitempty"Keytype:"map" required:"true"LastLocalStreamCreatedTimestampLogFilemapstructure:"logfile"MD5OfMessageBody type:"string" ModifiedCountbson:"nModified" NonRecursivejson:",omitempty"Parentjson:"parent,omitempty" PreviousSpecjson:",omitempty" Reachabilityjson:",omitempty" RegionRegexjson:"regionRegex" RepoDigestsjson:"RepoDigests"RequestSpecificData ssh:"rest" Reservationsjson:",omitempty"SSLClientCertificateKeyPasswordScaleInCooldowntype:"integer"SetAccountMaxWriteCapacityUnitsSetContinuousBackupsDescriptionSetLastEvaluatedGlobalTableNameSetProvisionedReadCapacityUnits SigningCAKeyjson:",omitempty"Statusjson:"status,omitempty"Storagemapstructure:"storage"Streamjson:"stream,omitempty"Targetprotobuf_oneof:"target" TaskDefaultsjson:",omitempty" TaskTemplatejson:",omitempty" TmpfsOptionsjson:",omitempty"UniqueIdasn1:"optional,tag:1" UpdateConfigjson:",omitempty"UpdateExpression type:"string" UpdateStatusjson:",omitempty" VirtualSizejson:"VirtualSize"WaitTimeSecondstype:"integer"WaitUntilTableExistsWithContextWeightjson:"Weight,omitempty"WriteCapacityUnits type:"long" WriteErrorsbson:"writeErrors"interfaceArrayToAnnotationArrayprintLineOptionalCellSeparatorsprocessSettingInitialWindowSize **dynamodb.ReplicaSettingsUpdate **iam.TestIamPermissionsResponse *[5]func(...interface {}) string *[8]*bsoncodec.structDescription *[8]*connection.pooledConnection *[]*binarylog.methodLoggerConfig *[]*dynamodb.AttributeDefinition *[]*dynamodb.LocalSecondaryIndex *[]*options.CreateIndexesOptions *[]*options.ListDatabasesOptions *[]bzip2.huffmanSymbolLengthPair *[]credentials.PerRPCCredentials *[]internal.LatencyBucketSummary *[]jwalterweatherman.LogListener *[]map[bsonrw.jsonTokenType]bool *[]swarm.NetworkAttachmentConfig *agent.constrainLifetimeAgentMsg *bsoncodec.interfaceValueDecoder *bsoncodec.interfaceValueEncoder *bsoncore.InsufficientBytesError *chan *vagrantutil.CommandOutput *chan http.http2frameWriteResult *descriptor.FieldDescriptorProto *descriptor.OneofDescriptorProto *docker.AttachToContainerOptions *docker.CopyFromContainerOptions *docker.NetworkConnectionOptions *docker.NoSuchNetworkOrContainer *docker.UploadToContainerOptions *dynamodb.CreateGlobalTableInput *dynamodb.DescribeEndpointsInput *dynamodb.ExpectedAttributeValue *dynamodb.GlobalTableDescription *dynamodb.ListGlobalTablesOutput *dynamodb.TransactGetItemsOutput *dynamodb.UpdateGlobalTableInput *dynamodb.UpdateTimeToLiveOutput *edwards25519.CachedGroupElement *func() (*git.Repository, error) *func() (*multipart.Part, error) *func() (*object.TagIter, error) *func() (*session.Server, error) *func() ([]bson.RawValue, error) *func() ([]plumbing.Hash, error) *func() ([]reflect.Value, error) *func() (http.http2Frame, error) *func() (result.Distinct, error) *func() (result.IsMaster, error) *func() (string, []uint8, error) *func() (string, bson.Raw, bool) *func() (syscall.RawConn, error) *func() *descriptor.FieldOptions *func() *descriptor.OneofOptions *func() *pubsub.ExpirationPolicy *func() *readconcern.ReadConcern *func() credentials.ProtocolInfo *func() http.http2WriteScheduler *func() wiremessage.CompressorID *func(*[][]uint8) (int64, error) *func(*bsoncodec.Registry) error *func(*bufio.Reader, bool) error *func(*int, string, int, string) *func(*pflag.Flag, string) error *func(*plumbing.Reference) error *func(*pubsub.Topic) *iam.Handle *func(*result.WriteConcernError) *func(...string) *ast.ObjectList *func([]diffmatchpatch.Diff) int *func([]int) reflect.StructField *func([]resolver.Address, error) *func([]trace.Attribute, string) *func([]uint8, ...uint8) []uint8 *func(bool) *dynamodb.QueryInput *func(bool) *options.FindOptions *func(context.Context) io.Reader *func(diff.Operation, ...string) *func(dnsmessage.Question) error *func(docker.StatsOptions) error *func(float64) stats.Measurement *func(func(string, string) bool) *func(int64) *dynamodb.ScanInput *func(int64, int) (int64, error) *func(interface {}) (int, error) *func(interface {}) interface {} *func(io.Writer, ast.Node) error *func(opentracing.FinishOptions) *func(request.NamedHandler) bool *func(resolver.ResolveNowOption) *func(string) (*big.Float, bool) *func(string) (bsonx.Doc, error) *func(string) (http.File, error) *func(string) (io.Writer, error) *func(string) (net.IPNet, error) *func(string) *config.Subsection *func(string) *dynamodb.Endpoint *func(string) *sqs.TagQueueInput *func(string) *template.Template *func(string) agenttasks.Handler *func(string, *pflag.Flag) error *func(string, bool) (int, error) *func(string, http.RoundTripper) *func(string, iam.RoleName) bool *func(string, int) (bool, error) *func(string, os.FileMode) error *func(string, string, int) error *func(syscall.Sockaddr) net.Addr *func(view.AggregationData) bool *grpc_binarylog_v1.MetadataEntry *http.http2headerFieldValueError *http.http2headersOrContinuation *http.http2transportResponseBody *httptrace.clientEventContextKey *map.bucket[*http.conn]struct {} *map.bucket[ghw.DriveType]string *map.bucket[gob.typeId]gob.decOp *map.bucket[http2.ErrCode]string *map.bucket[http2.SettingID]bool *map.bucket[int32]unsafe.Pointer *map.bucket[jmespath.tokType]int *map.bucket[logging.Level]string *map.bucket[logging.level]string *map.bucket[string]*macaron.Leaf *map.bucket[string]*macaron.Tree *map.bucket[string]*trace.family *map.bucket[string]http.muxEntry *map.bucket[string]plumbing.Hash *map.bucket[string]proto.Message *map.bucket[string]reflect.Value *map.bucket[string]toml.sortNode *map.bucket[string]user.Identity *map.bucket[uint16]*amqp.Channel *map.bucket[unsafe.Pointer]int32 *map.hdr[*net.Listener]struct {} *map.hdr[*parse.TextNode][]uint8 *map.hdr[plumbing.Hash]struct {} *map.hdr[reflect.Type]*gob.decOp *map.hdr[reflect.Type]*gob.encOp *map.hdr[reflect.Type]gob.typeId *map.hdr[reflect.Value]struct {} *map.hdr[string]*trace.spanStore *map.hdr[string][]*cobra.Command *map.hdr[string]endpoints.region *map.hdr[string]template.context *map.hdr[uint32][]*runtime._type *map.hdr[view.Exporter]struct {} *map.iter[gob.typeId]gob.gobType *map.iter[int64]*channelz.server *map.iter[interface {}]struct {} *map.iter[string]*git.FileStatus *map.iter[string]*trace.traceSet *map.iter[string]agenttasks.Task *map.iter[string]viper.FlagValue *map.iter[tag.Key]tag.tagContent *map[interface {}][]interface {} *map[logging.Level]logging.Color *map[plumbing.Hash]*list.Element *map[plumbing.Hash]idxfile.Index *map[plumbing.ReferenceName]bool *map[reflect.Value]reflect.Value *map[runtime._typePair]struct {} *map[string]*config.RemoteConfig *map[string]*knownhosts.KnownKey *map[string]internal.CommandInfo *map[string]template.contentType *map[string]view.AggregationData *map[token.Pos]*ast.CommentGroup *map[uint32]*transport.outStream *mapstructure.DecodeHookFuncKind *mapstructure.DecodeHookFuncType *nettrace.LookupIPAltResolverKey *options.FindOneAndDeleteOptions *options.FindOneAndUpdateOptions *passthrough.passthroughResolver *pubsub.ListSubscriptionsRequest *pubsub.ModifyAckDeadlineRequest *sqs.SendMessageBatchResultEntry *ssh.forwardedStreamLocalPayload *struct { F uintptr; err error } *struct { F uintptr; is []int8 } *struct { F uintptr; pa string } *struct { F uintptr; ua string } *struct { clear bool; flag int } *struct { io.Reader; io.Closer } *swarm.ConfigReferenceFileTarget *swarm.SecretReferenceFileTarget *x509.UnhandledCriticalExtensionBindsjson:"binds" form:"binds" CRLIssuerasn1:"optional,tag:2"Chainjson:"chain" form:"chain"Chordjson:"chord" form:"chord"ConditionChecktype:"structure" ContainerIDjson:"container_id" ContainerSpecjson:",omitempty" DescribeContinuousBackupsRequestEmailjson:"email" form:"email" EngineVersionjson:",omitempty" FailureActionjson:",omitempty"Groupjson:"group" form:"group"Imagejson:"image" form:"image" IndexNamemin:"3" type:"string"Itemtype:"map" required:"true" LastRemoteStreamCreatedTimestampLatestStreamLabel type:"string" ManagerStatusjson:",omitempty"MaxIdlemapstructure:"max_idle"MongoDByamk:"-" ignored:"true" Normalizationbson:",omitempty" Orchestrationjson:",omitempty"Ownerjson:"owner" form:"owner"Prunejson:"prune" form:"prune" PublishedPortjson:",omitempty"Queuejson:"queue" form:"queue"ReadCapacityUnits type:"double" RestartPolicyjson:",omitempty"RestoreSummarytype:"structure" RestoreTableToPointInTimeRequestRetryjson:"retry" form:"retry"SSEDescriptiontype:"structure"ScaleOutCooldowntype:"integer"ScanIndexForwardtype:"boolean" SetExclusiveStartGlobalTableName SetProvisionedWriteCapacityUnits SigningCACertjson:",omitempty"SizeEstimateRangeGB type:"list"TLSCertmapstructure:"tls_cert" TableNamemin:"3" type:"string"Tasksjson:"tasks" form:"tasks" UpdateGlobalTableSettingsRequestValuejson:"value" form:"value" VolumeOptionsjson:",omitempty"XXX_InternalExtensionsjson:"-" fillMethodLoggerWithConfigString outFlowControlSizeRequestHandler H+6 d /W@JU 6 d /Mڼ6 d /VP\ߥe6 d /tA#6 d /! l6 d /s{ҿ6 d /'@q6 d /vb6'6 d /b@9D P6 d /x# 6 d /௷n?6 d /S?6 d /٭|6 d /Sr6 d /j 6 d /bm6 d /ZbÜagj6 d /@rw6 d /u`bcr6 d /T`ܪGb[6 d /Q6 d /Q@.%6 d /Ԓh6 d /Ħ6 d /`Xp6 d /Gt6 d /&5m&A6 d /@`S2_6 d />`p6 d /y6 d /U`W<&6 d / `X@6 d /E `Z6 d /K`[@ .6 d /Md oÖ6 d /6 d / FĪ6 d /[H6 d / iz"}6 d /V s~6 d /@!H6 d /k`(K6 d /c`76 d /T@ 6 d /M6 d /`+T6 d /0?o6 d /?e6 d /ȑ?6 d /Y6 d /lP@͝Z^Q6 d /8!6 d /I3 6 d /)՝ l6 d //6 d /S|6 d /A6 d /S`?846 d /6 d /? S6 d /ʍp2c6 d /S 6 d /yc6 d /PF!6 d /Lb  6 d / @D1 6 d /*To:6 d /Pn~,6 d /0`.B6 d /HAw6 d /NT`t G6 d /`T`\j6 d /`F6 d /r6 d /rT_F6 d /`'6 d /`igL6 d /@6}6 d /Sbt6 d /MzDBw6 d / U 6 d /w@u@6 d /QFu6 d /qL^6 d /\@t6 d /Rd{6 d /@%y)v6 d /b`Wΰr6 d /Z86 d /$LǕ6 d /6 d /Tô16 d /^QH_6 d /6 d /b>!6 d /T@aG6 d /tQƯ6 d /|@Icf[6 d /6 d /Tr,B6 d /QJJl6 d /b6 d /n;6 d /Tu6 d /UJI$6 d /Ql[6 d /3@tv6 d /%-Ҟtv6 d /%-@Ҟa6 d /b eɐ6 d /ƴu@6 d /Q>w6 d /dߞ[C6 d /`f}w6 d /Q@6 d /OǴ6 d /l9 q6 d /bl%@6 d /k96 d /@m6 d /pw6 d />@e;6 d /:lΤ6 d /`^G6 d / `(+6 d /0 ;6 d /hd`D6 d / [l$6 d /`gaS6 d / ȁ6 d /I`6 d /H 9^6 d /$c6 d /`Yu6 d / d4n6 d /`[z6 d /?"6 d /3`]G)6 d /PRN56 d /Vcr6 d /(%`d6 d /`O&z6 d /C6 d /rc |6 d /B%ӧ6 d /^6 d / M$N6 d /cz6 d /hyCh6 d /ck6 d /L`ܜ6 d /jS6 d /~ mQ6 d /[936 d /% +n6 d /c R?6 d /%I6 d /U wdm6 d /R`?6 d /%'/6 d /|?R6 d /% O6 d /c`/ Q6 d /%੡q16 d /ddP,6 d /ġ Yb6 d /%da6 d /dଡV6 d /%`2x6 d /uడy6 d /|dцK6 d /% k+K6 d /S"66 d /^ȋ6 d / ೡuޖ26 d /ൡ06 d / 손6 d /8ڜB6 d /WV \6 d / 6 d /J%xr6 d /dມ>?6 d /N@6 d /e༡p6 d /p6 d /1ཡP‹6 d /`wu6 d /0Q6 d /{࿡ 6 d /@ Ӱ6 d /`v6 d /|"6 d /Hv6 d /`¡>H6 d / á. 26 d /@e`áGF:6 d / ġ1g6 d /`ġ6 d /BSġ ]6 d / š56 d /YšD6 d /ǡb>6 d /a ȡl.!6 d /%`ȡ/0*6 d /`ȡ6 d / ɡH6 d /`ɡ~[6 d / ʡŘ6 d / ˡ1M6 d /&̡=@6 d /`͡(\6 d /0͡#6 d /͡p6 d /0Ρd6 d /,&Ρ ]6 d /ϡ6DV]6 d /e СW.Ε6 d /2e ѡ?Q6 d /9&ѡ6 d /-ҡu6 d /D ӡu6 d /D`ӡ;96 d / ԡ 6 d /S&ԡNh6 d /ԡ36 d /\e ֡Y{6 d /Xס06 d /jeס6 d /g`١ԜP6 d /l١[dp6 d /e ڡv`6 d /& ݡ: z6 d / ޡ&a ,6 d /ޡ|Y6 d /2ޡL:46 d / ߡFFw6 d /`ߡr6 d /SߡP6 d /x`a.6 d /Ax6 d /|y6 d /g2  *6 d /`oo6 d /6 d /xVT6 d /e c6 d /V|6 d /E6 d /X ۧ56 d /`s-q6 d /yP6 d / ;6 d / 6 d /DL6 d /  f<6 d /&`M6 d /ՑhC6 d /T a 6 d /Z`I /6 d /&`6 d /#Y6 d / %6 d /&X6 d / 6 d /.f `6 d /& b6 d /!6 d /]|6 d /D`6 d /Fg Co6 d /' 1T6 d /̔ [n6 d /(`!bJ6 d /V!if6 d /hU`#§6 d / $\6 d /v$Y6 d /'($H6 d /`%wJ 6 d /A(&6 d /g '(6 d /g' L6 d /(46 d /)Ϳ6 d /N()L6 d /1Z *#6 d /`*{6 d /h`,Ze$Q6 d /`-~L6 d /g-:6 d / 0o6 d /h(דN6 d /(z6 d /1_6 d /Ph 35#6 d /^h3ݬ6 d /zh4ɧ6 d /g5h6 d /( 6"9>M6 d /(`6hк6 d /6^6 d / _֜6 d /ߕ F6 d /\Y=W6 d / =W6 d /@#Sp6 d /+,r6 d / @7:)|6 d /5@Wjq6 d />C6 d /Q@Cd6 d /D,9F6 d /qFE֖6 d /hKh6 d /W@Mu6 d /MP76 d /h@Nc6 d /@O&6 d /@Pb6 d /hPQ">d6 d /RK;6 d /R6 d /@SL޻6 d /TA6 d /@U뙍6 d /@W~ 6 d /}@^KY6 d /+a{Ĝ6 d /@c_o6 d /0id@6 d /(eW6 d /f&6 d /WiY6 d / njM6 d /Go v6 d /-o6 d /I@p~6 d /]iqbI96 d /t x6 d /-uF#6 d /@v c6 d / zdaA.6 d /z0<6 d /{hA6 d /@{>6 d /{EL6 d /{p\6 d /| SX6 d /u|U6 d /|>N6 d /8(8a6 d /6 d /Ya\6 d /J6 d /Zk6 d /o36 d /6 d /7S6 d /i6 d /Z@x6 d /5@|؄6 d /EMr6 d /xDj6 d /@W: 6 d /ݗX6 d /x6 d /nPK6 d /$]46 d /[TY6 d /DB6 d /5u6 d /:3n6 d /p6 d /@ 6 d / ׌6 d /N s 6 d /Z6 d /6 d /͗6 d /"Ÿ/6 d /lş5+D6 d /4@Ɵ q6 d /R ƟG6 d /ǟ6 d /w˟86 d /ΟP[6 d /П1R6 d /*ҟ#Ybb6 d /@ҟ\~m#6 d /ҟ6 d /LY@ӟ[6 d /؟H!~6 d /Lٟ>y6 d /\ڟw!6 d /Ę۟XCX6 d /Pp6 d /9"v6 d /X@Źt6 d /6 d /;o6 d /]6 d /Ɵ_L6 d /d@%?6 d /pi6 d /N s 6 d /@KtJ6 d /DmFk)B6 d /`ڦb6 d /ڦ n6 d /q;G{?6 d /@.6 d /  <)U6 d /c{@6 d /|IJ6 d /)Mm6 d /Zafʝ6 d /;P6 d /@!+6 d /mN6 d /m@&G^6 d /%a6 d /8<^>6 d /\@306 d /9GP6 d /'6 d /+#6 d /k`<jz6 d /*<_Vqz6 d / {ۓ'6 d / ;*6 d /YKh6 d /B(>6 d /_g%6 d /?`6 d / nc6 d /$eP6 d /F;6 d /SnƱ6 d /6b`!z6 d / 6 d /C׭ʹ6 d /<`C{R)6 d /16 d /! f6 d /P`Io6 d /C5~6 d /&!6 d /t #6 d /zn6 d /8 Du46 d /`B6 d /j 6 d /Jv6 d / 'G6 d /\hg6 d /]ନ:'6 d /A<`Eo6 d /_}6 d /"_/j6 d /  56 d /Fd@ K6 d /8uF6 d /CG6 d /4_|͸6 d / ۦ߻6 d /|`ۦ:Re6 d / 6 d /FZ6 d / jߎ6 d / m "6 d / q6 d /-k!6 d /w =a6 d /@G &6 d /OSD 6 d /iS~6 d / `=aH6 d /ѯ=}76 d /L=*6 d /Y?)T6 d //`E6 d /5~6 d /xJ6 d /Zw[6 d /@E&6 d /5%6 d /ECh6 d /m >f$c6 d /-$ 6 d /``>PG6 d /y>%a(6 d /.>tA6 d /ro ?8{6 d /(y@ Y6 d /og6 d /  6 d /%g6 d /t3:6 d /T6 d / O6 d /* ҅Q6 d /]8@6 d /r8 oq6 d /#6 d /RLq6 d /`R.$6 d /R6 d /p =|6 d /T@w6 d />yI6 d /Ty!Q6 d /Ӹ`!6 d /`zX%6 d /.9_6 d / R6 d /}o6 d /gBf6 d /X !6 d /A _:6 d /\G6 d /`/T6 d / *9I6 d /`!6 d /F_l6 d /M?  .܌6 d /5[6 d /`?M6 d /l)?v&6 d /r6 d /rW6 d /PG)M76 d / Sg6 d /2 !cV6 d /4B=6 d /a௨b6 d /a@06 d /q"Ba6 d /"RA6 d /  R$6 d /}*6 d /  6 d /"6 d /"`"6 d /0 P6 d /*$e6 d /"`yP6 d /@M&O6 d /Zz6 d /PU6 d /,6 d /dvJ6 d /l` X6 d /``^6 d /86 d / 6 d /lIRB6 d /k`!t 6 d /+ n'=6 d /Sf6 d /oX:6 d //2a6 d /8 y&6 d /ਫ6 d /b-!yb6 d /Ѳ(:6 d /ನ\W6 d /@WMq6 d /o?6 d /o- )vH6 d /ܮX6 d /3uz56 d /_-6 d /k86 d /de @3 a6 d /I**6 d /kHr6 d / ! Q6 d /\`BV6 d /gBZ?\6 d /.!`=^6 d /_96 d /?! Kw6 d / G6 d /V*C*6 d /@46 d /P6 d /P!@/ނ6 d /c* u6 d /$6 d /@+g6 d /]C s6 d /@d:6 d / Y/6 d /+o 6 d /k96 d /* +m6 d /" &6 d /0`X6 d /Nl@!a6 d /&$*A6 d /7'6 d /YOvBx6 d /O wX6 d / x2;6 d /p6 d /MZ6 d /Y6 d /p zi6 d /jzQ6 d /V' R6 d /RJ`7x 6 d /` 6 d /*]yOZ6 d /#ѹ6 d /஫d6 d / 5?=56 d /^$ :6 d /9&6 d /k n 6 d /e.H6 d /@㶓6 d / @076 d /_g6 d /Ϟפ6 d /g+x?6 d /dj˜)6 d /g}඲N6 d /%&D6 d /^$$6 d /`Ӝ6 d /I6 d /i {E6 d /@ص]6 d / q6 d /< fICi6 d /@,mx6 d /aM6 d / ս6 d /,n6 d /Ʈ |6 d /ծ౫7A6 d /@6 d /%`8x^6 d /e6 d /5S &B]6 d / k(16 d /jޣ6 d /_`&L6 d /jc}=6 d /0@\46 d /1q6 d / ak6 d /`+6 d /N6 d /]`w6 d /IqH^6 d /  Qa16 d /J^#u6 d /M ΥT6 d /# |\=6 d /d @+6 d /d26 d //46 d /&`llX6 d /ࣩ{I@6 d /#l>96 d / e mZ46 d / 68l6 d /k ~26 d /@w"6 d /0|@6 d /h@,6 d /06 d /c6 d /`͕6 d /d/Y6 d /0 6 d /]Pศx?o6 d /8@ 6 d /`؆c6 d /'z6 d /X Om56 d /* Xٻ6 d /p ~f6 d /<~ 6 d /,B6 d /,03+6 d / ԛ6 d /`O4y6 d /,ܰ(6 d /m6 d /l e^6 d /{ Uʇ6 d /I6 d /J෫6 d /~5@N.6 d /k  *76 d /5PA6 d /16 d /" G6 d /γh!}6 d / (u6 d /< )6 d / />6 d /"6ĉ6 d / F@G6 d /Ѕ6 d /pt6 d /RL$6 d /T 6 d /R`6 d /l kC6 d /u`-/6 d /y~!6 d /pc6 d /P Q 6 d /)`b6 d /" շ_6 d /!`(6I56 d /d '16 d /5& 6 d /n`UK6 d /5 V2Z6 d /56 d /xຫZ6 d /;6 d /8UW6 d /n a8ݙ6 d /@&k6y6 d /E,{6 d /l$fa6 d /q#p6 d /) \6 d /5]el6 d /n`H,6 d /RV6 d /" ZGtF6 d /l B6 d /$l K6 d /`Y 6 d / $@6 d / Ѧ6 d /n\6 d /ɤG6 d /M]6 d /6l`6 d /ʆ,6 d /?z>6 d /E-: 6 d /')I6 d /঩f6 d / '+(=6 d / f6 d /u vbH6 d /@L6 d /`PLa6 d /#b6 d /. q6 d /O *ڷ6 d /Kl6 d /5zV{6 d /26 d / (6 d /# oF6 d /6 d / 6 d /V,q6 d /6ཫ66 d /&6 >6 d /nt6 d /W6 d /?@*`6 d /g,*36 d /n3d6 d /u1d6 d /HlV=6 d /A gE16 d /L 6 d /u@y"6 d /;6`_6 d /uS6 d /x,``&6 d /+$f'6 d / pE6 d /2.mr 6 d /(<%6 d /qU3t6 d /_@[6 d /5\6 d /`+6 d /Pj6 d / 5{6 d /@Qh6 d /Ǟ` Q6 d /^ i6 d /ವUc6 d /!«IU6 d /b੩K66 d /=?r6 d /!`«K6 d /b«$6 d /ڞ ë6 d /@S%6 d / k86 d /!L}6 d /b JJn6 d /ZQ*6 d / ٶz6 d /[6 d /`0gx 6 d /*o`X26 d /4 ?f6 d / 7t6 d /=[F?6 d /ѳ'r6 d /`³6 d /}wl6 d /5 ry6 d /و6 d /S un|6 d //  76 d /@ *`-6 d /4ë̗Q6 d /@ ȭ6 d /Eo?6 d /!@6 d /1 96 d /qWt6 d /q2v6 d /ڵ!6 d /@īuu6 d /Q `Ά 6 d /W~6 d /b YY916 d /ɜ /6 d /^[ ޼6 d / 96 d / d6 d /būQk6 d /b  d6 d /c Oe6 d /,!>6 d / "^6 d /#6 d /""  \6 d /(c 6 d /p`IRY?6 d /C  Nw6 d />cy6 d /ZY56 d / Rc.*6 d / ު6 d /`o`ūr4W6 d /SL6 d /{oūO6 d /q ƫ6 d /r 456 d /ƫ-OC6 d /=ƫzp6 d /7@衍,6 d /Ҵ @ǫ<6 d / ͆}6 d /oǫ>c6 d /ZȫN6 d /`ȫ6 d /oȫ'6 d /w ɫ޿6 d /o(6 d /,ɫI6 d /TcڵTS6 d /@,Lx6 d /JE6 d /^Zl6 d /W E~r6 d /m6 d /jc 6 d / S+6 d /o+_6 d /v"W6 d /۵yE6 d / u6 d /@ S6 d />@ͫK|6 d /c >6 d /6 d /`ʯ:6 d //>x A6 d / ̌6 d /"ͫƘS86 d /c>!6 d /cΫiޑ6 d /c@nuD6 d /[`Ϋ 6 d /[ΫS|a6 d / ϫžX6 d /ϫx&6 d /ϫI 6 d /&r6 d /@Ы -G6 d /ЫD6 d /paE6 d /pt6 d /9ѫ+6 d /`ѫMSs6 d /[ 6=6 d / 6 d /U6 d /% 6 d /Cѫ]n6 d / ҫb6 d /aFf6 d /[ ۰J6 d /xҫnT6 d /s ҫ_6 d /^@ӫdZ6 d /p^6 d /  bK6 d /8pSg6 d /xs6 d / `L6 d /T 6 d /I>GV06 d /ӫg6 d /hԫև<6 d /   NQ6 d / ;HC6 d /\`6 d /qD6 d /͋H6 d /_6 d /% dƈ6 d / ir6 d / Hy:6 d /B`ԫr6 d / i#6 d /27`1z6 d /|d6 d /`W|6 d /)J#'6 d / ԫՄ46 d /`\y6 d /v_ܵχ[W6 d /S:t:+6 d /r6@K(FIk6 d /kիc6 d /6 d /իd6 d /pU"6 d /hk z6 d /XOm56 d /*\\6 d /֫!6 d /$}h6 d /໨xF6 d /(׫ڔ6 d / 6 d /t@×.6 d /U6 d //a-6 d /N׫E6 d / ثwz 6 d /ث(6 d /Nث҂6 d /٫*6 d /}͞6 d /Ȃ_<36 d /@`0D6 d /Q`66 d /;6 d / H|.6 d /é  X=6 d / ?q6 d /2 "~$6 d /pK=ސ6 d /Mb6 d /`ګ<6 d /pྨ<6 d /p@26 d /W/FK6 d /׬)Oz6 d / =6 d //vX=6 d /,';6 d /L6 d /\\6 d /۫!6 d /`$}h6 d /xF6 d /(۫ڔ6 d / U6 d // a-6 d /Nܫwz 6 d /ݫ(6 d /N`ݫ҂6 d /ݫ*6 d / }͞6 d /Ȃ`0D6 d /Q66 d /;6 d /`òH|.6 d /é  X=6 d /?q6 d /2@¨"~$6 d /p`L=ސ6 d /¨Mb6 d /ޫZ6 d /KèG6 d /m`è26 d /W/FK6 d /׬`*Oz6 d /=6 d //èvX=6 d /, Ĩ';6 d /L&36 d /Ĩ6 d /@߫En6 d /n26 d /5 H16 d /'+g6 d /aĨ6 d /\{<6 d /E@Ũ6 d /c ,6 d /e6 d /:z6 d /* \D6 d /0QDo6 d / MXD6 d /p`,?6 d /",,6 d /I( z6 d />a&/O6 d /Pa 26 d / :s6 d / f}6 d /% -56 d /  ?b6 d /<`6 d /#ƨ6 d /`ƨR%6 d /7`Odl\e6 d /(ͼ6 d / 6 d /(@7 6 d /`bX6 d /n%Ϟפ6 d /g+ƨ% 6 d /<@=q6 d /%x?6 d /d X]Z6 d /dIk6 d /  6 d /&6 d /bjg!6 d /`Ԕ|6 d /8p S=6 d /tr><؆6 d /Υ :6 d / &-IA6 d / ǨKe6 d /ǨS_6 d /!IH6 d /@vN6 d / m) 6 d /p . 6 d /6 d /0<6 d /6 d /٪@Q<_6 d /|e6 d / S6 d /i#`n6 d /Ze6 d / `6 d /`/fnu6 d /sjG$6 d / 0|6 d / Ps6 d /ʡ6 d /PHjb6 d /gh76 d /\ y6 d // 6 d /)6 d /6 d /x`ɨA6 d /`96 d />J#6 d /<`~36 d /rɨRg6 d / 6 d /6 d /0`{6 d /n gb6 d /'st6 d / O6 d /x)6 d /;R1r6 d /T@":6 d /6 d /  6 d / n16 d /Ś`66 d /i:V6 d /`hD6 d / p事6 d /i`R,%6 d /0 Z6 d /6l %]6 d /` 6 d /`_ ʨM+m6 d /P5"\6 d /@??6 d /C46 d / ?6 d /" @6 d /1&:շ6 d /3C^6 d /36 d /@ ˴6 d /OnAS6 d /23/66 d / \ʨt}6 d / ʨs6 d /x @˨c 16 d /L˨j_6 d /z̨ so6 d /`̨!u{6 d /βxp@6 d / ̨v6 d / SoP6 d /#; ͨĘM}6 d /=;ͨ6 d /aͨDV6 d /s@ΨN?6 d /4Ψd6 d /_6 d /z6 d /?  yb6 d /[v:}6 d /R`Ϩ߁6 d /h`S,6 d /~``ϨLڇV6 d /`Ϩ8M6 d /  Ш6 d / S[- 6 d /``B{6 d /``6 d /\éP'T6 d /  chs6 d /`D6 d /.\®ѥ6 d /@\ (#6 d /_ ХY6 d /}Y's|6 d /x6 d /@q^6 d /6a6 d /$6{6 d /g 7}k6 d /8t ݛ6 d /u`7R6 d /m{6 d /A( D/6 d /h î@6 d /i |`6 d /C@CNh6 d /LmШ]& 6 d /@ϲ6 d /?&îAEs6 d /m`éPw6 d /`-)6 d /gLé6 d /ĩ/6 d /%ϲ o6 d /*6 d / (\~6 d /@Ш+86 d /x,*s6 d /m`K6 d /T7}=L6 d /n^ 6 d /s6 d /L >(6 d /q@WAB$6 d /I(`N'N6 d /" Ž6 d /%Yw6 d /epi6 d /dj@Ѩ-6 d /z*6 d /56 d /dƮJqO6 d /"ѨX 6 d /G`6 d /_Ҩq/6 d /h`8M|6 d /y)$c6 d /36 d / 6 d /G.kE6 d /  /rz6 d /Ȯ%S-6 d /v6 d /* O6 d /`,_|6 d //`7 6 d /#&yz6 d /UѲqtx6 d /#` 6 d /;-6 d /y>m 6 d / CG6 d /  0G\'6 d / `ҨK_6 d /Ҩ ?H6 d /  FD6 d /Н8}6 d / B6 d /<';E6 d / Ө6 d / 6 d /Ӳ1t6 d / ̮6 d /(̮N6 d /? ʩ%6 d /q9T6 d / ͮ$6 d /(ͮ6 d /Rpd(6 d /r ή.&6 d /( ޝ6 d /Mʩ_g6 d /( |Mu6 d /(|6 d /%1ή(o6 d / cPT6 d /$``5 6 d /`q 6 d /TT9%6 d /wRj6 d /< 6 d /ˈ@nib6 d /B Ϯ]6 d / !@G:n6 d /RjϮi6 d /, Ю+Ji^6 d /3Lrf 6 d /9,p06 d /ɪʩla6 d /v6 d /v [6 d /6 ѮxZ/6 d /M8Z6 d /`6 d /N,Ѯma6 d /d Үi$q6 d /6m 1Q6 d /R"9<6 d /QS$6 d /@۟6 d /Q >](6 d /R`?v 6 d /{Ȝ6 d /lZ`ײ!6 d /Ț6 d /`k6 d /ߝ3+6 d /U6 d /^שwS6 d /R6ةhI6 d /`ة86 d /ةmD6 d / ٩.\6 d / ;6 d /fjZi?6 d /^HDd6 d /ز`kt6 d /(زK6 d / 6 d /k6 d / ?|6 d /yƫlL6 d /k6 d /y`׿6 d /e]6 d /٩36 d / ?$6 d /C@ 6 d /kը]M6 d /X!j6 d /{ڲ<6 d /'Iۉ6 d /A* ֨ f6 d / `X} 6 d /H6 d /$l J6 d / Q6 d /Vh6 d /֨Hf6 d /L#{,6 d /MUL6 d / 6 d /\߲q06 d /o YY6 d /a7 ׷6 d /o xPX 6 d /  6 d />֨`i6 d /`~[W6 d / o6 d /zP?6 d /#6 d /ly6 d /@Zߡ6 d /ډ6 d /C.y(7,6 d /`f ߔ6 d /& Nj6 d /`C밆6 d /`D76 d /Pͩ'6 d /R\@ 6 d /z@ר`6 d /ɬ6 d /sOw26 d /4~( 6 d / Kj6 d /y( ר6 d /'ب16 d /Z;"6 d /( I2)6 d /[w6 d /(`[ 6 d /`بM 6 d /( P6 d /)In36 d /j6 d /RB+6 d /  J]v6 d /j`Dc6 d /"[ 6 d /@,.j6 d /) \λ6 d /(b\6 d /# 96 d /0)Jk]+6 d /){=6 d /mGߩ6 d /6 d /X s6 d /& LR/6 d /4jb6 d /d6 d /}pz6 d /.Y6 d /ߩE6 d /GDk6 d /`j@Rvh6 d /^b"886 d /\)6 d /- Lv6 d /D\6 d /Ÿ@rz46 d /q<6 d /`رX6 d /H@3][6 d /بKI6 d /X@]zϷ6 d /F hh6 d /ٟ}n6 d /ݬ6 d /_ ٨km6 d / % ٨WM6 d /٨| 6 d /Lb _j@6 d /̜@ڨ|6 d / ڨL)}6 d /wZ^,8i6 d / N)&6 d /rLD6 d /F_ ~N6 d / h#46 d /@j`b6 d /uIۨ6 d /0`ۨI_6 d /ۨT6 d /E ܨjB6 d /ܨ46 d /[ _*6 d /6"6 d /ܨW6 d /z`6 d / <`Z16 d /  +Ȁ6 d /mhb6 d /%@ݨi#6 d /Z P k6 d / P4Q86 d / <+m+6 d /8ݨXǝ6 d /5Zy$6 d / :<6 d /˜6 d /lI6 d /m _Gw6 d /\@s6 d /'<l $6 d / `T56 d /7@'6 d /ӳmM6 d /Ͱ`No6 d /TU>E6 d /7 &6 d /@46 d /H!a6 d /ST`fpD6 d /Qd:6 d /ַ C6 d /#:6 d / RZ6 d /-$oh6 d /`Fb1a6 d /Kv:6 d /@$8w6 d /6x%u[/6 d /2 Ng6 d / 6 d /i@:F6 d /%c 6 d /`KZ6 d /n &6 d /7&6 d /!&mO6 d /o VBD6 d /x$`&6 d /=-6 d / \6 d /LFo/A6 d /e@'5A6 d /+'z 6 d /FXM6 d /S16 d /6 d /S Q6 d /_t66 d /( 6 d /g G 6 d /0_S6 d /h`( 6 d /, ?6 d /{(f86 d /ThT6 d /p@`i2h6 d /4) 86 d /+%$y6 d /k`6 d /@*=6 d /k"G6 d /1RGX6 d / Ue<946 d /a*y6 d /aU:l6 d /Vj6 d /^ Vu\6 d /n =!l6 d /j /u6 d /@tz X6 d /)`H6 d /++\6 d /`&o6 d /VE\6 d /`+ȥ56 d / @VA6 d / ,6 d / ?6 d /$ 56 d /`z6 d /+`aG6 d /F o6 d /@` j6 d /lj6 d / H&56 d /ݭg6 d / e`HH a6 d /H,6 d /eaE\6 d /.es6 d /@e"+g86 d /EJi6 d /7PY6 d /%. ^6 d /  V|bh6 d / Vߗd6 d /`]6 d /d`ި >6 d / b/6 d /)b 6 d /Hj@v@ji6 d /`dj6 d /u /@w6 d /[ި;'6 d /Q Wڏ~6 d /9 ߨ%g6 d /Lߨ\6 d /Ѓ6 d /ba ~_p6 d /sߢ'6 d /a X2Q6 d /L6 d /@6 d /T/6 d /h0xQ6 d /-"e?6 d /a E86 d /?` 926 d /Y-6 d /w6 d /ߨ5`6 d /*@Yr6 d /e06 d /xOS6 d /:1`[E6 d /AgI6 d /r  6 d /O1 2$6 d /2r(r6 d /Hr86 d /d12406 d /B2j@g6 d /\6 d /X I86 d /^rcY6 d /9 -k6 d /h ՞,*6 d /H4HpQ6 d /;NV[ 6 d /v\`6 d /@@3ֻ6 d /P3~6 d /];6 d /]4n6 d /Х!M6 d /Rkb!g6 d //* 5S6 d /n^5Gu6 d /^ҳ6 d /`k@chsp6 d / 6 d /s(@6 d /(tb6 d /<$ 6 d /*ci6 d /M$ WXQ6 d /V7D6 d /*|6 d /[I`7;6 d /` ,%6 d /l@9N6 d /E]a/6 d /@9C6 d />n @?6 d / -`:EW6 d /& d;6 d /\6 d /p d6 d /2dť6 d /`46 d /6 d /['&6 d /@? 6 d /\3&J 6 d /* `~6 d /`-[6 d /?=6 d /`6 d /`u@6 d /ծ@Z6 d /l ec%6 d /" TV.6 d /`@>WY6 d /KRW̘6 d /4,gVK6 d /ܵeG6 d /RKeC6 d /@f6 d /KA;z&6 d /f6 d /)Ar6 d /DBM6 d /]@wrx#P6 d /6 d /$>6 d /(j6 d /*@\W"]6 d /jCub6 d /+W6 d /k6ZD6 d /8e D:6 d /^Dd6 d /*gw =6 d /D f6 d /?i86 d /0 !aK6 d /JJ6 d / c' T6 d / dO[6 d /1/`z=6 d /E6 d /oôw6 d / %\6 d /o`jp6 d /F!66 d /|-(6 d /`F"26 d /0$FVp6 d /okt6 d /T u6 d /8`!ϸW6 d /$#6 d /v!:+6 d //`Pk6 d /!H6 d / U "X_6 d /`"@U6 d /`D16 d /'%"q6 d /@%F[6 d /ຳAr6 d /Y%"k6 d /y d6 d /u w6 d / #6 d /`#C 6 d /=UeC6 d /8#M$6 d / GK6 d /8fA6 d /iqG᭳6 d /K_K6 d /*y]6 d / fW6 d /ݦ >6 d /F`6 d / $W36 d /v`$6 d /0 v%P<6 d /D-$(A6 d /6$6 d / %_v6 d /m`%QM6 d /K%56 d /%?26 d /H &r;6 d /v g`y6 d /pCL6 d /4@HQ@M6 d /gѯZ6 d /6 d /+6 d /3+ ׊6 d /l"6 d /d h#z6 d /)6 d /8H"%6 d /,`&f6 d /<&&Xk6 d /E&&6 d /N '_6 d /q`'O6 d /'X6 d /*sp*6 d /(kIJ~6 d /"* N!6 d /F@Ŧ6 d / N7OW6 d /Nfh[6 d /,`NU16 d /l d6 d /q3ű3o6 d /xx'h6 d /66 d /$@36 d /c`gm)6 d /$ 6 d /* ֈ6 d /%g6 d /% h'46 d /~k Jq:~6 d /*%h's6 d / +`6 d /r=6 d /;%  6 d /L%'6 d /ch l6 d /+66 d /d@iּ}6 d /&+@%sf6 d /uk6 d /~#Kh6 d /BA6 d /j 6 d / `m6 d / u6 d /H 6 d /CE{6 d /p u 6 d / @#ό6 d /C6 d /  6 d / `k6 d /jDap6 d / 6 d /n Sd6 d / S6 d /й @6 d / kM6 d / C6 d / `636 d /7 ީA6 d / Hc;6 d /Xݡu6 d /8 }Hx6 d /2D@ Wo86 d / l:6 d / x_R6 d /ۈ` Y7+6 d /" Y 6 d / p{6 d / <516 d /  =i6 d /_ Z6 d /F çf6 d /' ^&f6 d /1 =6 d / r^6 d / @' 6 d /3 䴝~6 d /8 1S6 d /l`lw6 d /Flw6 d /F Z6 d /3 6 d /^ 6 d /j@,n6 d /<y96 d / d6 d / `}6 d / ;6 d / F6 d / @'|6 d /^ Ҿ%6 d /L OK6 d /I `]6 d /RhC6 d /  6 d /wD{6 d /ِ 6 d /` k׍b6 d / @6 d /`,K6 d /0 Uh6 d / <6 d / .6 d / ~6 d / @X6 d /6 d /`؇i6 d /j\6 d / nj6 d /q 6 d / l~6 d /@6 d / M'6 d /- ' 6 d /`jI6 d / n@6 d /k 46 d /2C@!6 d /! !%6 d / "[6 d /P`"D~6 d /"@6 d / #i6 d /9k#?6 d / #6 d / $w6 d /nb`%؁6 d / % Y6 d /` &$X6 d /X &.ڣ6 d /x&| 6 d / @'N6 d / 'Y6 d / (N6 d / `(Y6 d / (~\6 d / )cb6 d /I)]56 d /ث@*]56 d /ث*O6 d /} ,9A6 d /Ȫ,{p6 d /@-|"6 d / - H8 6 d / .5r16 d / `.[6 d /  .6 d / / 6 d / /m֠A6 d / / 6 d /e@0s6 d /k`1;d6 d /}1-6 d / 2g?6 d /2#6 d /rC2*|D6 d /l3+6 d /i4te6 d /# `4ŭ6 d / 4cG6 d /; 5%6 d /5 5>y6 d /5{[ \6 d /g @6@6 d / 6(6 d /c7G۴"6 d /$ `7ST06 d /u 7DȞ6 d / 86 d / 88G6 d /y8 6 d /@9]6 d /0 9Q{6 d /$ :b|6 d /k `:Wnw6 d /:6 d /  ;Կ_6 d /V ;475~6 d /K ;Y f6 d / @<ڞ6 d / <K6 d / =T6 d / `= %H6 d /=]T6 d /& >r`6 d / >,6 d / >_6 d / @?/N6 d /?0o6 d /, @-6 d /X`@-_b6 d /Z @T!6 d /a% AQ/Y6 d /` A/N6 d /A0o6 d /, @B-6 d /XB-_b6 d /Z CT!6 d /a% `CQ/Y6 d /` C2p6 d /Ȣ D/ao6 d /E D\-6 d /% DE 6 d / @Er| 6 d /CEE6 d /5 Fh<6 d / `F[6 d / F[6 d / GfY6 d / G;{/6 d /B G$6 d /@H'@|6 d /H.6 d /g!Iӱa6 d /j`Ip36 d /4kIp36 d /4k J6 d / J[+26 d /J&6 d / @K6 d /B KB6 d /ZkLȓQ6 d /7 `L6Y6 d / Lȱ6 d / M6 d /CM  6 d / M:6 d /'@N !6 d / Nݼ>6 d / O:6 d /`O^6 d /Oq6 d / PbYo06 d /P6 d /n P6 d /% @Qu[z&6 d / Qo 6 d /& Ro 6 d /& `R}q6 d /h R/M6 d /H S<ҋ6 d / SLLC6 d / S26 d / @TlRB6 d / T崞6 d / U$C6 d / `UxV6 d /Uf6 d / V y6 d / Vv6 d /Vh6 d / @Wq6 d /Wއ6 d /TX.y6 d /w`Xq6 d / Xs6 d /{k Y]}î6 d / Y,F6 d /a Yq/6 d /\ @ZK6 d / Zth6 d /ɉ[P6 d / `[ fX6 d /k[6`B6 d /C \@=6 d /p \r6 d /  \}6 d /!@]+q6 d /% ]6 d / ^ {B6 d /1`^@=6 d /p ^U6 d /k _Dm6 d / _&6 d /_ٵ6 d / @`'{6 d /`!ݤC6 d / aocB6 d / `a6 d /O a436 d /D bڮ6 d /" b Xa6 d / b6 d /}@cQD&6 d /hc\6 d /yd(6 d / `dYR6 d /duu6 d /N e[E6 d /Je=6 d /8 er6 d /a @fS6 d /kfC6 d /}gN0R6 d /`g6 d /ag6 d / h6 d /' hNн6 d /lha6 d /Q@i|҄6 d /8 i O6 d /L jcj6 d / `j 6 d /` je6 d /r k_w6 d / k:6 d / kig/6 d / @l#V6 d /| lXy6 d /L mg6 d / `m16 d / m^$:6 d / nȼP6 d /nȼP6 d /nP,6 d / @oV16 d /=& o ]6 d /Ipt1gR6 d / `pV6 d / p+6 d /! qѡJo6 d / qq@6 d /# qE"M6 d / @r[e6 d / rt6 d / sڗnI6 d /F `s]V6 d /& sC6 d /D tj\6 d /ԬtP'6 d / t'C@6 d / @u 6 d / u\úe6 d /Cv46 d /`vS=6 d / vY6 d /@ wC/m6 d /. ww:6 d / w26 d /V @xdZ 6 d /| xɾ̜6 d /ysSw6 d /}`y 6 d / ~y6 d /$~ z6 d / z6 d / z6 d /@ @{(6 d /q {3%i6 d /|6 d / `|>@6 d / |н6 d /m }Mӹ6 d /}66 d //}Xט~6 d /&@~|6 d /0 ~te6 d /e^6 d /(`6 d /!'6 d / ٕ6 d /!n6 d /nI6 d /@! *X6 d /UGS6 d / 6 d /] `6 d /֣ 㨌6 d / 9:D6 d / ZU6 d / A6 d / @] 6 d /kJ6 d /`Ba6 d /J6 d /0 -6 d /R  6 d /n  6 d /n @c?6 d /էtQ;6 d /RD`9^6 d /sX6 d /Z~Ÿ6 d /u~5{X6 d /@6 d /#A6 d /i& r6 d / `M'6 d /- l6 d / %-6 d /kF6 d /  qf6 d /] b3Jc6 d /d`6 d /լG6 d /rD6 d / @yz6 d / [d6 d / v,;6 d /gC6 d /& `6 d /` 䰜6 d /@Gi06 d /& 0[6 d / '6 d / ;6 d /E' >6 d /: `MT'6 d /& n;!6 d /nkp`6 d / @iF6 d /yz6 d /%T6 d / Ŝ6 d / `e6 d /QCH6 d / _k6 d /6y6 d /`e6 d / 6 d / @+jB6 d /!"Yd_6 d /AlYd_6 d /Al ̋6 d /يG6 d /3`hh6 d /cU6 d /~t6 d /6 d / d76 d /Э Jp6 d /W vb6 d /bl` 6 d /' 6 d / }#6 d /@"@ n 6 d / 6 d /] Wѹ6 d / 6 d / `JO,6 d / @*6 d / 2w46 d / 6 d / G 6 d /86 d /7ؒ6 d / 9 6 d /ʻ h"6 d / `9j6 d /t r&V6 d /ʭ@nu6 d /6 d /O np6 d /D 6 d /?+6 d /`O6 d /l2sЉ6 d / '6f6 d /@66 d /* !o·6 d /J!66 d /* `"+6 d /##E6 d / #Z6 d /@$g0L6 d / $j6 d /l%p6 d / &ͦ6 d /& v6 d /l`'/I6 d /~(~6 d /"("=6 d /j @)ra6 d / )<_6 d /l*'6 d /a +z6 d / +p6 d /`,#6 d /<-و6 d /A ->9/56 d /.ZM%6 d / /6o86 d /h 0L6 d / 0i!6 d /`1gp6 d /D2z6 d /3246 d /.l@3 ( 6 d /_"3c@6 d /4~j6 d /` 5_V6 d /D58SN6 d /E`6Ƽ6 d /7y6 d /E@86 d /RE8pL^6 d /9JY,6 d / :U6 d / :06 d /̮`;(C6 d / <p6 d /= @=8+6 d /9=F6 d // >X!6 d /q' ?76 d /(?S_T 6 d / `ѥK_6 d /K6 d /i6 d /  ^6 d /eec6 d /s k6 d /+"\6 d / (?ඪ6 d /   6 d /`(TT6 d /jT&K6 d /8(LNf6 d /e@}Y6 d /0`jA=06 d /<NH6 d /Z+M/zB6 d /O26 d / `O26 d / r6 d /f X U6 d /j4O6 d /JmD6 d /`P6 d /8 Ȥ6 d /+(з76 d / mS6 d /m&`0JR6 d /~J6 d /j o6 d /bjY]6 d /*@{ 6 d /Wm6 d /h-.;6 d /@6 d /_# 6 d /Y6 d /XPmJ{6 d /Ϫ@Q6%6 d /o)` z6 d /#(}66 d /#^/6 d / _k6 d /`)6 d /R~86 d /]C6 d /k 6 d /k1ſ6 d /AT6 d / J6 d /  H=6 d /' ɱPB6 d / H26 d /{ F,6 d /{@Tڛ>6 d /iUWJ6 d /. `U 36 d /`MSX6 d /E;06 d /1`#}6 d /@- 6 d /V%6 d /ḿ6 d /X>&6 d /o )TO6 d /`X[ ;6 d /~"6 d /qH ʱ6 d /*XP6 d /{ *Mf6 d /ʱdO6 d /HRY>6 d /\`m`6 d /$c@ZG6 d /#Z;6 d /( P+6 d / ˱W86 d /#6 d /`[Ҍ6 d /#\ q 6 d /x`*kD 6 d /) "6 d /k`Ve 6 d /$Hf46 d /AI6 d /=qL`6 d /5@XE6 d //$wچ\6 d /Xhα6 d /[`³cf6 d /P+6 d /Pu6 d /h0_?6 d /[ bz86 d /}0b}6 d /@q ϱ`hI6 d /jh vlLoZ6 d /rϱ0 6 d / +׬D6 d / F6 d /Pc6 d /`+p6 d /|(+6 d /dӫ!6 d /ͪ+f6 d /(㲜6 d /`d@ 6 d /}l!E6 d /n !6 d /q!S6 d / e$46 d /rj6 d /(eq 6 d /~l ,'6 d /``,?\6 d /T@fSB6 d /f%6 d /)@oQU6 d /&)`BW6 d /ä6 d / i@óvu6 d /7) 6 d /iѱˠ6 d /y1gS6 d /r xm6 d /@#@[6 d /1 $Ͷ6 d /gjr6 d /r,I6 d /r,6 d /ó=36 d /xx /6 d /wP$?4i6 d / %(g6 d /Bi h6 d /, yn.6 d /Y)h'RT6 d /Tih&06 d /ī`8([6 d /fi@6 d /1@ijlo6 d /r@iL(6 d /׫y*m6 d /1 ұK6 d /@ұ@6 d /X%6 d /xi,kR6 d /i0(66 d /@ w6 d /*,@MX6 d /p`-_46 d /-$6 d /i-6 d /,  .~mp6 d /j)ijg6 d /z6 d / 2j@#6 d /)`Ao\6 d /)`joc6 d /j%?6 d / {xY6 d /E &M s6 d /!2 k6 d /ik6S6 d /6M76 d /7,۹`6 d /WqV6 d /$s.k6 d / (!w!6 d /IʵTH6 d /K2@l W6 d /) L\n6 d /:s M0 6 d /Ps(=56 d /i@آq6 d /)` : .6 d /\.6 d /p X %6 d /  6 d /fsԱLE6 d /D, (246 d /lW)6 d / jh6 d / )KD]6 d /m*AL*6 d /$]Y6 d /2m 06 d / nͭ=6 d /) ձs*6 d /j ZXR6 d /`/~?6 d /n,?6 d /s|\ 6 d /ά }M_6 d /j wRT6 d /* *3q66 d /@*!.6 d /٭ձiR6 d /*o6 d / p 2ع6 d /D+jk6 d /,j ,8(QM6 d /Xk(ά6 d /`p-6 d /lS?6 d /%*6 d /2Ď66 d /s}Y`6 d //S \6 d / -z36 d /6*/56 d />j`eK6 d /P ~֦6 d /@r 6 d /- 01,6 d /ֱ6 d /@̵ob6 d /  F6 d /Pr6 d /Bts6g6 d /`06 d /j t56 d /+tLzE6 d /(AS6 d /4 /ј6 d /4tZZ6 d / @006 d / q)-86 d /`v96 d / T1W!6 d /V ^e]6 d /&^By6 d /^ډ6 d /(i!6 d /R@P6 d / #6 d /a`=#6 d /:  >ɢ6 d / ~d 6 d / cc6 d /b B6e6 d /Vl u6 d /l =c6 d / " 6r6 d / @;6 d / @ ]|6 d / JB6 d /I 1QO6 d /` 6 d /yz6 d /c ϥ%6 d /~ ig6 d /9F~i6 d /7J,6 d /`B6 d /A76 d /B\a߱6 d /7Oм6 d /9n6 d /^z౯26 d / &Oм6 d /:n6 d /^zಯ26 d / '6 d /+_೯ԴT6 d /lJ@ }6 d /P *( I6 d /R8D~m,6 d /g @j8T6 d /k7oI6 d /`# 4z{Տ6 d /c C'?6 d /^\6 d /4`f6 d /:`EQ6 d /* 6Y6 d /66 d /$` 5h6 d /[+F6 d /] @7aK@x6 d /%JH6 d / 7 6 d /(@JMy6 d /j )܈6 d /6 d /*Ng86 d /O|m6 d / ]6 d /+]෯J6 d /A7 6 d / B?6 d /rOL6 d /H @C#H6 d /3Qn6 d /Bฯ<,6 d /I R%6 d / FE7³6 d /KGLU6 d /R_[F6 d /r@SK6 d / HO6 d /N!յ]uZ6 d /f sU6 d /¨ `\F6 d /U@_86 d /TuQt6 d /sT{>6 d /,)6 d /_6 d /`6 d /m, Ukl6 d /4```Z6 d /&ɯ6/l6 d /`6 d /, XvX6 d /G`ʯ T6 d /eR`rR6 d / V]6 d /hW6 d /hXR6 d /I `VD6 d /4 V`6 d /m W46 d /ʯ 6 d /4;WUXQ6 d /4 v6 d /5`i[6 d /5#U6 d /*5 6 d /?5 f6 d /T5`Fx6 d /i5eF6 d /W+6 d /(@X+6 d /(X 6 d /  YT6 d /6d`YW O6 d /a\XW6 d /I Y.B6 d /mb6 d /c36 d / [6 d / `\'@6 d /G˯ׁ6 d /N \O/6 d /`̯hR/6 d /#,26 d /x`ͯn6 d />]2՗A6 d /T :J$6 d /^,0Q6 d /NqՅ{6 d /T ٱ_6 d /,@x 0c6 d /pb2N6 d /v.C6 d /lxr6 d /z13>b6 d /|y5s6 d /P6 ڱޓY6 d /e6|6 d /lyhZt 6 d /S zDD6 d /azid6 d /ڱ4 6 d / t6 d /@{&s6 d /f{Qc16 d /S|]6 d /}-V6 d / ۱t6 d /K`dzm|6 d / P6 d /`|S 6 d /l|~H6 d / `6 d /l`O6 d /`b6 d /l` /6 d /} |5y6 d /02\86 d /` 5Z6 d /m`16 d /1|i6 d / m 3 6 d /66 d /0x6 d /^ ܱw6 d /f-1bi6 d /T 2w6 d /Q Zz6 d /q`Y6 d /6@~#ɖ6 d /¶ǃo6 d /m~0MD6 d /g`2QX6 d /' v6 d / 7ȳlY&6 d /,36 d /mx6 d /q2.6 d /*2l6 d /4 3t/6 d />`3&ٚ6 d /`@3^ŋ6 d /"3agh6 d /7 46 d /4̍.6 d / 5=7^6 d /bx5~+6 d /-`7+6 d /c@6 d / A26 d /o 4/BJ6 d /n\6 d /`486 d /e!4'6 d /4ؔ6 d /or a|6 d / 586 d /b`5K16 d /k*bH6 d /$l6J6 d /6 d /c56 d /PQ6 d / 7k6 d /`5;W6 d /l`HM6 d /[ 6y(7,6 d /`f`6ߔ6 d /&Nj6 d /\밆6 d /6D76 d /P8!**sqs.SendMessageBatchResultEntry!*[8]*binarylog.methodLoggerConfig!*[8]map[bsonrw.jsonTokenType]bool!*[]*dynamodb.AttributeValueUpdate!*[]*dynamodb.GlobalSecondaryIndex!*[]map[gob.typeId]**gob.decEngine!*[]map[int32]*proto.ExtensionDesc!*archive.overlayWhiteoutConverter!*bsoncore.DocumentValidationError!*chan http.http2FrameWriteRequest!*credentials.ChannelzSecurityInfo!*credentials.TransportCredentials!*descriptor.ExtensionRangeOptions!*descriptor.MethodDescriptorProto!*dynamodb.AutoScalingPolicyUpdate!*dynamodb.CreateGlobalTableOutput!*dynamodb.DescribeEndpointsOutput!*dynamodb.DescribeTimeToLiveInput!*dynamodb.ListTagsOfResourceInput!*dynamodb.LocalSecondaryIndexInfo!*dynamodb.TimeToLiveSpecification!*dynamodb.TransactWriteItemsInput!*dynamodb.UpdateGlobalTableOutput!*func() (*agenttasks.Task, error)!*func() (*object.BlobIter, error)!*func() (*object.FileIter, error)!*func() (*object.TreeIter, error)!*func() (*os.ProcessState, error)!*func() (*pubsub.Snapshot, error)!*func() (*request.Request, error)!*func() ([]*dotgit.DotGit, error)!*func() ([]bsoncore.Value, error)!*func() ([]docker.Network, error)!*func() (bsoncore.Document, bool)!*func() (net.Conn, *bufio.Reader)!*func() (object.FileStats, error)!*func() (object.TreeEntry, error)!*func() (string, bsonx.Doc, bool)!*func() *descriptor.MethodOptions!*func() *scram.ClientConversation!*func() *scram.ServerConversation!*func() []*pubsub.ReceivedMessage!*func() []metricproducer.Producer!*func() map[int32]proto.Extension!*func(*agenttasks.Pipeline) error!*func(*big.Float, int) *big.Float!*func(*bsoncodec.RegistryBuilder)!*func(*git.CheckoutOptions) error!*func(*http.Request) (bool, bool)!*func(*http.Server, net.Listener)!*func(*idxfile.MemoryIndex) error!*func(*index.Entry, interface {})!*func(*list.Element) interface {}!*func(*packp.UploadRequest) error!*func(*primitive.Timestamp) error!*func(*tag.Map) (*tag.Map, error)!*func(*url.URL) (*url.URL, error)!*func(...*aws.Config) *aws.Config!*func(...http.http2Setting) error!*func([]uint8, bool) (int, error)!*func(asn1.ObjectIdentifier) bool!*func(bool) *mongo.UpdateOneModel!*func(bool) *options.IndexOptions!*func(capability.Capability) bool!*func(flag.Value, string, string)!*func(float64) *dynamodb.Capacity!*func(fmt.ScanState, int32) error!*func(func() error, string) error!*func(func(*cobra.Command) error)!*func(http.ResponseWriter, error)!*func(httptrace.WroteRequestInfo)!*func(int) ([]os.FileInfo, error)!*func(int, int, int) (int, error)!*func(int, string, string) string!*func(int32) *options.FindOptions!*func(int64) *dynamodb.QueryInput!*func(int64) *dynamodb.ScanOutput!*func(int64) *options.FindOptions!*func(interface {}) *list.Element!*func(interface {}) errcode.Error!*func(interface {}, interface {})!*func(interface {}, string) error!*func(io.Reader) ([]uint8, error)!*func(io.Reader) *scanner.Scanner!*func(io.Writer, ...interface {})!*func(map[gob.typeId]bool) string!*func(mongo.SessionContext) error!*func(primitive.Decimal128) error!*func(reflect.Type) reflect.Value!*func(ssh.PublicKey, string) bool!*func(stack.Call) stack.CallStack!*func(string) (afero.File, error)!*func(string) (amqp.Queue, error)!*func(string) (billy.File, error)!*func(string) (net.IPMask, error)!*func(string) *dynamodb.Condition!*func(string) *dynamodb.ScanInput!*func(string) map[string][]string!*func(string, agenttasks.Handler)!*func(string, bool, string) *bool!*func(string, flag.ErrorHandling)!*func(string, int, string) string!*func(string, int8, string) *int8!*func(string, interface {}) error!*func(string, string, int) string!*func(string, uint, string) *uint!*func(tls.ConnectionState, error)!*func(transport.AuthMethod) error!*func(xml.Name) (xml.Attr, error)!*http.http2priorityWriteScheduler!*http2.duplicatePseudoHeaderError!*interface { CloseWrite() error }!*interface { InvalidUTF8() bool }!*map.bucket[*trace.Span]struct {}!*map.bucket[docker.Port]struct {}!*map.bucket[gob.typeId]*gob.decOp!*map.bucket[http.ConnState]string!*map.bucket[int32]proto.Extension!*map.bucket[interface {}][]string!*map.bucket[string]*config.Branch!*map.bucket[string][]*http.Cookie!*map.bucket[string][]interface {}!*map.bucket[string]common.Profile!*map.bucket[string]docker.Runtime!*map.bucket[string]encoding.Codec!*map.bucket[string]map[string]int!*map.bucket[string]parse.itemType!*map.bucket[string]yaml.fieldInfo!*map.hdr[*grpc.addrConn]struct {}!*map.hdr[*reflect.structType]bool!*map.hdr[http.http2SettingID]bool!*map.hdr[interface {}]*sync.entry!*map.hdr[string]*config.Submodule!*map.hdr[string]*openpgp.Identity!*map.hdr[string]endpoints.service!*map.hdr[string]http.RoundTripper!*map.hdr[string]map[string]string!*map.hdr[trace.Exporter]struct {}!*map.hdr[uint32]*http.http2stream!*map.hdr[uint32]*transport.Stream!*map.iter[*net.Listener]struct {}!*map.iter[*parse.TextNode][]uint8!*map.iter[plumbing.Hash]struct {}!*map.iter[reflect.Value]struct {}!*map.iter[string]*trace.spanStore!*map.iter[string][]*cobra.Command!*map.iter[string]endpoints.region!*map.iter[string]template.context!*map.iter[view.Exporter]struct {}!*map[*view.viewInternal]struct {}!*map[*view.viewInternal]time.Time!*map[color.Attribute]*color.Color!*map[digest.Algorithm]crypto.Hash!*map[ghw.StorageController]string!*map[int32]*proto.marshalElemInfo!*map[int64]*channelz.listenSocket!*map[int64]*channelz.normalSocket!*map[interface {}][]reflect.Value!*map[plumbing.ReferenceName]error!*map[string]measurable.Measurable!*map[uint32]*http.http2writeQueue!*options.FindOneAndReplaceOptions!*pubsub.DeleteSubscriptionRequest!*pubsub.ListSubscriptionsResponse!*pubsub.ListTopicSnapshotsRequest!*pubsub.UpdateSubscriptionRequest!*sqs.ChangeMessageVisibilityInput!*sqs.SendMessageBatchRequestEntry!*ssh.streamLocalChannelForwardMsg!*struct { F uintptr; is []int16 }!*struct { F uintptr; is []int32 }!*struct { F uintptr; is []int64 }!*struct { F uintptr; now *int64 }!*struct { F uintptr; p *io.pipe }!*struct { F uintptr; sep string }!*struct { Key uint8; Val uint32 } Architecturejson:"architecture"AttributeDefinitions type:"list"AutoScalingRoleArn type:"string" BackupArnmin:"37" type:"string" BackupNamemin:"3" type:"string" CPUCfsPeriodjson:"CpuCfsPeriod" Capabilitiesjson:"capabilities"Commentjson:"comment,omitempty"Currentjson:"current,omitempty" CursorsAlivebson:"cursorsAlive"!EC2MetadataDisableTimeoutOverrideForceRmTmpContainer qs:"forcerm"IDjson:"Id" yaml:"Id" toml:"Id"Idtype:"string" required:"true"ItemCollectionMetrics type:"map" KernelMemoryjson:"KernelMemory"!ListDeadLetterSourceQueuesRequestLocalSecondaryIndexes type:"map"LogLevelmapstructure:"loglevel" MaximumUnitsmin:"1" type:"long"Messagejson:"message,omitempty" MinimumUnitsmin:"1" type:"long"NodeCertExpiryjson:",omitempty"Patternprotobuf_oneof:"pattern"Payloadprotobuf_oneof:"payload"Periodsjson:"periods,omitempty" PolicyNamemin:"1" type:"string"Profilesmapstructure:"profiles"Protocolmapstructure:"protocol"RestoreDateTimetype:"timestamp"!RestoreTableFromBackupWithContextRollbackConfigjson:",omitempty" SaltLengthasn1:"explicit,tag:2"SetNamebson:"setName,omitempty"!SetPointInTimeRecoveryDescriptionTagstype:"list" required:"true"Variantjson:"variant,omitempty"VisibilityTimeouttype:"integer"!WithCredentialsChainVerboseErrors!WithS3DisableContentMD5ValidationWriteCapacityUnits type:"double"!interfaceArrayToMessageEventArray!isPushConfig_AuthenticationMethod   d /  &8 d /xW7  i d /s@I  r d /+@ I d /X 7 d /X A. d /.௷ 1 d /@ EU) d / G}  d / (:{ d / l d / An d /Ü EpR d /ߕ/@r {a d /hĜ   d /` gv d /Ŗ˜ " d /X¸ 2bmZ d /0YϜ %YF d /G7^ xA! d / g d /XԜ 4 d /ԙ@Ԝ A d /X  d /h@ Z d /\Y@/` kp_ d /`  v d /`  #( d /Л@ m)G d /I  ! d /`  ]Ye d /h  vXn d / ]I% d /4 Nx d /@ MX d / P &G2 d / * d / `D  d / `Q V d / R $% d /jh@ &H d /R !1 d /  &#a d / #@ d /4@ T6 d /_W@  k d /S j d /ƭ ! w d /   d / d d //y` M d /! C d /jZT _!H d /  0 d /  .. d /@  Z d /̕  n d / n d /W b d /ɕ [>] d /R5U 2b/ d / `V _( d / : d /{ " a d /  Vq d /X  L,)E d /r5" )i d /G  W! d / @ v d /@ & d /@ %"l d /@ (= d /`F , d / =zLU d /W5 a4 d /N@ Ed> d /Oh  3 d / 6 d /)6 4 d /@ ( d />X@ w7 d / )  d /6@  Yp d /@" : d /x Z gy d / wK d /@# =k' d / bN d /% U d //@ [C d /ܷ r d /TX@ e﫥 d /6` )  d /6`  Yp d /* : d /x+ gy d / wK d /@+ =k' d /  bN d /@- U d // [C d /޷ r d /TX๪ e﫥 d /6 0r d />W: | d /@ ` k6 d /^ `G 2 d / `   d /`H q d /o ` 0 d / <  m d / y S d /j @X  T d /    d / `I  d /x ` .2 d /R   }S d /̲ @߷ M d / `J  A d /h` 6 d /X1 9sK d /ଧ 5~ d /W bi d /M` ݏ d /$  I d /d` ?Q d /h` +S d /5 DQ d /c@5 a d /X 渇 d /X` ۓ d / [l d /P൧ C d /@׸ =i d /0@Y T? d / v(v d /sy@ , d /` 63 d /ȹ p6nY d /xZ nw d /* % d /ͪ 'M d /Qy@b % d /5  d / i@1 0 d /ʧ  I  d /@ |͒ d /@˧  Z d /`ͪ -Tk d /W˧ !X` >O d /`5 .\ d /5 =L7 d /, r d /h~ 5e d /4h`R ڈ,  d /W`S  d /` E> d /'i [  d /`_ n d /jX i | d /7@! K{ d /w`( 5 d /`7  d /@ Zܠ d /8 ħ d /D `d e d /x dXF d /q@  d /! =+ d /= Ƙ d /50 a d /{`+ [q d /Y`> { d /u? +b d /(X? Wr: d /5`, [ d / U@ d /-7 0  d /8̝  d /x`C Fj d />0  d /Q13 :[ d /x՝ 3; d /y m d /`? T d /6 }? d /? Tu3 d /@1p eH d /  4  d /9 ܠ d /PF  N d /  t d /h@ u#; d /W ˆ d /q1`. =MC d /6D ( d /6 _ d /@`t  d /T` )9 d /W ' d / . d /h . d /h  6 d /6 5 d /d@ o[ d / 2  d /z zw@ d /W "$ d /  \ d /rY /ua d /pF AY٪ d /  d /@  d /@ 1C d /h ./E d /h1@% o d /`W  d /d U׌ d /( x< d /( B  d /h )  d /W2* B d /@+ ? d /@2  k] d / Z d /h2 N d /@4  d /`  d /Q5 1 d /2`^ ^ d /h  d /טX Ÿ d /h I  d /3` 7M d /h@3`2 N|2 d /hT q d /d Ҳ d /|` LKS d / p d /ι 85J d /`3 p d / W$ d /3 /2| d /3 ?O d /ô " d /4`h   d /h B̰ d / H d /( +Gp d /@I c d /@4 $LZ d / Q$m d / nX d /4 ݜ d /J Ⱦ_ d /(@ "a d /N  d / e EZ d /ƴ /ua d /p> Kv d /a`f `sWV d /4@ ̀\+ d /jl im d /l j d / |ݻ d /@m ͏ d /( M d /2 Ut d /@ =L7 d /,`\ ;  d /ѣ  O} d /੡  п d /ա < d /h` 6Pf d /` A8 d / f d /5  T d /K` S d /    d /PX` +  d /bX  & d /J`  ' d /i  d /0 Hh 4 d /i`* "I d /M / , d /"i1  d /0`2 _z d /`6 5 d /}5  fJ d / 4u d /n  8} d /9  d /Y+ "@  d /$K l d /@M O[~ d /@N I: d /d@P [j @ d /GR  d /YS !z6 d /Bi@^  \  d /@d ֨m d /+@5e [0 d / qǢ d /a7 O# d /X ׀% d /֖  d /# 18]o d /tXП >q" d /5ҟ g d /(ҟ 1W C d /0@ӟ Tו d / ֟ 2 d /_۟ C% d /t : d /0i5@ # d /Y R d />i } d /(6 uJ d /@B  d /@6; O& d /{  d /"Z| E d /m@~ ߅ d /X {D d / J d / |;p d /8Z@ qK< d /^ ے d /@ 9` d / W d /V 珈 d /@ wHV d /g %= d /W6 1>q d /5 S$ d /NZ 1Ɋ d /`< \/r d /< !b d /u { & d /  =zY d /' sq d /`  Z  d /  Z d / n "Da d /D  d /Z  d /` en d /dZC   d /x   d /` ni) d /Y  B d / q T+ d /`= + d / 6= P d /WD  d /Ι -"s d /,^`> \F d /G7  pE d /-@7 DG d /y @ d /I7@ O d /B^  X\dI d /26   d / v# d /   ?L d /]i7`' DpA d /r ˲ d /XG N+ d / gqO d /Y  U\ d / S_1 d /` !~ d /Y  &4H d / m d /Z ڗ d / z d /[  'PE d /8I [F! d /M d  d /i ?d d /iਫ ;  d /-@8t f d / z d /)`B 037 d /)B =% d /@8 0e d /X@ ,0a| d /[֠ G d / 0 d /X K{ d /z `t ~bH d /st `&KV d /B`{ A d /y  RTa d / 헸 d /   &r d /Y 4؏ d /   } d /  6 d /  d /(Y` 8\ d / 8K v d /9 ߢ, d /@9  yq d /9) @R d /9`  d /:  F? d /@:  d d /  d /u:  d /:L O d /Y  d /඲ Tu d / IhU^ d /* q d / @H d /Z`δ e d /`ϳ k|l d / ϴ @ d /   d /Zࣩ  z d /   d /) 6   d /8;@ 4v d /$@ ) d /٘  oR d /8 " d /) @ d /3 ' 泟. d /R`' $ d /-`| zC  d /@; ~ Ձ  d /f`O T3 d /Y; +Zz d /c u d /Ck  Ϛ d /P]  ̵Ќ d / V d /֜ ` d /;` _Z d / 1/( d /% 2c d /` A d / *R d /f] ~ d /Z< 6  d /@< =-( d /< KD d /,  d /1  d /7<`+ S d /i=  } d /Z@=@Q # i d /[` $ d /  + d /u޴ /# d /  mL d /`« š d /H« 쒂 d /p ë f~|; d /5=ë $M d /{`X jjW d /H  iY d / 8 d /`  U d /Z f> d /њ  }c\ d /E=  _9 d /^ ƫ cZ =D d /w S 1d d /@>   ?# d /J  * d /x>Ϋ $ d /@n n@ d /@ӫ u d /? נ d /7  φ$ d /D?@Q Ec d /pYQ Q8 d /W  ` d / G+ d /gX/ 7K d /e8  H d /D J> d /  d /ɨ _cl d /(  A| d /i9 6 d / 1 E d /R 1 d /^ 9 d /X  ͂ d /\@ 9b2 d /' 6F d /* Z d /9@ OP d /p ˣ.a d /hiI =C d /д ZoI d /@ g_F d /5 ͨ Y^ d /Qͨ ) d /5@_ %B d /`  J, d /  b d / Zé \owJ d /xi  n  d /{7` V d /E@T R d /X®  d /l ( \ d / 6 H  d / ?LO d /18f L d /Xî O_ d /[` Ud d /\Ш   d /@ -& d /  3( 7 d /  & d /8) + Dg d /E) 4 d /:@@ C d /p@S ^V d /I0 %YF d /Y  L) d /D k d /i 0 d /@Ѩ   d /i` @+ K d /k`8 % d /%` nk d /yk . d /@ BQH d /i ť d /  ';> d /N ̝ d /5 Ө -O)i d /89 ,p d /I ^m d /ή 4 d /)  T d / A  x d /@n  d /y Ϯ  d /FX@ Vh d /mϮ `CJ d / Ю D d /A 3= d / @T d /j`  d /[n l d /Ө L" d /> + d / Ɩ d /6Z: :Hy d /9@o =v d /Ө ,`d d /+) ~ d /Z W d /Ԩ Dg d /E)   d /` HC d /] Ԯ 2 d /: O+B d /<ը tq d /3  d /  A d /$Z 4   d /]  d /X eֈ d / 4 mw\ d / ծ F d /6 Fp d / ׮ qM d /ט`ը M} d /8  d /H\@  ǚӽ d / V  d /@ H\` d /` 2g d /pV   d /\  Z% d /]V J>S d /-` g d /q  BK d /8 ! d /`@   d /@ >cC d /@ j@ d /@A U W̤ d / A }9 d / ֨  J d /A Uɾ d /   j d / _  d /^k A d /$Z NL]\ d /ҳ pW d /P u d /y qi d / ɟ d /PB d) d / ӳ  d / Te d / y}X d /LY , d /Z h} d /r  Yg d /A r` d /͗B@q KM d /Y\ ߺ d /Y@] 13 d /`E x d /E ;L d /J^ W; d /   (G d /  6 d /& l d /U  5a d /t\S ZL| d /\_ 9F d /"@BT ƒF d /X  d /  ` d /v` rI d /7 , B/Z d /` W; d /j`a  d /`  d / \ d /kj H d4# d / s d /lBH `շ d /. oD d /`@ g@ d /4B V: d /@ 7 d /R C I \ d /@C Ϫ d /  \ E6 d / 5 J# d /b ɦ d /5 D" d /[  b d /? W 1 d /`7 u d /"`  L) d /] Rd d /o 0D d /X`: kNn d /@   d /2\ =u d /iI a+ d /? dn d / f  d /*x f d /wC d Dk d /HZE - d /x` ,p d / `F S d /e  q d /c! :r d /  ܑz d /X^ / d /k" > d /kF * d /n^ຳ ؏ d /e K UN d /e h d /C G PX d /ȝf ļ&^ d /g  1z d /O9 & IK d /]õ 9Q d /]`L 7 d /L 2{1 d /:Yg )ΨV d /D gP d / h wV d /^Y Jx d /B ѥ Yj  d /[H f d /*@D`&  7 d /D& *Ms d /D& v d / ' b0 d /`' p/ d /LYE' r5 d /I  d / ~z| d /Ф` o n d /ߤ@ q6 d /`إ j d /jڥ c d / Ā d /i` mr d /<` mr d /<  d /[  Er d /6 4V d /  vƵ d /  nj d /`  ) d /  .t d / ahQ d /[` / d /@E f d /" =ҌN d /Zi ( njl d /4  B$ d /( .l d /vi`j 2q d /LE`Ʒ iz1 d /@N <% d /DZ  d /O  = d / Ui0 d /\E *n d /ĘFz  \5 d /K8    d /HO I d /` h| d /5j ( d /P   d / Q yD d /&`Q KV d /%XҴ IT d /ΛX 8X d /?Q I2l d /Pj@ 8Gvf d /\Y 7s d /p@Z 38+c d /Z VZ d / q d /7`* &h d /r ޗܪ d /n M d /4T z d /^ + d /Y V %. d /Y  d /# 9 r d /_ f d / b 9 d / v Y> d /9  4 d /6 ] d /Y`d r{ d /P@F ! m d / d T d / w Ux d /|]@f (#~ d /\` U+h d /˜g |pG d /9F#  d /8 h  d /\ y Ǟ5* d /Lh 4 d /`@  d /h@i o d /)y  ~ d / ұ ^ d />i  d /k T d /{ ObJ d /( 4 d /F ) 4%N/ d /m ; d /o ձ } d /hn {@ d /jp  d /\ - w d / k`Y p d /}@r c4 d / 0 +t d /(k  0 d /:]. wHH& d /Ut Ө  d /XF0 :f&j d /Y`v _| d /` ֩ d /ea d d /p V f d /v` f d /v༯ W%V d /bʯ  d /PW f d /v` f d /v཯ f d /v` Oot d /ϳ W f d /vྯ f d /v` f d /v࿯ f d /v` f d /v f d /v` f d /v f d /v`¯ f d /v¯ f d /v`ï S d /p`Y NyD d /ea f d /vï f d /v`į f d /vį f d /v`ů f d /vů f d /v`Ư f d /vƯ i  d /c ܇ d /4c  d / [ f d /v`ǯ f d /vǯ l{] d / \ f d /v`ȯ f d /vȯ f d /v`ɯ  + d /Z] 8  d /J^ - d /8fd #  d /h`_ ̥ d / 0 ;1, d /  / d /G`y u.  d / z LI d / z &` d /592  d /]} 8| d /} g/\ d /`1 j d /@G 3 ^  d /l@~ 8o d /0~ I:ϩ d /@ 'i d /`2 o d /Gy * d /9 Il& d /H3 : d / @^ d /ƟG2   d /dH2 ԑ d /p@H 3 ?i  d /|`3 ~.8 d /H3 3] d /R)3 K d / 4 ? j d /O4 c d /d 5 T5 d /^ a2 d /^  F< d /d 4 P^ d / 6 uȲ d /,  d /F 5 `& d /0`5  4 d /b  J d /Hʳ Uɾ d /  B d /5 j d / 7 RZk d /A` ɟ d /P \ d) d /ճ  d / Te d /83 d /v"**pubsub.ListSubscriptionsResponse"**sqs.SendMessageBatchRequestEntry"*<-chan *vagrantutil.CommandOutput"*[8]*dynamodb.AttributeValueUpdate"*[8]map[gob.typeId]**gob.decEngine"*[8]map[int32]*proto.ExtensionDesc"*[]*descriptor.EnumDescriptorProto"*[]*descriptor.FileDescriptorProto"*[]*descriptor.UninterpretedOption"*[]*dynamodb.ItemCollectionMetrics"*[]*dynamodb.ReplicaSettingsUpdate"*[]*options.ListCollectionsOptions"*[]bsoncodec.interfaceValueDecoder"*[]bsoncodec.interfaceValueEncoder"*[]edwards25519.CachedGroupElement"*[]struct { clear bool; flag int }"*bsonrw.errMaxDocumentSizeExceeded"*chacha20poly1305.chacha20poly1305"*chan *connection.pooledConnection"*chan<- *vagrantutil.CommandOutput"*credentials.ChannelzSecurityValue"*descriptor.ServiceDescriptorProto"*docker.ListFilteredPluginsOptions"*driver.ListCollectionsBatchCursor"*dynamodb.DescribeGlobalTableInput"*dynamodb.DescribeTimeToLiveOutput"*dynamodb.GlobalSecondaryIndexInfo"*dynamodb.ListTagsOfResourceOutput"*dynamodb.TransactWriteItemsOutput"*edwards25519.ExtendedGroupElement"*envconfig.RequireHandshakeSetting"*func() (*multipart.Reader, error)"*func() (*ssh.ClientConfig, error)"*func() ([]bson.RawElement, error)"*func() (amqp.properties, []uint8)"*func() (bsoncore.Document, error)"*func() (bsonx.Arr, string, error)"*func() (credentials.Value, error)"*func() (event.APIResponse, error)"*func() (idxfile.EntryIter, error)"*func() (merkletrie.Action, error)"*func() (object.CommitIter, error)"*func() (primitive.ObjectID, bool)"*func() *bsoncore.DocumentSequence"*func() *descriptor.MessageOptions"*func() *descriptor.ServiceOptions"*func() *descriptor.SourceCodeInfo"*func() *grpc_binarylog_v1.Address"*func() *grpc_binarylog_v1.Message"*func() *grpc_binarylog_v1.Trailer"*func() *writeconcern.WriteConcern"*func() []*runtime.PluginPrivilege"*func() description.SelectedServer"*func() func(*cobra.Command) error"*func(*amqp.Channel, string) error"*func(*asn1.ObjectIdentifier) bool"*func(*big.Int, *big.Int) *big.Int"*func(*big.Int, *big.Int) *big.Rat"*func(*big.Rat, *big.Rat) *big.Rat"*func(*bool, string, bool, string)"*func(*cobra.Command, error) error"*func(*idna.Profile, string) error"*func(*int8, string, int8, string)"*func(*pkix.CertificateList) error"*func(*uint, string, uint, string)"*func(...func(*endpoints.Options))"*func([]interface {}, bool, error)"*func([]uint8) agenttasks.Pipeline"*func([]uint8, int64) (int, error)"*func([]uint8, interface {}) error"*func([]uint8, uint8, int) []uint8"*func(big.RoundingMode) *big.Float"*func(bool) *dynamodb.GetItemInput"*func(bool) *mongo.ReplaceOneModel"*func(bool) *mongo.UpdateManyModel"*func(bool) *options.UpdateOptions"*func(error) (time.Duration, bool)"*func(http.http2FrameWriteRequest)"*func(image.Point) image.Rectangle"*func(image.Rectangle) image.Image"*func(image.Rectangle) image.Point"*func(int) (*object.Commit, error)"*func(int, int, int) reflect.Value"*func(int, string) (string, error)"*func(int, syscall.Sockaddr) error"*func(int32) *options.IndexOptions"*func(int64) *dynamodb.QueryOutput"*func(int64) *options.CountOptions"*func(int64) *request.offsetReader"*func(int64) *sqs.SendMessageInput"*func(io.Reader, ssh.Signer) error"*func(jwalterweatherman.Threshold)"*func(logrus.Fields) *logrus.Entry"*func(logrus.Level) *io.PipeWriter"*func(net.IP) net.policyTableEntry"*func(parse.Node) (string, string)"*func(pflag.Value, string, string)"*func(plumbing.Hash) (bool, error)"*func(plumbing.ReferenceName) bool"*func(reflect.Value) reflect.Value"*func(string) (*git.Remote, error)"*func(string) (*swarm.Node, error)"*func(string) (*swarm.Task, error)"*func(string) (os.FileInfo, error)"*func(string) *dynamodb.Projection"*func(string) *dynamodb.QueryInput"*func(string) *options.FindOptions"*func(string) *pubsub.Subscription"*func(string) *sqs.ListQueuesInput"*func(string) *sqs.PurgeQueueInput"*func(string) *sqs.UntagQueueInput"*func(string, bsonx.Val) bsonx.Doc"*func(string, pflag.ErrorHandling)"*func(string, string, net.IP) bool"*func(string, string, string) *int"*func(time.Duration) time.Duration"*func(uint32, bool, []uint8) error"*func(uint32, http2.ErrCode) error"*func(uint32, uint32, uint8) error"*func(uint64, uint8) []openpgp.Key"*http.transportReadFromServerError"*map.bucket[clog.MODE]clog.Factory"*map.bucket[gob.typeId]gob.gobType"*map.bucket[http.http2Flags]string"*map.bucket[http2.FrameType]string"*map.bucket[http2.SettingID]string"*map.bucket[int32]jmespath.tokType"*map.bucket[int64]*channelz.server"*map.bucket[interface {}]struct {}"*map.bucket[logrus.fieldKey]string"*map.bucket[string]*fsnotify.watch"*map.bucket[string]*git.FileStatus"*map.bucket[string]*ssh.cipherMode"*map.bucket[string]*trace.traceSet"*map.bucket[string][]net.nssSource"*map.bucket[string]agenttasks.Task"*map.bucket[string]docker.Endpoint"*map.bucket[string]map[string]bool"*map.bucket[string]viper.FlagValue"*map.bucket[tag.Key]tag.tagContent"*map.hdr[index.Stage]plumbing.Hash"*map.hdr[interface {}]interface {}"*map.hdr[string]*template.Template"*map.hdr[string]*trace.eventFamily"*map.hdr[string]*view.viewInternal"*map.hdr[string][]*xmlutil.XMLNode"*map.hdr[string]endpoints.endpoint"*map.iter[*grpc.addrConn]struct {}"*map.iter[interface {}]*sync.entry"*map.iter[string]*config.Submodule"*map.iter[string]*openpgp.Identity"*map.iter[string]endpoints.service"*map.iter[string]http.RoundTripper"*map.iter[string]map[string]string"*map.iter[trace.Exporter]struct {}"*map.iter[uint32]*http.http2stream"*map.iter[uint32]*transport.Stream"*map[reflect.Type]*proto.mergeInfo"*map[reflect.Type]*yaml.structInfo"*map[string]*docker.EndpointConfig"*map[string]*http.http2addConnCall"*map[string]*proto.OneofProperties"*map[string]jmespath.functionEntry"*map[unsafe.Pointer]unsafe.Pointer"*pkix.RelativeDistinguishedNameSET"*pubsub.ListTopicSnapshotsResponse"*pubsub.SubscriptionConfigToUpdate"*sqs.ChangeMessageVisibilityOutput"*sqs.DeleteMessageBatchResultEntry"*struct { F uintptr; buf []uint8 }"*struct { F uintptr; c *tls.Conn }"*struct { F uintptr; h hash.Hash }"*struct { F uintptr; hash uint32 }"*struct { F uintptr; m *sync.Map }"*struct { F uintptr; name string }"*struct { F uintptr; repl string }"*struct { F uintptr; ss []string }"*struct { F uintptr; ttl tag.TTL }"*struct { Min uint32; Max uint32 }"*struct { R *big.Int; S *big.Int }"*struct { b bool; x interface {} }"*struct { sync.Mutex; dir string }"*struct { sync.Mutex; m sync.Map }AgentKeymapstructure:"agent_key" BrokerURImapstructure:"mgmt_uri""ChangeMessageVisibilityWithContextConditionExpression type:"string"ConsumedCapacitytype:"structure"ContainerStatusjson:",omitempty"CreationDateTimetype:"timestamp""DescribeGlobalTableSettingsRequest GCPPubSubyaml:"-" ignored:"true"GlobalSecondaryIndexes type:"map"HeartbeatPeriodjson:",omitempty"KeyPathmapstructure:"db_keypath"LocalSecondaryIndexes type:"list"LockPathmapstructure:"lock_path"NumericOrderingbson:",omitempty"SSESpecificationtype:"structure""SSLClientCertificateKeyPasswordSetStopGracePeriodjson:",omitempty"TableDescriptiontype:"structure""UpdateContinuousBackupsWithContextVersionasn1:"optional,default:0""WaitUntilTableNotExistsWithContext#vendor/golang_org/x/net/http2/hpack#*[8]edwards25519.CachedGroupElement#*[8]struct { clear bool; flag int }#*[]*descriptor.FieldDescriptorProto#*[]*descriptor.OneofDescriptorProto#*[]*dynamodb.ExpectedAttributeValue#*[]*grpc_binarylog_v1.MetadataEntry#*[]*options.FindOneAndDeleteOptions#*[]*options.FindOneAndUpdateOptions#*[]*sqs.SendMessageBatchResultEntry#*descriptor.SourceCodeInfo_Location#*dynamodb.AutoScalingSettingsUpdate#*dynamodb.DescribeGlobalTableOutput#*dynamodb.SourceTableFeatureDetails#*edwards25519.CompletedGroupElement#*func() (*docker.DockerInfo, error)#*func() (*dotgit.PackWriter, error)#*func() (*object.ObjectIter, error)#*func() (*template.Template, error)#*func() ([]*vagrantutil.Box, error)#*func() ([]bsoncore.Element, error)#*func() (bsonrw.ArrayReader, error)#*func() (bsonrw.ArrayWriter, error)#*func() (bsonrw.ValueReader, error)#*func() (bsonrw.ValueWriter, error)#*func() (crr.WeightedAddress, bool)#*func() (primitive.ObjectID, error)#*func() (result.KillCursors, error)#*func() (string, bsoncore.Document)#*func() (vagrantutil.Status, error)#*func() *grpc_binarylog_v1.Metadata#*func() jwalterweatherman.Threshold#*func() map[string]endpoints.Region#*func() pubsub.isSeekRequest_Target#*func(*big.Int, int, uint) *big.Int#*func(*index.EndOfIndexEntry) error#*func(*int, string, string, string)#*func(*list.Element, *list.Element)#*func(...interface {}) (int, error)#*func(...string) (bsonx.Val, error)#*func(...string) *template.Template#*func([]diffmatchpatch.Diff) string#*func([]uint8) (*big.Int, *big.Int)#*func([]uint8, []uint8) cipher.AEAD#*func([]uint8, uint32) (int, error)#*func(aws.LogLevelType) *aws.Config#*func(bool) *options.FindOneOptions#*func(bool) *options.ReplaceOptions#*func(bool) *options.SessionOptions#*func(bool) map[string]interface {}#*func(bsontype.Type, []uint8) error#*func(chan *docker.APIEvents) error#*func(context.Context, int64) error#*func(http.http2writeContext) error#*func(http2.PushPromiseParam) error#*func(int, string, ...interface {})#*func(int64) (plumbing.Hash, error)#*func(int64) *channelz.ServerMetric#*func(int64) *channelz.SocketMetric#*func(interface {}) (string, error)#*func(io.Reader) (io.Reader, error)#*func(io.Writer) bsonrw.ValueWriter#*func(plumbing.EncodedObject) error#*func(plumbing.Hash) (int64, error)#*func(plumbing.ReferenceName) error#*func(proto.Message, []uint8) error#*func(proto.Message, proto.Message)#*func(proto.pointer, proto.pointer)#*func(reflect.Value, reflect.Value)#*func(string) (*http.Cookie, error)#*func(string) (*index.Entry, error)#*func(string) (*object.File, error)#*func(string) (*object.Tree, error)#*func(string) (interface {}, error)#*func(string) (net.Listener, error)#*func(string) *dynamodb.GlobalTable#*func(string) *options.IndexOptions#*func(string) *sqs.CreateQueueInput#*func(string) *sqs.DeleteQueueInput#*func(string) *sqs.GetQueueUrlInput#*func(string) *sqs.SendMessageInput#*func(string) <-chan ssh.NewChannel#*func(string, []int, string) *[]int#*func(string, int) (*big.Int, bool)#*func(string, int, int) *token.File#*func(string, int16, string) *int16#*func(string, int32, string) *int32#*func(string, int64, string) *int64#*func(string, string) (bool, error)#*func(string, string) *pubsub.Topic#*func(string, string, string) error#*func(string, uint8, string) *uint8#*func(time.Time, time.Duration) int#*http.http2clientConnPoolIdleCloser#*http.http2sortPriorityNodeSiblings#*interface { LocalAddr() net.Addr }#*macaron.internalServerErrorInvoker#*map.bucket[*net.Listener]struct {}#*map.bucket[*parse.TextNode][]uint8#*map.bucket[*reflect.structType]int#*map.bucket[[8]uint8]chan struct {}#*map.bucket[ghw.Architecture]string#*map.bucket[int64]*channelz.channel#*map.bucket[plumbing.Hash]struct {}#*map.bucket[reflect.Type]*gob.decOp#*map.bucket[reflect.Type]*gob.encOp#*map.bucket[reflect.Type]gob.typeId#*map.bucket[reflect.Value]struct {}#*map.bucket[string]*redis.fieldSpec#*map.bucket[string]*tls.Certificate#*map.bucket[string]*trace.spanStore#*map.bucket[string]*view.measureRef#*map.bucket[string][]*cobra.Command#*map.bucket[string]balancer.Builder#*map.bucket[string]endpoints.Region#*map.bucket[string]endpoints.region#*map.bucket[string]map[int32]string#*map.bucket[string]map[string]int32#*map.bucket[string]resolver.Builder#*map.bucket[string]ssh.kexAlgorithm#*map.bucket[string]syntax.charGroup#*map.bucket[string]template.context#*map.bucket[string]template.element#*map.bucket[uint32][]*runtime._type#*map.bucket[view.Exporter]struct {}#*map.hdr[*parse.ActionNode][]string#*map.hdr[*parse.TemplateNode]string#*map.hdr[bsontype.Type]reflect.Type#*map.hdr[context.canceler]struct {}#*map.hdr[interface {}]*list.Element#*map.hdr[reflect.Type]*gob.typeInfo#*map.hdr[reflect.Type]reflect.Value#*map.hdr[resolver.Address]struct {}#*map.hdr[string]*dynamodb.Condition#*map.hdr[string]*plumbing.Reference#*map.hdr[string]chan *amqp.Delivery#*map.hdr[string]chan ssh.NewChannel#*map.hdr[string]knownhosts.KnownKey#*map.iter[index.Stage]plumbing.Hash#*map.iter[interface {}]interface {}#*map.iter[string]*template.Template#*map.iter[string]*trace.eventFamily#*map.iter[string]*view.viewInternal#*map.iter[string][]*xmlutil.XMLNode#*map.iter[string]endpoints.endpoint#*map[*http.http2ClientConn][]string#*map[anagent.TimerID]*anagent.Timer#*map[reflect.Type]*redis.structSpec#*map[runtime.typeOff]*runtime._type#*map[string][]*http.http2ClientConn#*map[string][]*multipart.FileHeader#*map[string]docker.ContainerNetwork#*map[string]errcode.ErrorDescriptor#*map[uint32]*http.http2clientStream#*map[uint32]*http.http2priorityNode#*map[uint64]chan description.Server#*sqs.DeleteMessageBatchRequestEntry#*struct { F uintptr; R *rand.Rand }#*struct { F uintptr; count uint32 }#*struct { F uintptr; f *clog.file }#*struct { F uintptr; repl []uint8 }#*struct { F uintptr; ret *uintptr }#*struct { F uintptr; scerr *error }#*struct { src []uint8; stride int }#*swarm.ConfigReferenceRuntimeTargetArbitersbson:"arbiters,omitempty"AutoScalingDisabledtype:"boolean"BackupDescriptiontype:"structure"#ChangeMessageVisibilityBatchRequestCodetype:"string" required:"true"Commitjson:"commit" form:"commit" CursorsKilledbson:"cursorsKilled"EncryptionConfigjson:",omitempty"Errorjson:"errorDetail,omitempty"Filterjson:"filter" form:"filter"GenericResourcesjson:",omitempty"GlobalSecondaryIndexes type:"list"IsMasterbson:"ismaster,omitempty"KeepOldSnapshotsjson:",omitempty"MaxNumberOfMessagestype:"integer"Nodejson:"node_id" form:"node_id"NodeIDform:"nodeid" json:"nodeid"Outputjson:"output" form:"output"Passivesbson:"passives,omitempty"Passwordjson:"password,omitempty"Platformjson:"platform,omitempty"ProjectionExpression type:"string"ReadOnlybson:"readOnly,omitempty" RelativeNameasn1:"optional,tag:1"Resultjson:"result" form:"result" SSLCommonNamejson:"sslCommonName"Scriptjson:"script" form:"script"Selecttype:"string" enum:"Select"#SetPointInTimeRecoverySpecificationSnapshotIntervaljson:",omitempty"Sourcejson:"source" form:"source"Statusjson:"status" form:"status"StreamDescriptiontype:"structure"TimeNanojson:"timeNano,omitempty"UnprocessedKeysmin:"1" type:"map"Usernamejson:"username,omitempty"$**sqs.DeleteMessageBatchRequestEntry$*[33]struct { clear bool; flag int }$*[8]*dynamodb.ExpectedAttributeValue$*[8]*sqs.SendMessageBatchResultEntry$*[]*descriptor.MethodDescriptorProto$*[]*dynamodb.LocalSecondaryIndexInfo$*[]*options.FindOneAndReplaceOptions$*[]*sqs.SendMessageBatchRequestEntry$*[][]*dynamodb.ItemCollectionMetrics$*balancer.ConnectivityStateEvaluator$*bsoncore.InvalidDepthTraversalError$*descriptor.EnumValueDescriptorProto$*descriptor.FileOptions_OptimizeMode$*docker.DownloadFromContainerOptions$*dynamodb.GlobalSecondaryIndexUpdate$*dynamodb.ReplicaSettingsDescription$*edwards25519.ProjectiveGroupElement$*func() (*plumbing.Reference, error)$*func() ([]*tasks.TaskResult, error)$*func() (dnsmessage.Question, error)$*func() (dnsmessage.Resource, error)$*func() (primitive.Decimal128, bool)$*func() (string, primitive.ObjectID)$*func() *descriptor.EnumValueOptions$*func() *pubsub.MessageStoragePolicy$*func() *pubsub.PushConfig_OidcToken$*func() func(...interface {}) string$*func() map[string]endpoints.Service$*func(*[]int, string, []int, string)$*func(*int16, string, int16, string)$*func(*int32, string, int32, string)$*func(*int64, string, int64, string)$*func(*macaron.Context, *log.Logger)$*func(*opentracing.StartSpanOptions)$*func(*rand.Rand, *big.Int) *big.Int$*func(*uint8, string, uint8, string)$*func(...interface {}) errcode.Error$*func(...string) (bsonx.Elem, error)$*func([]*string) *dynamodb.ScanInput$*func([]diffmatchpatch.Patch) string$*func([]uint8) (cipher.Block, error)$*func([]uint8, *ssh.Signature) error$*func([]uint8, []uint8) (int, error)$*func(agenttasks.StateRequest) error$*func(bool) *dynamodb.AttributeValue$*func(bool) *dynamodb.RestoreSummary$*func(bsoncodec.DecodeContext) error$*func(bsoncodec.EncodeContext) error$*func(context.Context) (bool, error)$*func(context.Context) *http.Request$*func(context.Context) *logrus.Entry$*func(docker.JoinSwarmOptions) error$*func(docker.LoadImageOptions) error$*func(float64) *options.IndexOptions$*func(func(*object.Tag) error) error$*func(http2.HeadersFrameParam) error$*func(int) (syscall.Sockaddr, error)$*func(int, int) (cipher.AEAD, error)$*func(int, wiremessage.OpCode) error$*func(int32) *options.FindOneOptions$*func(int64) *channelz.ChannelMetric$*func(int64) *dynamodb.BackupDetails$*func(int64) *dynamodb.BackupSummary$*func(int64) *options.FindOneOptions$*func(interface {}) ([]uint8, error)$*func(interface {}) *anagent.Anagent$*func(io.Writer, interface {}) error$*func(logrus.Level, ...interface {})$*func(map[string]interface {}) error$*func(plumbing.Hash) (uint32, error)$*func(plumbing.Hash, uint64, uint32)$*func(runtime.neverCallThisFunction)$*func(string) (*docker.Image, error)$*func(string) (*swarm.Config, error)$*func(string) (*swarm.Secret, error)$*func(string) ([]os.FileInfo, error)$*func(string) (gotty.stacker, error)$*func(string) (plumbing.Hash, error)$*func(string) (reflect.Method, bool)$*func(string) (time.Duration, error)$*func(string) *dynamodb.GetItemInput$*func(string) *dynamodb.PutItemInput$*func(string) *properties.Properties$*func(string) *sqs.CreateQueueOutput$*func(string) *sqs.GetQueueUrlOutput$*func(string) *sqs.SendMessageOutput$*func(string, ...interface {}) error$*func(string, int) *machinery.Worker$*func(string, string) (string, bool)$*func(string, string) *config.Config$*func(string, viper.FlagValue) error$*func(time.Duration) (string, error)$*func(uint) (bson.RawElement, error)$*interface { RequiredNotSet() bool }$*map.bucket[*grpc.addrConn]struct {}$*map.bucket[*reflect.structType]bool$*map.bucket[codes.Code]http2.ErrCode$*map.bucket[gob.typeId]*gob.wireType$*map.bucket[http.http2ErrCode]string$*map.bucket[http.http2SettingID]bool$*map.bucket[http2.ErrCode]codes.Code$*map.bucket[interface {}]*sync.entry$*map.bucket[plumbing.ObjectType]bool$*map.bucket[reflect.Kind]gcfg.setter$*map.bucket[reflect.Type]gcfg.setter$*map.bucket[reflect.Type]gob.gobType$*map.bucket[string]*config.Submodule$*map.bucket[string]*docker.IndexInfo$*map.bucket[string]*object.TreeEntry$*map.bucket[string]*openpgp.Identity$*map.bucket[string]endpoints.Service$*map.bucket[string]endpoints.service$*map.bucket[string]grpc.MethodConfig$*map.bucket[string]http.RoundTripper$*map.bucket[string]map[string]string$*map.bucket[trace.Exporter]struct {}$*map.bucket[uint32]*http.http2stream$*map.bucket[uint32]*transport.Stream$*map.bucket[uint64]amqp.Confirmation$*map.hdr[interface {}][]interface {}$*map.hdr[plumbing.Hash]*list.Element$*map.hdr[plumbing.Hash]idxfile.Index$*map.hdr[plumbing.ReferenceName]bool$*map.hdr[runtime._typePair]struct {}$*map.hdr[string]*config.RemoteConfig$*map.hdr[string]internal.CommandInfo$*map.hdr[string]view.AggregationData$*map.hdr[token.Pos]*ast.CommentGroup$*map.hdr[uint32]*transport.outStream$*map.iter[*parse.ActionNode][]string$*map.iter[*parse.TemplateNode]string$*map.iter[bsontype.Type]reflect.Type$*map.iter[context.canceler]struct {}$*map.iter[interface {}]*list.Element$*map.iter[reflect.Type]*gob.typeInfo$*map.iter[reflect.Type]reflect.Value$*map.iter[string]*dynamodb.Condition$*map.iter[string]chan *amqp.Delivery$*map.iter[string]chan ssh.NewChannel$*map.iter[string]knownhosts.KnownKey$*map[*http.http2serverConn]struct {}$*map[*http.persistConn]*list.Element$*map[digest.Algorithm]*regexp.Regexp$*map[reflect.Type]*proto.discardInfo$*map[reflect.Type]*proto.marshalInfo$*map[string]*dynamodb.AttributeValue$*map[string]*stats.measureDescriptor$*map[string][]*dynamodb.WriteRequest$*map[string]docker.AuthConfiguration$*map[string]map[string]*macaron.Leaf$*map[uint64]proto.unmarshalFieldInfo$*sqs.ListDeadLetterSourceQueuesInput$*ssh.streamLocalChannelOpenDirectMsg$*struct { F uintptr; R *net.Dialer }$*struct { F uintptr; R *ssh.Client }$*struct { F uintptr; R agent.Agent }$*struct { F uintptr; c *tls.Config }$*struct { F uintptr; cutset string }$*struct { F uintptr; d os.FileInfo }$*struct { F uintptr; gp *runtime.g }$*struct { F uintptr; isProto3 bool }$*struct { F uintptr; s *trace.Span }$*struct { F uintptr; t http.Header }$*struct { name string; called bool }$*transport.outFlowControlSizeRequest$*wiremessage.SectionDocumentSequence AttributeNamemin:"1" type:"string"AttributesToGetmin:"1" type:"list"BillingModeSummarytype:"structure" BuildPathmapstructure:"build_path"CertIssuerSubjectjson:",omitempty"CertPathmapstructure:"db_certpath" DatabaseNamemapstructure:"db_name"$DescribeContinuousBackupsWithContext ErrorMessagejson:"error,omitempty"ExpressionAttributeNames type:"map" IndexesAfterbson:"numIndexesAfter"Labeltype:"string" required:"true" MaxActivemapstructure:"max_active"NamedResourceSpecjson:",omitempty"Passwordmapstructure:"db_password"$RestoreTableToPointInTimeWithContextRevokedCertificatesasn1:"optional" SecretKeymapstructure:"secret_key"$SetLastUpdateToPayPerRequestDateTimeSourceTableDetailstype:"structure"TagKeystype:"list" required:"true"UnprocessedItemsmin:"1" type:"map"$UpdateGlobalTableSettingsWithContextValuetype:"string" required:"true"%vendor/golang_org/x/crypto/cryptobyte%vendor/golang_org/x/crypto/curve25519%vendor/golang_org/x/text/unicode/bidi%vendor/golang_org/x/text/unicode/norm%**dynamodb.GlobalSecondaryIndexUpdate%*[8][]*dynamodb.ItemCollectionMetrics%*[]*descriptor.ServiceDescriptorProto%*[]*dynamodb.GlobalSecondaryIndexInfo%*[]*sqs.DeleteMessageBatchResultEntry%*[]map[runtime.typeOff]*runtime._type%*[]struct { src []uint8; stride int }%*descriptor.FieldDescriptorProto_Type%*dynamodb.RestoreTableFromBackupInput%*dynamodb.discovererDescribeEndpoints%*edwards25519.PreComputedGroupElement%*func() (*agenttasks.Pipeline, error)%*func() (*dotgit.ObjectWriter, error)%*func() (*git.SubmoduleStatus, error)%*func() (*idxfile.MemoryIndex, error)%*func() (*pubsub.Subscription, error)%*func() (dnsmessage.AResource, error)%*func() (git.SubmodulesStatus, error)%*func() (primitive.Decimal128, error)%*func() (result.CreateIndexes, error)%*func() (result.FindAndModify, error)%*func() (result.ListDatabases, error)%*func() (storer.ReferenceIter, error)%*func() (textproto.MIMEHeader, error)%*func() []*descriptor.DescriptorProto%*func() credentials.PerRPCCredentials%*func() descriptor.FieldOptions_CType%*func() func(string, ...interface {})%*func() map[string]endpoints.Endpoint%*func(*[]uint8, *bool, asn1.Tag) bool%*func(*cobra.Command, []string) error%*func(*flate.compressor, []uint8) int%*func(*http.Request, io.Writer) error%*func(*logrus.Entry) ([]uint8, error)%*func(*request.Request) time.Duration%*func(*tasks.Signature, string) error%*func(...interface {}) logging.Logger%*func([]*string) *dynamodb.Projection%*func([]*string) *dynamodb.QueryInput%*func([]*string) *sqs.UntagQueueInput%*func([]diffmatchpatch.Diff, int) int%*func([]internal.BucketConfiguration)%*func([]uint8) (int, net.Addr, error)%*func([]uint8, bool) ([]uint8, error)%*func([]uint8, net.Addr) (int, error)%*func(anagent.TimerID) *anagent.Timer%*func(bool) *options.AggregateOptions%*func(bool) *options.BulkWriteOptions%*func(bool) *options.InsertOneOptions%*func(capability.Capability) []string%*func(chan<- *docker.APIEvents) error%*func(context.Context) io.WriteCloser%*func(docker.BuildImageOptions) error%*func(docker.LeaveSwarmOptions) error%*func(docker.PushPluginOptions) error%*func(docker.RemoveNodeOptions) error%*func(endpoints.Resolver) *aws.Config%*func(func(*cobra.Command, []string))%*func(func(*object.Blob) error) error%*func(func(*object.File) error) error%*func(func(*object.Tree) error) error%*func(func(interface {}) error) error%*func(http2.SettingID) (uint32, bool)%*func(int, int) timeseries.Observable%*func(int, interface {}) interface {}%*func(int64) (*multipart.Form, error)%*func(int64) *sqs.ReceiveMessageInput%*func(interface {}) inject.TypeMapper%*func(io.Reader) (image.Image, error)%*func(io.Writer, proto.Message) error%*func(io.Writer, string) (int, error)%*func(os.FileInfo, *tar.Header) error%*func(plumbing.Hash, *idxfile.Writer)%*func(plumbing.Hash, time.Time) error%*func(string) (*config.Branch, error)%*func(string) (*docker.Volume, error)%*func(string) (*git.Submodule, error)%*func(string) (*http.Response, error)%*func(string) (*swarm.Service, error)%*func(string) ([]*index.Entry, error)%*func(string) (map[string]int, error)%*func(string) (ssh.AuthMethod, error)%*func(string) (storage.Storer, error)%*func(string) *binarylog.MethodLogger%*func(string) *dynamodb.BackupDetails%*func(string) *dynamodb.BackupSummary%*func(string) *options.FindOneOptions%*func(string) *sqs.AddPermissionInput%*func(string) *sqs.DeleteMessageInput%*func(string) *sqs.ListQueueTagsInput%*func(string) map[string]interface {}%*func(string, *ssh.Certificate) error%*func(string, ...interface {}) string%*func(string, []bool, string) *[]bool%*func(string, []uint, string) *[]uint%*func(string, net.IP, string) *net.IP%*func(string, string) (string, error)%*func(string, string) *config.Section%*func(string, string, []string) error%*func(string, string, string) *string%*func(string, uint16, string) *uint16%*func(string, uint32, string) *uint32%*func(string, uint64, string) *uint64%*func(uint) (bsoncore.Element, error)%*func(unsafe.Pointer, unsafe.Pointer)%*http.http2duplicatePseudoHeaderError%*map.bucket[*http.Request]func(error)%*map.bucket[bsonrw.jsonTokenType]bool%*map.bucket[dnsmessage.section]string%*map.bucket[http.connectMethodKey]int%*map.bucket[index.Stage]plumbing.Hash%*map.bucket[int64]plumbing.ObjectType%*map.bucket[interface {}]interface {}%*map.bucket[reflect.Type][]yaml.field%*map.bucket[string]*dynamodb.Capacity%*map.bucket[string]*singleflight.call%*map.bucket[string]*ssh_config.Config%*map.bucket[string]*template.Template%*map.bucket[string]*trace.eventFamily%*map.bucket[string]*view.viewInternal%*map.bucket[string][]*xmlutil.XMLNode%*map.bucket[string]docker.PortMapping%*map.bucket[string]endpoints.Endpoint%*map.bucket[string]endpoints.endpoint%*map.hdr[*view.viewInternal]struct {}%*map.hdr[plumbing.ReferenceName]error%*map.hdr[uint32]*http.http2writeQueue%*map.iter[interface {}][]interface {}%*map.iter[plumbing.Hash]idxfile.Index%*map.iter[string]*config.RemoteConfig%*map.iter[string]internal.CommandInfo%*map.iter[string]view.AggregationData%*map.iter[token.Pos]*ast.CommentGroup%*map.iter[uint32]*transport.outStream%*map[address.Address]*topology.Server%*map[chan<- os.Signal]*signal.handler%*map[docker.Port][]docker.PortBinding%*map[interface {}]measurable.HookFunc%*map[pflag.NormalizedName]*pflag.Flag%*map[string][]errcode.ErrorDescriptor%*map[string]auth.AuthenticatorFactory%*map[string]internal.PerMethodSummary%*map[uint64]chan description.Topology%*pubsub.ListTopicSubscriptionsRequest%*sqs.ListDeadLetterSourceQueuesOutput%*struct { F uintptr; R *flock.Flock }%*struct { F uintptr; R *http.Server }%*struct { F uintptr; R http.Handler }%*struct { F uintptr; _g_ *runtime.g }%*struct { F uintptr; a []int; x int }%*struct { F uintptr; b *int; a *int }%*struct { F uintptr; c *color.Color }%*struct { F uintptr; hlSize *uint64 }%*struct { F uintptr; keys []tag.Key }%*struct { F uintptr; m *metadata.MD }%*struct { F uintptr; s *ssh.Session }%*struct { F uintptr; t reflect.Type }%*struct { F uintptr; tags []tag.Tag }%*viper.UnsupportedRemoteProviderErrorCmd json:"Cmd" yaml:"Cmd" toml:"Cmd" Containerjson:"container,omitempty"ConversationIDbson:"conversationId"ExpressionAttributeValues type:"map"Get type:"structure" required:"true"KeyConditionExpression type:"string"%ListDeadLetterSourceQueuesWithContextMD5OfMessageAttributes type:"string" MediaTypejson:"mediaType,omitempty"MessageDeduplicationId type:"string"NonKeyAttributesmin:"1" type:"list"QueueOwnerAWSAccountId type:"string"SSETypetype:"string" enum:"SSEType"ScalingPolicyUpdatetype:"structure" Secondarybson:"secondary,omitempty" StandAlonemapstructure:"standalone"StreamSpecificationtype:"structure"TimeRangeLowerBoundtype:"timestamp"TimeRangeUpperBoundtype:"timestamp" TotalSegmentsmin:"1" type:"integer"UserIdjson:"user_id" form:"user_id"%WithEC2MetadataDisableTimeoutOverrideڇ 2 d / @Ϝj2 d /3MPs2 d /Q Z2 d /kr12 d /;ȱ2 d /q2 d /T_k{2 d /NZw!2 d /=@G2 d / [2 d /R $2 d /02 d / U2 d /0Qe2 d /2 d /@ϜP@D2 d /;tU2 d /cJ`D2 d /J P2 d /> b 2 d /K2 d /*+2 d /hlB2 d /.`ԽY 2 d /2 d /@ǝ2f2 d /Da@̝2 d /;`_ 2 d /zm@Ÿ2 d /H2 d /)K;"]2 d /jdE2 d /z^s_2 d /C2 d /  wg2 d /8vG2 d /Za@K@(>2 d /;K[m2 d /paTcIl32 d /K`X2 d /C 2M2 d /m ʨA- 2 d /mLN2 d /m@L@42 d /@ԨX2 d /L uIy2 d / MӍ2 d /r WDb2 d /;&Uq2 d /`&_2 d /m'U;2 d /њ ::|2 d /\`_eF2 d /`Lg2 d /\@q\2 d /XRGu2 d /ҴwY 2 d /@T&dS2 d /Vj~@2 d /zչ2 d /X2 d /  .2 d / ˱2 d / `[2 d /; "P2 d /\n2 d /8L0S^\2 d /\M02 d /r>2 d /\}QU2 d /)2ʲ{2 d /G 3C$02 d /V`362 d /c @Ϝ Q2 d /@MbB2 d /P‘32 d / n2 d /'M ?2 d /Mnr2 d /0t3 d /v3 d /;`:B_3 d /UA`;JD3 d /r3 d /p(3 d /(@*3 d /$6"3 d /:3 d /el3 d /9r`AmJ3 d /e`Z33 d /{m3 d /2; 3 d /)ʨ3 d /`[3 d /#`@DT3 d /J]3 d /- WN3 d /ќ!423 d /rz3 d /r!6w3 d /` D3 d /5S3 d /~ഷs3 d / Й3 d /Y  Wsy#3 d /7@oV3 d / 3 d /¡=H3 d /] @3 d /c n3 d /@8E+B3 d / @;WE3 d /  b3 d /`T3 d /7!%3 d /`Y'>F3 d /% !}3 d /J 3 d /`(;3 d /`lQ3 d /@@((3 d /s@Y,~3 d / p0m13 d /nƪ3 d /@Ǫ>3 d /@z3 d /Rrz3 d /Ȋcp3 d /`Ƨ;M3 d /@`bYL3 d /A`0߮3 d /+ͧ!ư3 d /`!9(3 d /޸ Ǿd3 d /۷ @P3 d /rb3 d /:1n3 d /`6E03 d / `P(3 d /e`\3 d /m;3 d /  b3 d /:->3 d />U3 d / `^3 d /r iW3 d /@!3 d /X`(3 d / `)g3 d /:3 d /TrI3 d /o `*T853 d / @jy,3 d / Kr3 d / `c:3 d / `9QEX3 d / @}3 d / `kz83 d /9 I3 d / @u83 d /4 @b3 d /_`:3 d /  nۄ3 d /`>Y3 d /y $3 d /ٟ?|:3 d /or`F\3 d /Yh3 d /T3 d / [K3 d /@3 d /@  ۉ3 d /`3 d /;#~3 d /ιb3 d /"M23 d /!AǴRe3 d /;A@ȴm3 d /e:b3 d /T3 d /fxG%3 d /sz q3 d / ੡/N3 d / `n3 d /$*X3 d /1{3 d / @ \3 d /3ը3P3 d / @$c)3 d /I$,/3 d /$+P3 d / %J3 d /D@%N\=*3 d /h%Hr3 d /Ø %:3 d / &:z3 d /@&bv3 d / &~=k3 d / &f3 d /I 'p3 d / @'{h3 d / 'ߊv3 d /'P3 d /%(U3 d /,s+ 3 d /R5.K3 d /K@<+ 3 d /<˛ 3 d /=SW53 d /m@=W3 d /(=>3 d /=O3 d /D`>M\3 d /oA@> "G3 d / @? 3 d /ǥE/#l3 d /qJȔ;3 d /m@M/#l3 d /qV3 d /4e/3 d /_uAXp3 d /@z3 d /H|ti3 d /A@:x3 d /bs7E3 d /e`7E3 d /e`l%3 d /q3 d /\@?;P3 d /*f :3 d /L@Xu>3 d /9·3 d /3 d /*_ <3 d /#\i3 d /}sx*3 d /ޥǟ3 d /Gsȟ153 d /ʟ 3 d / `ҟ'23 d /@ӟ/3 d /%؟5`3 d /A3 d /0@io%3 d /`3 d /@@3 d /%@Bqa3 d /B zTx3 d /;23 d /%`<ՓX3 d /A3 d /lfT,3 d /t`%33 d /{'65߰3 d /ptgӳA3 d /%q.yF3 d /ۦ@hO3 d /tgh3 d /8i{D3 d /ga~3 d /@[Tc3 d /t 5ֵ3 d /v%3 d / @s3 d /0``B-3 d /B`Ba h3 d /M 3 d /  t$3 d /5 `nH̷3 d /~nT93 d /F  |%3 d /R; []3 d /,  @u3 d /q  .U@3 d /YǤ13 d /` `sV3 d / 483 d //cS3 d / Fg3 d /sysk3 d /!γ`3 d /t*3 d /T`b-3 d /`'z>Q3 d /`|h'I3 d / ~H13 d /:t (ȳ3 d /V`mq53 d /*s3 d /B{3 d /0 m3 d /x `a13 d /8 r3 d /  ]3 d /6 XD*3 d /83 d /^g* 3 d / +q^3 d /`+R(,3 d /Ħ+X3 d /f@Ũ3 d /V3 d /Hg 03 d /Hgٻ'3 d /] Pb^_3 d /?B0J3 d /t`޵쬂3 d /`Y¹3 d /A P+g3 d / BPsv3 d /;`7p3 d /ǨN?3 d /3 d / Q!z+3 d /:QZ3 d / /+33 d /VI<գ3 d /@Ƞy03 d / 6ƎG3 d /R83 d /g@qkߞ3 d /C;3 d /B1drk3 d /`ݎ3 d /p@Qg 93 d /q3 d /@%`:"3 d /I@Φ73 d /`3 d /eѨ`3 d /A@* 3 d /(  T3 d /NPw3 d /@ZH3 d / bp3 d /9\3 d /3 d /@oR!H3 d / G3 d /;Sd-3 d /`,e)3 d / 3 d / B3 d /;/p3 d /+%BUQ3 d / @רa x3 d /@Z[^3 d /רGK3 d /F بP3 d / ]WMk3 d /^83 d /` `^s5ٌ3 d /٨z3 d /j%`E:3 d /sE⃨3 d /  ڨ3 d / ^W3 d /N NYsN3 d / rٕ93 d / a@!=3 d /f @0M3 d /U% sz3 d /sB3 d /@f Vx3 d /s`D3 d /s`d3 d /`V3 d /x:3 d /? \q<3 d /` 5$^3 d /``I\_=3 d /53 d /!3 d /`:J3 d /Ut`ug3 d /Q "<3 d /f d|!3 d /y$*|3 d /f`$ʹe3 d /YBQ{#3 d /Vf93 d /k`&Ź} 3 d /&a|3 d / '#3 d /#'>X3 d /0g&3 d /H h/3 d /`hs\+3 d /`hW3 d /@^o3 d /p^o3 d /p [3 d / 5P3 d / 3 d /S  =?3 d /  D3 d /t`3 d /ՠ"}3 d /N%3 d /s OWH3 d /i`jgN3 d /a!`Ʒ'a'3 d /%,3 d /f`?4=>3 d /r; $v~3 d /q{ʥ3 d /%Yya3 d /fr3 d /g s3 d /BU w3 d /h VW3 d /243 d / 93 d /5 , i3 d /`m3 d /r!03 d /2gq=hK3 d /Nq3 d /t(t3 d /%~K"C83 d /`Z65$3 d /Zrn3 d /y3 d /%Z t3 d /l`3 d / [?.53 d /ͧ2iBE3 d /!2L3 d /! 3 $3 d /!`3}S'3 d /3}g3 d /f`3 3 d /C@rl#3 d /%B 5/p3 d /+% \GAI3 d /$P)3 d /8j;3 d / 4I)B3 d /7@9}3 d /N<3 d /cu@ڷji73 d />`=7c|3 d /@3 d /t6".3 d /v௷Z[3 d / v"Y&3 d /`Ü 3 d /e@r:S3 d /u8ms3 d /ќv3 d /wCԜk+͊3 d /h % 3 d /E 3 d /]Cw!i3 d /C`:v3 d /HuYJ3 d /~u22KQ3 d /U 3 d /:3 d /<`=k3 d /B*jI3 d /= AwS3 d /@w@YabT3 d /&ڠ#3 d / p3 d /ܡX3 d /$-p93 d /ڧ3 d /vƕv#3 d /wג;:3 d /fhܯS3 d /`<4~3 d /t)\3 d /(['g3 d /73 d /Q6T3 d /!B|hד3 d /R>@ﱭ3 d /h@ 3 d /4ߠ3 d /3 d /D@e6^3 d />@ӫ03 d /r>t3 d /3 d /-@n3 d /  .Gw3 d / `n6*@3 d /x*93 d /tn 3 d />x3 d /&EN3 d /Kkp3 d /x 3 d /Cd @3 d / F3 d /dd3 d /͢@@Y3 d /  |e3 d / 3 d /CdBz3 d /w`0:3 d /5+(%3 d /=3 d /KZ13 d /q0j3 d /<@03 d /F3 d /1 9ĒI3 d /  Xy3 d /iF.ǹ3 d /0D3 d /y.3 d /k2p03 d / 3G'3 d /`3$q3 d /3vw 3 d /!33 d / 4j3 d /!xʳ&vendor/golang_org/x/net/dns/dnsmessage&vendor/golang_org/x/net/http/httpproxy&*[4]struct { src []uint8; stride int }&*[]*descriptor.SourceCodeInfo_Location&*[]*sqs.DeleteMessageBatchRequestEntry&*[]map[string]*dynamodb.AttributeValue&*descriptor.FieldDescriptorProto_Label&*dynamodb.AutoScalingPolicyDescription&*dynamodb.ContinuousBackupsDescription&*dynamodb.RestoreTableFromBackupOutput&*dynamodb.UpdateContinuousBackupsInput&*func() ([]*plumbing.Reference, error)&*func() ([]dnsmessage.Question, error)&*func() ([]dnsmessage.Resource, error)&*func() ([]revision.Revisioner, error)&*func() (bsonrw.DocumentReader, error)&*func() (bsonrw.DocumentWriter, error)&*func() (dnsmessage.MXResource, error)&*func() (dnsmessage.NSResource, error)&*func() *annotations.CustomHttpPattern&*func() *channelz.ServerInternalMetric&*func() *channelz.SocketInternalMetric&*func() *descriptor.FieldOptions_CType&*func() annotations.isHttpRule_Pattern&*func() descriptor.FieldOptions_JSType&*func() func(*cobra.Command, []string)&*func() grpc_binarylog_v1.Address_Type&*func(*[]bool, string, []bool, string)&*func(*[]uint, string, []uint, string)&*func(*amqp.Channel, amqp.frame) error&*func(*dynamodb.ScanOutput, bool) bool&*func(*http.Request) (*url.URL, error)&*func(*net.IP, string, net.IP, string)&*func(*runtime.Frame) (string, string)&*func(*runtime.g, unsafe.Pointer) bool&*func(*strconv.decimalSlice, int) bool&*func(*string, string, string, string)&*func(*transport.goAway) (bool, error)&*func(*uint16, string, uint16, string)&*func(*uint32, string, uint32, string)&*func(*uint64, string, uint64, string)&*func(...color.Attribute) *color.Color&*func([]*string) *sqs.ListQueuesOutput&*func([]reflect.Value) []reflect.Value&*func(bool) *dynamodb.SSESpecification&*func(bool) *options.InsertManyOptions&*func(bool) *sqs.BatchResultErrorEntry&*func(chan<- error) chan *clog.Message&*func(context.Context) (string, error)&*func(context.Context, stats.RPCStats)&*func(docker.ExportImageOptions) error&*func(docker.ImportImageOptions) error&*func(docker.LogsServiceOptions) error&*func(docker.UpdateSwarmOptions) error&*func(func(http2.Setting) error) error&*func(func(object.Object) error) error&*func(func(plumbing.Hash) error) error&*func(func(string) bool) reflect.Value&*func(func(time.Duration)) *aws.Config&*func(image.Rectangle) image.Rectangle&*func(int, int, *syscall.IPMreq) error&*func(int, int, *syscall.Linger) error&*func(int, textproto.MIMEHeader) error&*func(int32) *options.AggregateOptions&*func(int64) *dynamodb.ListTablesInput&*func(interface {}, interface {}) bool&*func(io.Reader) (image.Config, error)&*func(io.Writer, *packet.Config) error&*func(macaron.Handler) macaron.Handler&*func(map[string]*string) *sqs.Message&*func(parse.Pos) *parse.IdentifierNode&*func(request.HandlerListRunItem) bool&*func(string) (*common.Profile, error)&*func(string) (*docker.Network, error)&*func(string) (*openpgp.Entity, error)&*func(string) ([]docker.Change, error)&*func(string) ([]time.Duration, error)&*func(string) (dns.netResolver, error)&*func(string) *dynamodb.AttributeValue&*func(string) *dynamodb.ConditionCheck&*func(string) *dynamodb.RestoreSummary&*func(string) *dynamodb.SSEDescription&*func(string) *sqs.ReceiveMessageInput&*func(string, *http.PushOptions) error&*func(string, *tls.ClientSessionState)&*func(string, int32) []*trace.SpanData&*func(string, string) ([]uint8, error)&*func(string, string) opentracing.Span&*func(string, string, ...interface {})&*func(toml.marshalOrder) *toml.Encoder&*func(uint16, []uint8) tls.macFunction&*func(uint32, http.http2ErrCode) error&*func(uint32, http.http2PriorityParam)&*func(unsafe.Pointer, uintptr) uintptr&*grpc_binarylog_v1.GrpcLogEntry_Logger&*map.bucket[*parse.ActionNode][]string&*map.bucket[*parse.TemplateNode]string&*map.bucket[bsontype.Type]reflect.Type&*map.bucket[capability.Capability]bool&*map.bucket[context.canceler]struct {}&*map.bucket[ghw.MemoryCacheType]string&*map.bucket[gob.typeId]**gob.decEngine&*map.bucket[hpack.pairNameValue]uint64&*map.bucket[http.http2FrameType]string&*map.bucket[http.http2SettingID]string&*map.bucket[int32]*proto.ExtensionDesc&*map.bucket[int64]*channelz.subChannel&*map.bucket[int64]*packfile.objectInfo&*map.bucket[interface {}]*list.Element&*map.bucket[logrus.Level][]logrus.Hook&*map.bucket[net.hostLookupOrder]string&*map.bucket[reflect.Kind]gob.decHelper&*map.bucket[reflect.Kind]gob.encHelper&*map.bucket[reflect.Type]*gob.typeInfo&*map.bucket[reflect.Type]reflect.Value&*map.bucket[reflect.Type]types.IntMode&*map.bucket[resolver.Address]struct {}&*map.bucket[string]*dynamodb.Condition&*map.bucket[string]*http.http2dialCall&*map.bucket[string]*plumbing.Reference&*map.bucket[string]*unicode.RangeTable&*map.bucket[string]chan *amqp.Delivery&*map.bucket[string]chan ssh.NewChannel&*map.bucket[string]docker.NetworkStats&*map.bucket[string]encoding.Compressor&*map.bucket[string]knownhosts.KnownKey&*map.bucket[string]transport.Transport&*map.bucket[string]yaml.resolveMapItem&*map.iter[*view.viewInternal]struct {}&*map.iter[plumbing.ReferenceName]error&*map.iter[uint32]*http.http2writeQueue&*map[*grpc.acBalancerWrapper]struct {}&*map[http2.FrameType]http2.frameParser&*map[ini.ASTKind]map[ini.TokenType]int&*map[int64]*connection.commandMetadata&*map[metricproducer.Producer]struct {}&*map[reflect.Type]*proto.unmarshalInfo&*map[reflect.Type]proto.defaultMessage&*map[resolver.Address]balancer.SubConn&*map[string]*sqs.MessageAttributeValue&*map[string]bsoncodec.fieldDescription&*options.EstimatedDocumentCountOptions&*pubsub.ListTopicSubscriptionsResponse&*pubsub.Subscriber_StreamingPullClient&*sqs.ChangeMessageVisibilityBatchInput&*struct { F uintptr; R *flag.FlagSet }&*struct { F uintptr; R *logrus.Entry }&*struct { F uintptr; R *net.Resolver }&*struct { F uintptr; R rand.Source64 }&*struct { F uintptr; d time.Duration }&*struct { F uintptr; errc chan error }&*struct { F uintptr; errs chan error }&*struct { F uintptr; f *flag.FlagSet }&*struct { F uintptr; h plumbing.Hash }&*struct { F uintptr; n *[]nodes.Node }&*struct { F uintptr; result *[][]int }&*struct { F uintptr; tf reflect.Type }&*struct { F uintptr; unhandled *bool }&*struct { anchor []uint8; alias bool }&*struct { cycle uint32; flushed bool }Addresstype:"string" required:"true"Adminjson:"is_admin" form:"is_admin"AppURLmapstructure:"application_url"BackupExpiryDateTimetype:"timestamp"CertIssuerPublicKeyjson:",omitempty"&DescribeGlobalTableSettingsWithContext DockerCapsmapstructure:"docker_caps"DriverConfigurationjson:",omitempty" Endpointsmapstructure:"db_endpoints" Endpointstype:"list" required:"true"GlobalTableNamemin:"3" type:"string"HTTPAddrmapstructure:"listenaddress" IndexesBeforebson:"numIndexesBefore"LastDecreaseDateTimetype:"timestamp"LastIncreaseDateTimetype:"timestamp" MaxPathLenasn1:"optional,default:-1"NetworksAttachmentsjson:",omitempty" OSVersionjson:"os.version,omitempty"Ownerjson:"owner_id" form:"owner_id"Plannedjson:"planned" form:"planned"PrivKeyjson:"privkey" form:"privkey"ReceiveRequestAttemptId type:"string"&SetReplicaGlobalSecondaryIndexSettings&SetReplicaProvisionedReadCapacityUnits&SetReturnValuesOnConditionCheckFailureStatustype:"string" enum:"SSEStatus"Storagejson:"storage" form:"storage"SubjectUniqueIdasn1:"optional,tag:2"TableIdtype:"string" required:"true"TimeOutjson:"timeout" form:"timeout"'**pubsub.ListTopicSubscriptionsResponse'*[]*descriptor.EnumValueDescriptorProto'*[]*dynamodb.GlobalSecondaryIndexUpdate'*[]*dynamodb.ReplicaSettingsDescription'*[]edwards25519.PreComputedGroupElement'*dynamodb.UpdateContinuousBackupsOutput'*func() (*hpack.Encoder, *bytes.Buffer)'*func() (*packfile.ObjectHeader, error)'*func() (*pubsub.SnapshotConfig, error)'*func() (*topology.Subscription, error)'*func() ([]*vagrantutil.Vagrant, error)'*func() ([]result.EndSessions, []error)'*func() (bsontype.Type, []uint8, error)'*func() (dnsmessage.PTRResource, error)'*func() (dnsmessage.SOAResource, error)'*func() (dnsmessage.SRVResource, error)'*func() (dnsmessage.TXTResource, error)'*func() (plumbing.EncodedObject, error)'*func() *channelz.ChannelInternalMetric'*func() *descriptor.FieldOptions_JSType'*func() *grpc_binarylog_v1.ClientHeader'*func() *grpc_binarylog_v1.GrpcLogEntry'*func() *grpc_binarylog_v1.ServerHeader'*func(*agenttasks.Task) (string, error)'*func(*dynamodb.QueryOutput, bool) bool'*func(*edwards25519.CachedGroupElement)'*func(*object.Commit) object.CommitIter'*func(*pubsub.Subscription) *iam.Handle'*func(...string) (bson.RawValue, error)'*func([]*string) *dynamodb.GetItemInput'*func([]uint8) *dynamodb.AttributeValue'*func(agenttasks.Executor) (int, error)'*func(bool) *dynamodb.KeysAndAttributes'*func(context.Context, *pubsub.Message)'*func(context.Context, stats.ConnStats)'*func(context.Context, time.Time) error'*func(docker.EnablePluginOptions) error'*func(docker.ExportImagesOptions) error'*func(docker.RemoveConfigOptions) error'*func(docker.RemoveSecretOptions) error'*func(docker.RemoveVolumeOptions) error'*func(func(*object.Commit) error) error'*func(func(string, string) error) error'*func(http.http2PushPromiseParam) error'*func(int, int) []timeseries.Observable'*func(int, int, *syscall.IPMreqn) error'*func(int64) *channelz.SubChannelMetric'*func(int64) *dynamodb.ListBackupsInput'*func(int64) *dynamodb.TableDescription'*func(io.Reader) (digest.Digest, error)'*func(io.Writer) (int64, uint32, error)'*func(io.Writer, map[string]bool) error'*func(map[string]*string) *dynamodb.Get'*func(map[string]*string) *dynamodb.Put'*func(plumbing.Hash) (time.Time, error)'*func(plumbing.ObjectType, int64) error'*func(resolver.Builder) grpc.DialOption'*func(string) (*tasks.TaskState, error)'*func(string) (billy.Filesystem, error)'*func(string) (jmespath.ASTNode, error)'*func(string) *dynamodb.DeleteItemInput'*func(string) *dynamodb.ListTablesInput'*func(string) *dynamodb.UpdateItemInput'*func(string) *options.AggregateOptions'*func(string, *docker.HostConfig) error'*func(string, []uint8) ([]uint8, error)'*func(string, []uint8, string) *[]uint8'*func(string, float32, string) *float32'*func(string, float64, string) *float64'*func(string, primitive.ObjectID) error'*func(string, request.ErrInvalidParams)'*func(string, string) (net.Conn, error)'*func(string, string, int, string) *int'*func(time.Duration) description.Server'*func(timeseries.Observable, time.Time)'*grpc_binarylog_v1.GrpcLogEntry_Message'*grpc_binarylog_v1.GrpcLogEntry_Trailer'*http.http2PriorityWriteSchedulerConfig'*http.http2write100ContinueHeadersFrame'*map.bucket[interface {}][]interface {}'*map.bucket[logging.Level]logging.Color'*map.bucket[plumbing.Hash]*list.Element'*map.bucket[plumbing.Hash]idxfile.Index'*map.bucket[plumbing.ReferenceName]bool'*map.bucket[reflect.Value]reflect.Value'*map.bucket[runtime._typePair]struct {}'*map.bucket[string]*config.RemoteConfig'*map.bucket[string]*knownhosts.KnownKey'*map.bucket[string]internal.CommandInfo'*map.bucket[string]template.contentType'*map.bucket[string]view.AggregationData'*map.bucket[token.Pos]*ast.CommentGroup'*map.bucket[uint32]*transport.outStream'*map.hdr[anagent.TimerID]*anagent.Timer'*map.hdr[string][]*http.http2ClientConn'*map.hdr[string][]*multipart.FileHeader'*map.hdr[uint32]*http.http2clientStream'*map.hdr[uint64]chan description.Server'*map[jwalterweatherman.Threshold]string'*map[plumbing.Hash]*packfile.deltaIndex'*map[plumbing.Hash]*packfile.objectInfo'*map[proto.extPropKey]*proto.Properties'*map[scram.KeyFactors]scram.derivedKeys'*map[string]*dynamodb.KeysAndAttributes'*sqs.ChangeMessageVisibilityBatchOutput'*struct { F uintptr; R *http.response }'*struct { F uintptr; R *tar.formatter }'*struct { F uintptr; R http.http2gate }'*struct { F uintptr; authority string }'*struct { F uintptr; bounds []float64 }'*struct { F uintptr; c *cobra.Command }'*struct { F uintptr; c *runtime.hchan }'*struct { F uintptr; d *dotgit.DotGit }'*struct { F uintptr; e *runtime.eface }'*struct { F uintptr; f *pflag.FlagSet }'*struct { F uintptr; f *tar.formatter }'*struct { F uintptr; fr *http2.Framer }'*struct { F uintptr; min int; max int }'*struct { F uintptr; notCreated *bool }'*struct { F uintptr; preemptible bool }'*struct { F uintptr; startTime *int64 }'*struct { F uintptr; x *reflect.rtype }'*struct { Struct string; Field string }'*struct { signalLock uint32; hz int32 } Attributesjson:"attributes,omitempty"BrokerExchangemapstructure:"exchange"'ChangeMessageVisibilityBatchWithContextCredentialScopejson:"credentialScope"CursorsNotFoundbson:"cursorsNotFound"DataTypetype:"string" required:"true"DiscreteResourceSpecjson:",omitempty" ElectionIDbson:"electionId,omitempty"Enabledtype:"boolean" required:"true" HideCountsjson:"hidecounts,omitempty"ItemCollectionMetricstype:"structure"LatestStreamArnmin:"37" type:"string" Percentagejson:"percentage,omitempty"ProvisionedThroughputtype:"structure"QueueUrltype:"string" required:"true"'SetReplicaProvisionedWriteCapacityUnits SetVersionbson:"setVersion,omitempty"SourceBackupArnmin:"37" type:"string"TimeToLiveDescriptiontype:"structure"UseLatestRestorableTimetype:"boolean"(github.com/MottainaiCI/mottainai-cli/cmd(vendor/golang_org/x/text/secure/bidirule(*[8]edwards25519.PreComputedGroupElement(*[][]map[string]*dynamodb.AttributeValue(*[]func(macaron.Handler) macaron.Handler(*descriptor.GeneratedCodeInfo_Annotation(*descriptor.UninterpretedOption_NamePart(*dynamodb.AutoScalingSettingsDescription(*dynamodb.DescribeContinuousBackupsInput(*dynamodb.LocalSecondaryIndexDescription(*dynamodb.PointInTimeRecoveryDescription(*dynamodb.RestoreTableToPointInTimeInput(*dynamodb.UpdateGlobalTableSettingsInput(*func() (dnsmessage.AAAAResource, error)(*func() (memory.ReferenceStorage, error)(*func() (token.Pos, token.Token, string)(*func() (uint32, uint32, uint32, uint32)(*func() (wiremessage.WireMessage, error)(*func() credentials.TransportCredentials(*func() func(*url.URL) (*url.URL, error)(*func() func(io.Writer, ...interface {})(*func(*[]uint8, string, []uint8, string)(*func(*big.Float, *big.Float) *big.Float(*func(*big.Int) (*big.Int, big.Accuracy)(*func(*big.Rat) (*big.Rat, big.Accuracy)(*func(*cryptobyte.String, asn1.Tag) bool(*func(*float32, string, float32, string)(*func(*float64, string, float64, string)(*func(*git.SubmoduleUpdateOptions) error(*func(*idxfile.MemoryIndex) (int, error)(*func(*int, string, string, int, string)(*func(*parse.Tree) *parse.IdentifierNode(*func(*session.TransactionOptions) error(*func(*tar.Header, string) (bool, error)(*func(...string) (bsoncore.Value, error)(*func([]*string) *sqs.AddPermissionInput(*func([]uint8) (int, *net.IPAddr, error)(*func([]uint8, *net.IPAddr) (int, error)(*func([]uint8, []uint8) ([]uint8, error)(*func(bsonrw.ValueWriter, []uint8) error(*func(chan *amqp.Error) chan *amqp.Error(*func(chan amqp.Return) chan amqp.Return(*func(client.HttpClient) agenttasks.Task(*func(docker.DisablePluginOptions) error(*func(docker.InstallPluginOptions) error(*func(docker.KillContainerOptions) error(*func(docker.RemoveServiceOptions) error(*func(func(*cobra.Command, error) error)(*func(func(int, interface {}) bool) bool(*func(http.http2HeadersFrameParam) error(*func(int, int, *syscall.IPv6Mreq) error(*func(int32) *options.ListIndexesOptions(*func(interface {}) (interface {}, bool)(*func(interface {}) *options.FindOptions(*func(io.Writer) (io.WriteCloser, error)(*func(logrus.Level, *logrus.Entry) error(*func(namespace.Namespace, string) error(*func(plumbing.Hash) (billy.File, error)(*func(redis.Conn, ...interface {}) error(*func(reflect.Value, reflect.Value) bool(*func(ssh.RejectionReason, string) error(*func(string) (*docker.Container, error)(*func(string) (*object.TreeEntry, error)(*func(string) (event.APIResponse, error)(*func(string) (map[string]string, error)(*func(string) (os.FileInfo, bool, error)(*func(string) *dynamodb.ConsumedCapacity(*func(string) *dynamodb.CreateTableInput(*func(string) *dynamodb.DeleteTableInput(*func(string) *dynamodb.KeySchemaElement(*func(string) *dynamodb.ListBackupsInput(*func(string) *dynamodb.ListTablesOutput(*func(string) *dynamodb.SSESpecification(*func(string) *dynamodb.TableDescription(*func(string) *dynamodb.TagResourceInput(*func(string) *dynamodb.UpdateTableInput(*func(string) *sqs.BatchResultErrorEntry(*func(string) *sqs.MessageAttributeValue(*func(string) *sqs.RemovePermissionInput(*func(string) *sqs.SendMessageBatchInput(*func(string, interface {}) interface {}(*func(string, request.NamedHandler) bool(*func(string, string) (io.Writer, error)(*func(string, string) *config.Subsection(*func(string, string) *template.Template(*func(time.Time) *dynamodb.BackupDetails(*func(time.Time) *dynamodb.BackupSummary(*func(uint32, http2.PriorityParam) error(*map.bucket[*view.viewInternal]struct {}(*map.bucket[*view.viewInternal]time.Time(*map.bucket[color.Attribute]*color.Color(*map.bucket[digest.Algorithm]crypto.Hash(*map.bucket[ghw.StorageController]string(*map.bucket[int32]*proto.marshalElemInfo(*map.bucket[int64]*channelz.listenSocket(*map.bucket[int64]*channelz.normalSocket(*map.bucket[interface {}][]reflect.Value(*map.bucket[plumbing.ReferenceName]error(*map.bucket[string]measurable.Measurable(*map.bucket[uint32]*http.http2writeQueue(*map.hdr[*http.http2serverConn]struct {}(*map.iter[anagent.TimerID]*anagent.Timer(*map.iter[string][]*http.http2ClientConn(*map.iter[string][]*multipart.FileHeader(*map.iter[uint32]*http.http2clientStream(*map.iter[uint64]chan description.Server(*map[balancer.SubConn]connectivity.State(*map[reflect.Kind]bsoncodec.ValueDecoder(*map[reflect.Kind]bsoncodec.ValueEncoder(*map[reflect.Type]*proto.marshalElemInfo(*map[reflect.Type]bsoncodec.ValueDecoder(*map[reflect.Type]bsoncodec.ValueEncoder(*map[uint64]*connection.pooledConnection(*struct { F uintptr; R *common.session }(*struct { F uintptr; R *exec.closeOnce }(*struct { F uintptr; R *http.Transport }(*struct { F uintptr; R *macaron.Router }(*struct { F uintptr; R *toml.tomlLexer }(*struct { F uintptr; ar *packp.AdvRefs }(*struct { F uintptr; bp *int; s string }(*struct { F uintptr; buf *bytes.Buffer }(*struct { F uintptr; c *runtime.mcache }(*struct { F uintptr; conf *net.nssConf }(*struct { F uintptr; elemOp *gob.decOp }(*struct { F uintptr; h *signal.handler }(*struct { F uintptr; s **runtime.mspan }(*struct { F uintptr; v []reflect.Value }(*struct { laddr net.TCPAddr; value int } AccessTokenmapstructure:"access_token"AppNamemapstructure:"application_name"BackupCreationDateTimetype:"timestamp"Broker yaml:"broker" envconfig:"BROKER"DistributionPointasn1:"optional,tag:0"EndTimejson:"end_time" form:"end_time"GlobalSecondaryIndexUpdates type:"list"GlobalTableDescriptiontype:"structure" IdleTimeoutmapstructure:"idle_timeout" LxdEndpointmapstructure:"lxd_endpoint" LxdProfilesmapstructure:"lxd_profiles" MessageIdtype:"string" required:"true"NetworkAttachmentSpecjson:",omitempty" OSFeaturesjson:"os.features,omitempty"OwnerIdjson:"owner_id" form:"owner_id" QueueNametype:"string" required:"true" ReadTimeoutmapstructure:"read_timeout"StaticRootPathmapstructure:"root_path" StoragePathmapstructure:"storage_path"Wait"yaml:"wait" envconfig:"REDIS_WAIT")*[1]func(macaron.Handler) macaron.Handler)*[8][]map[string]*dynamodb.AttributeValue)*[]*dynamodb.AutoScalingPolicyDescription)*[]*options.EstimatedDocumentCountOptions)*descriptor.DescriptorProto_ReservedRange)*dynamodb.DescribeContinuousBackupsOutput)*dynamodb.GlobalSecondaryIndexDescription)*dynamodb.RestoreTableToPointInTimeOutput)*dynamodb.UpdateGlobalTableSettingsOutput)*func() (dnsmessage.CNAMEResource, error))*func() (result.TransactionResult, error))*func() (storer.EncodedObjectIter, error))*func() (string, bsoncore.Document, bool))*func() (string, object.TreeEntry, error))*func() *descriptor.ExtensionRangeOptions)*func() []*descriptor.EnumDescriptorProto)*func() []*descriptor.FileDescriptorProto)*func() []*descriptor.UninterpretedOption)*func() credentials.ChannelzSecurityValue)*func() func(*cobra.Command, error) error)*func(*cryptobyte.String, *asn1.Tag) bool)*func(*dynamodb.DescribeTableInput) error)*func(*edwards25519.ExtendedGroupElement))*func(*http.http2priorityNode, bool) bool)*func(*net.TCPAddr) (net.Listener, error))*func(*pubsub.StreamingPullRequest) error)*func([]*string) *dynamodb.AttributeValue)*func([]*string) *sqs.ReceiveMessageInput)*func([][]uint8) *dynamodb.AttributeValue)*func([]uint8) (dnsmessage.Header, error))*func([]uint8) (int, *net.UDPAddr, error))*func([]uint8) *sqs.MessageAttributeValue)*func([]uint8, *net.UDPAddr) (int, error))*func([]uint8, []uint8, []uint8, []uint8))*func([]uint8, properties.Encoding) error)*func(bool) *dynamodb.StreamSpecification)*func(bool) *options.ListDatabasesOptions)*func(context.Context, *iam.Policy) error)*func(float64) *dynamodb.ConsumedCapacity)*func(hash.Hash, *packet.Signature) error)*func(http.ResponseWriter, *http.Request))*func(http.http2SettingID) (uint32, bool))*func(idtools.Identity) (int, int, error))*func(int) (int, syscall.Sockaddr, error))*func(int32) *options.ChangeStreamOptions)*func(int64) *dynamodb.SourceTableDetails)*func(interface {}) *mongo.DeleteOneModel)*func(interface {}) *mongo.InsertOneModel)*func(interface {}) *mongo.UpdateOneModel)*func(interface {}) *options.CountOptions)*func(interface {}) *options.IndexOptions)*func(io.Writer, string, ...interface {}))*func(net.Conn, *http.http2ServeConnOpts))*func(net.Listener, string, string) error)*func(plumbing.Hash) (*object.Tag, error))*func(plumbing.Hash) (os.FileInfo, error))*func(proto.Message, *proto.Buffer) error)*func(string) (*template.Template, error))*func(string) ([]*tasks.Signature, error))*func(string) (bsonrw.ValueWriter, error))*func(string) (credentials.Bundle, error))*func(string) (reflect.StructField, bool))*func(string) *dynamodb.BatchGetItemInput)*func(string) *dynamodb.CreateBackupInput)*func(string) *dynamodb.DeleteBackupInput)*func(string) *dynamodb.KeysAndAttributes)*func(string) *dynamodb.ListBackupsOutput)*func(string, []net.IP, string) *[]net.IP)*func(string, []string, string) *[]string)*func(string, func(), ...macaron.Handler))*func(string, func(string) string) string)*func(string, interface {}) *logrus.Entry)*func(string, string) (billy.File, error))*func(string, string, bool, interface {}))*func(string, string, bool, string) *bool)*func(string, string, int8, string) *int8)*func(string, string, uint, string) *uint)*func(string, time.Time, time.Time) error)*func(time.Duration) *options.FindOptions)*func(time.Time) *dynamodb.RestoreSummary)*func(uint32, io.Reader) ([]uint8, error))*grpc_binarylog_v1.GrpcLogEntry_EventType)*grpc_binarylog_v1.isGrpcLogEntry_Payload)*interface { IsHTTP2NoCachedConnError() })*map.bucket[reflect.Type]*proto.mergeInfo)*map.bucket[reflect.Type]*yaml.structInfo)*map.bucket[string]*docker.EndpointConfig)*map.bucket[string]*http.http2addConnCall)*map.bucket[string]*proto.OneofProperties)*map.bucket[string]jmespath.functionEntry)*map.bucket[unsafe.Pointer]unsafe.Pointer)*map.hdr[address.Address]*topology.Server)*map.hdr[chan<- os.Signal]*signal.handler)*map.hdr[docker.Port][]docker.PortBinding)*map.hdr[interface {}]measurable.HookFunc)*map.hdr[pflag.NormalizedName]*pflag.Flag)*map.hdr[uint64]chan description.Topology)*map.iter[*http.http2serverConn]struct {})*map[http.connectMethodKey]chan struct {})*map[plumbing.Hash]*packfile.ObjectToPack)*map[reflect.Type]*proto.StructProperties)*map[string]*binarylog.methodLoggerConfig)*pubsub.isPushConfig_AuthenticationMethod)*struct { F uintptr; R *bundler.Bundler })*struct { F uintptr; R *http.atomicBool })*struct { F uintptr; R *http.connReader })*struct { F uintptr; R *idxfile.Encoder })*struct { F uintptr; R *json.mapEncoder })*struct { F uintptr; R *json.ptrEncoder })*struct { F uintptr; R *request.Request })*struct { F uintptr; R *ssh.CertChecker })*struct { F uintptr; R *toml.tomlParser })*struct { F uintptr; as *bytes.asciiSet })*struct { F uintptr; b *bundler.Bundler })*struct { F uintptr; b resolver.Builder })*struct { F uintptr; cancelc chan error })*struct { F uintptr; dirs []os.FileInfo })*struct { F uintptr; h func() hash.Hash })*struct { F uintptr; info *gob.typeInfo })*struct { F uintptr; list []os.FileInfo })*struct { F uintptr; p *printer.printer })*struct { F uintptr; refNames *[]string })*struct { F uintptr; req client.Request })*struct { F uintptr; s *topology.Server })*struct { F uintptr; t *agenttasks.Task })*struct { Name string; KeyBytes []uint8 })*struct { Nonce string "bson:\"nonce\"" } Annotationsjson:"annotations,omitempty" ArbiterOnlybson:"arbiterOnly,omitempty"AutoScalingRoleArnmin:"1" type:"string" Compressionbson:"compression,omitempty"Hostnamejson:"hostname" form:"hostname"ID%json:"identity_id" form:"identity_id"Init#json:",omitempty" yaml:",omitempty"Keys#min:"1" type:"list" required:"true"Name#json:"Name" yaml:"Name" toml:"Name"Passwordjson:"password" form:"password"Progressjson:"progressDetail,omitempty"Providerjson:"provider" form:"provider" PublicKeyasn1:"optional,explicit,tag:1" RegionNametype:"string" required:"true"TimeToLiveSpecificationtype:"structure" d /`:q d /5* d / @Y+  d /@4{Y d /w5rL{ d /4 Eg$ d /$R@E+İ d /FE' d /*@Mj d / e@VPw0 d /d@a d /8Ubt  d /bҟcߊ d /Š@d4q d /ce졻 d /I;fDW d /Itgm d /Ԡu d /c`BvU d /cB@voW d /$v; d /,c:'l d /U* d /ѹ* d /   d / O< d /J!Iz d /0 d /% 3^ d /%`3l d /`3o d /:c3@ d /:R4ř d /1 6 Q8I1 4e20/&3@do/Hc3d(/3@dXML-x/h4dl#j` H@TQjȫ/3OY"Ы/3d1L,/4fj/4gb=X/3 {@PB=/djȾf@/PR@2@?l&@/%`'ӟl//4m((u[. 2fR@Y+ ((4z 2T`@; ( gs /7Z 9/`k (H/ /_`&ҟ PLN쬰3Vc0@ 6譖/dc2@ vx/(%3 <Ny3p/4 S豖/4pq/ֽ &ϟqR?PA0@qir/4u,$I/@`Bv |!,x0 d 5|Rp@ ,.O/5%&ҟ XTK>F)3rc0@ 0/B%3 B:tر/4 X60/4{TA0@~c@/4~|x/O%;f K==ǎ`@Q*1=ގ@U UQ/\%;fgN)/@`Bv%/( ӳRg/d@i@us'&ȫAc1kg(/.2@/= 3MK/c3E/3@%/(ճGZ0>3S 9/c300Ld!Ȱ2R@Y+ ЖЭ/H੡Y `X貖/}1 ``vQiȋt4h'@ӟ `\3FЋ3c0@ PHT d ;Yc@ [/c2@ ~xP/i%3 H /4 Ҍd/nU 3($KM؋BL@0@ tz(/@(P> T!X!=J~]4402R@Y+ huz苖/[B@v 4\XȌ/v%&ҟ 6 h/%@3 Nh/#4 Hu /: 5 +Rsج/j3BAd /y2@pM /d9[q/39"#\*?@/2@r:/@47;/c3?Ь/l`'ӟpp}q d 5Q@rplL5D5c0@X d 8 "W@'Ь/%3TH</h4d0Ө/X 5UR/3<?/2@x7X/Ւ@OV8UIӟ~mi!8R@ h@ (/%3Z^/4*/ 5J@/c3R_l~/dl@G_/Y2@@@@3^g2R`@Q:]pȫ/j Yx/|`[@e]S/ nl+㰅/`mo-q/@@KI΅/UB@$ L!/j`&ҟ@^,/%&ҟ d 7ٟcЭ/\ )@0 d =Lʯ aC/c2@@M/c@ 3E9/c`3}5G d /%3`hz3貖/ď4R`\Э/ۏ 5@KI΅/U \N/ d3 Jxb૖/p4,@h論/4| | QdhS8Kଖ/ e`U/ġB@v(h%</ @DLO/%@&ҟ%\6d0@/(d`3i[/6d3/ 5Â&謖/)@HOh[ /Dd 3/%3l|0p~/4yX/  5Ѫ/Rd3t;(/4J>ȭ/ 3JT_ P/c{T_ P/c 7{N#/`d30ح/nd3L[H/u`&ҟL]kH/%&ҟ4Kɍ87|k8M6|d@0@L.l=H/d 31Y/%3u1 d /3@I W*c1 d /௷  d11 d /U@@41 d /7`"x1 d /R@)zTr1 d /^`)1 d / @`*1 d /1+*1 d /s@Y+eS1 d /4*@-3V1 d /E@1@.hAT31 d /%e@1Clj1 d /@3{1 d /-i3oM1 d /̝BO(o1 d /Cp*1 d /3@C' 1 d /`.FNT1 d /`t@G@o_: d /WV@p40 d 82It d /xu1 d / y$Z /} G% d /e@5)(/J ,$k d 0dND d /S^נ d /1J40ʗ, d 82U#X d /ve۫v6 d /ĨWk d /ӡ M3ӱJ d /N@@4 d /e@I d /,S  nXx d /XSΥ@$$00pq@ 4]8/1q?> d /[e @e d /1RP d /F 4ӫ d /e@` d /U@T@ q@/@` te d /0 aH0{SUP/@0@o d /@Ѩ@KRX/|n+H=`/HM1 d /N d /d ]^ d /UԨ@ d /@ M d / VVh/ UPb d /SZ4b1 d /U Ÿgp/@S@Ÿ kUڧx/@e ,ß2X d /1@şm^ d /@Ɵ& 譖/ǟ* d / ɟvv/BS@ @ʟT d /N`&ҟA*c d / &ҟ[ ? d / 'ҟP[ d /Y '@ӟRx d /P`ԟ0 d /`@@ԟ< d / (؟6 d /`j@ٟ d /@Nٟ]$ d /l V@  d / S_32P/  9 d /0_+/a@  ĸb  d /% 0@G N /` @~ d /~@C3// 3 ~iz/@  R d /& 37 d /&`316 d / 3a d /d3@Җhnh/nS4 'P/S 5{1 d /  4i d /b XX G32 ұ`A/d3=/d390/d`3~譖/& 3xBX/4h!f/&ҟZBB 4`O@ 0@Z4 H/0 3V`8 '@ӟ~Rh/4XX`4x hh80 '@ӟ풹h/,&@ 3/4ҿ/2@ _ ]u/3_ 凃/ B@vwȌ7e 0@Ȭ/444/e3Mo/$e3pЌ72e0@0AȰ/@e2@Њ}/9&@3 m0(/K 5 j/e>>b8`M-^ 9މ،C-0@S/Ne3*ȫAD:*ȫAD@Y w d Ee'k/F&;fw)C/@`Bvȫ/`&ҟKd/S&`'ӟ0"aȫ/`W ȫ/`&2x/<2@8}aȫ/K 3j t/Z`3/\e3ث/i 3 ;6cЮ/x3 dd`-9 d 5rdd{ d 5sdd. d 5@y.茖9X@X8je0@L/m&3q/b4H讖/3m஖/xe3FI/2@\Z0/gh4hh/e2@+9l'@ӟS8e@0@h/4xh0/e&ҟh 8/`&ҟ pLM/`-@pa/`&ҟv,x/e`3>s /z&3x5`/y4&ŪeP/e3&P08/`'ӟt@/e 3.18/&3~1 d /M2pD J`/S` @\!1 d /ee0/Gr7JY d 6 ϴ~00]0  /2@J0(s d 0@ 6jd`@/g2!H/@ D d /* c d /e@V, d /U@T@_U0 d /2@@fP1SPGX/xV Ө 2?N`/e Sl d /@ #D'h d /V@-P}m d /`EET d /Eu d /U Ÿ Lh/E@Ɵ0(] d X124 GΟu d /X`&ҟ& d /&ҟ,Yp/@'@ӟ3x/`ԟ>/@@ԟ\ d /;؟hx/X@ݟg" d /e`*ߟ#/@nߟ d /˓ V@i/ 9 .<0Sy(k9Q / ӱ PX/&0@80 d 2 \ d /Ց}!= d /T}@8;B d /Z@`1! d /y UI d /&2@c} d /& 36 d /&`3F d /3 d /e3@ 5uP/T4}h8/4T 5 ;u d /o 4D. d /S 5/`@'~m / 2@ / lh/f3/mw/2 40xBX/&&ҟQ(`/`'ӟx+EX/f 3]/`/&@3h!%}p/`&ҟ<=/ f3=D㭁/@(\9.f0@pC/4t௖/ 5D㭁/`$/% 3'5JT`@Q Mg51R xx// /@] 79/H@ T]/&&ҟ 9/B@v!8Ix:ff0@! 'Jȍ/] @W@!I/3@!xୖ/v4!aK1/ 5!pЍ/âB@v"Ń/}@" 0W؍:tf0@"@EP/ 5"j$P/4g1/ 5#@ 0/@h$Jhdد/&3$ʕb/Ғ 5$}X|p/4%అ,/ 5&` y{/@0`N(/Ң 384?X;f@0@''y3/ '3'!v^/ 5' V*P/@Y+ nP/Jl#/0`6^$Xy d /fetX/;f#=荖/u887 d ;3 H@_W d 0.@Ϝ//`T@ XU*A/3`  P/E`-@ ;P/73``}/+$U d /vTΥ@nM/cx@Ȩ$ YG&02`Q//f@ E42P/"V@@T@``?Q 46S 4> d / 0$ b d 0\@  -6 d / @Œ/Iʟ cFP/b`&ҟ 2sP/&ҟB/ 'ҟ /ޓ@'@ӟ8e3(/@@@ԟ ," d /'Tߟ09 Ȱ/۾{CiB0/#'0@<4 81G  7P/0' 3('$^/='`3¹RX/,3 /P/f@ 3@|Z/T4$(V'mد/T 5WiH/f3 `/3@mc@/ B@v(( /J'3(L/s4(w_p/f3JC/f3 pȮ/4+ / 5+TV/4,xEв/2@-K/W'3-xtBHH<f 0@/0?YȰ/d'30@nX/ϓ 50S d /@Y+W d /<A0^ d /`@QW d /`\@Y@H/P੡Y0(  d X1Пc0(g d X1feԏ d /4V`=@n1 Pl5X!S@4 d 0@ rX6FV@!ҳ+ȫ/iП0b`/! hџ/!@џ0(F d X1T ѥџph: d 4HџjW d /l`&ҟ{ d /8"&ҟ P2h00@"'@ӟ ײp/"X@ݟ v C0 k @R/p@ УJx0q'"0@]Э/?~`Y 4#P/c@4g d 0) [?w5 d /~'2@}B d /'# 3 {N9/'`3B d /D@#3l< d /f3@'xs/T40Ȱ/T 5@/`3@_<#ޟ2l>8DT@I@ThQ@DT?/ 3)/g#3h(/p$3@42s;/'348/@$ 3pŹwB`/ 37,@/'378I#ǘP/'386./+ 5:. H/2@@ /B 5;r譖/URp譖/Q3XOۅ?k3`@[<4Ȩ d ^18R`<4k d ^1gҟc<4AS d ^1gexps% d p5p pc d / x(l} /3f@ఖ/L@ПU 譖/v`&ҟ1n譖/P&ҟ(,~d /\ 'ҟ((#B2*$'@ӟ"&N譖/=$ V@<8 1+Np2 9($sz1'%0@<< d 1 yU譖/'@% 3іఖ/h%3sa`/&U4< rp/j谖/Nf}=Fg&0@?z/4?$09RU`@Q@1/`&ҟ@@R/t`'ӟ@m d @CP ؟@]x d FL`_@@./Tg 3@@&/''3@;/,3@@dnX/ 5@/3#Oȱ/v -@б/3qNbr/' 'ҟAAHn[:/`'ӟA x`X0A̔@'nAIIخ/bg 3AAj/(3An`خ/;3@A,/4BU5@/P yC<MKA/~dCT2/pg2@Ct (/~g`3CCJౖ/ (3C f*M/J3@C vm~/h vm~/h8@Dy|/('3D`/,@Y+0iȎ/V' [0X1Ȱ/`2]H@ d f1geOs# d /c@vWO d /< `twM d /*tx00&uЎD2hU(`ğ6zph/AL@П&j/`&ҟ uP/@(&@ҟ d/&ҟ00R؎D2v('@ӟ0,:~1'((0@ rP/4(2@\]h/)3^/g3@$ѹ د/~U4HϹ /U 5L2|/4FH- /A(@)3H`;a./ 5H  X/g)35Ӳಖ/( 5Mpl3R莖?g)0@N5 07 L~d0V@Y+j?Ь/3=nplnr5*Tqa/U@a/`&ҟ+d/&ҟ88۠<J2@*'@ӟ84 V1N(*0@pl 51Z*a@/+3*sx/U4T!O/U 5 ,Fx/g3 -/g`3P?kJH/2@$ N/{`Y ؋/Y3 o;jIh@+0@< /e /8@eqUp/g2@Vp!/+.WPI P@g+0@X`j>Я/@X <&C0`@Q ?/VաZ}dV/ \!/\(H{ d /5=nK/ 4jrT/k ծ@ 5j/&ҟ,{X(/,.@<US>01h(@,0@@ۂ/yh{ d /u(2@ ./( 3@^/(,`3>0 d /,30F; Ȱ/W4`x貖/W 5z d /|5QȲ/Bh3)(/``@Z[!Y%8@Ph-0@[D+P/ 5[(FH/4\6 @@^h@-0@]}NW诖/lh&ҟY诖/ 3`M 貖/`'ӟ`fHAzh-0@aFk`/64a$$BNد2`5; $/Hد/`&ҟ HDS-P3g- @۟ HD|l X3(.0@ $#د/(@. 3 I0/.3 6Ƚ0/W4 lJJ/W 5 ZԽg3 d / Ní3 d / `P0i3 d /]Qܕ03 d / `Dnv3 d /¸3 d /x!3 d / 3 d /۷ 3 d /6iO3 d / }@YB3 d / ]ȹ,3 d /d$ֲw3 d / ԧD:3 d / է4k3 d /D "3 d /R9@{z3 d /T i~3 d / Ní3 d / @!0i3 d /]`(:3 d /Yx.3 d /0 s$3 d /,] 3 d /+}`-A3 d / pɤ3 d /M}ҐUn3 d /X `fs3 d /8 G3 d /k QR3 d /8IGQ3 d /ĞE-X53 d /o}`R3 d /94̀yW3 d /`FKv/B3 d / @Jy3 d /n]IȄ"3 d /`hEr3 d /AF4@3 d /29SX3 d / `G;m3 d /}S=3 d / `yzD3 d / Q{3 d / F/v3 d / }s!3 d / @OP3 d /8Ra3 d /M]3 d /`2UV3 d /T\C3 d /0Q{3 d / >3 d /A o]3 d /wd3 d /2  m3 d / 33 d / NGa3 d /r993 d /]C@jG3 d / D 3 d /@I3 d /_d\3 d /l~7P3 d /}_Jt3 d /i n3 d /u3 d /X Tk3 d /N3 d / uF3 d /9s&t3 d / Ɵ3 d /ǟ13 d /]˟.Ѐ3 d /@ְٟ+3 d /͠B3 d /1@>U3 d /Fqҟx]3 d /aq3 d / ʉ3 d / @FN@3 d /k;;D-3 d /;3 d /9`3 d /1` c+3 d /Q!,I3 d /@`B;"h3 d /}`BNk;3 d /@B;`5!3 d /qB3 d /~BNv3 d /" GB13 d /  %(_3 d / k3 d /9`1i3 d / @];. 3 d /`R%Q3 d / `NǠ3 d /|qI;lQz3 d /MI3 d /^@/3 d /~ Ϩv3 d / Sv(3 d />  ШdY3 d /g Sے3 d / `B|3 d / `2+q3 d /i R;Lų3 d / RDչ3 d / ;ѝ3 d /< 3 d /i@;x'3 d /;XN3 d /b13 d /`:;+3 d /@;w3 d / @麈3 d /}3 d /   ̮ߊN"3 d /^̮F3 d / ʩkm3 d /H  ͮS]$3 d /_ͮr93 d /6p3 d /b  ήN>3 d /p  3 d / ʩn3 d /<_ !i3 d / @ne 3 d /^`ը]J/3 d /XZ!Zx3 d /ZB13 d / 5|w3 d /@D)3 d /``; '3 d /;~@ZT3 d / @t143 d /O d; F3 d /mKs[3 d /e`&;3 d /`&I~3 d /$`&`&L3 d /&;.+3 d /&3 d / ';0f3 d / '%3 d /( ' '"e3 d /9 'N"3 d /';j /3 d /:'͒3 d /v^gߕ3 d /`o3 d /]~@i%x3 d /&q%x3 d /& q$!S3 d /~@$3 d /,4 3 d /3 d /k@3 d /P Ҵ; 3 d / ࠲XfC3 d /;r숑3 d /Z s܀3 d /2: 9;H3 d /R:`;r3 d /A0;u3 d /Q@0P3 d /0IZ=I3 d / 0T3 d /0+=3 d / 0@Ժg3 d /0`&513 d /q008܊X3 d /@{z:3 d /r:y;I7bs3 d /;Ȓ3 d /4\3 d /k@2R.t3 d /q22>+ 3 d /@ 3:3 d /q 3 3wz3 d /@`3H<3 d /_`3N:7wX3 d /r`3`34,3 d /r3T3 d /Z3T3 d /D ( F3 d / 7A.3 d /} @y3 d / .b3 d / 3 d /g 0Ζ3 d /  60ji3 d /B }83 d /< ޱ7y3 d / ɳ23 d /  `3 d / `+LY3 d /j;y3 d / ;D3 d /Vv 3 d /L;޺*W3 d /a@2KE3 d /@'#3 d / @@U3 d /b蚛3 d /<௷; %3 d /b௷3 d / X3 d /@;A3 d / ;I=J3 d /`>H3 d /;¸`3 d /<ԜY3 d /d  @CC3 d /!;L3 d /<!g 3 d /x !y%'3 d / ` @0/3 d /"` Pv3 d / 3 d / B!9wB3 d /W3#y3 d /Rwx+3 d /a[T=3 d /m2'3 d / @mp3 d /N%.3 d /j ~\3 d /" `l|3 d / I3 d /Ӣ V3 d /J.3 d /2@^73 d / @a@V@3 d / 3 d /$3 d />o5!_3 d //捸C3 d /kWMx3 d /f@i=3 d /N[l 3 d /}n^3 d /C`tc3 d />+F;3 d /9Rw73 d /@@"3 d /Zi3 d /2:@R^3 d /@3 d /m;3 d / @ա"3 d /@sH3 d /<`kH3 d /`3 d /$=`I\3 d /e3 d /co3 d / $3J3 d /:f3 d /O@d3 d /`u3 d /`A{Y3 d /P``D- 3 d /``Q`B3 d /`Se3 d /E`!J3 d /` %)3 d /r3 d /PS&3 d /8QJ3 d /p=`Q0@3 d /7`E=3 d /Dj 3 d /@M73 d /<{`D3 d /KaDi3 d /`3 d /`ĭ3 d / Ua53 d /28@Ի3 d /ǣa-\3 d /: S[3 d /y @˧3 d /d`E E3 d /@ l3 d /Sqc3 d /3@3 d /aP0L3 d /*@.3 d / aR3 d /Ka`RF3 d /la3 d /3aYyL3 d /a`;l3 d /af3 d /T>@`#3 d /@@=3 d /84` &O3 d />`eP3 d /`5[3 d /=;RuF3 d /-u5;F3 d /; R3 d /`&~3 d /r<:0²,3 d /Ź$S3 d /@Y93 d /[@Y@i\3 d / p= | 3 d /C`;J 3 d />q3 d /$@uG/j3 d /ڢ 3 d /q`Ƨ@bUC73 d /`Ƨ("Ҷ3 d /@`@`߳3 d /$ʧY d3 d /$ʧ`g3 d /Wʧ093 d /ʧa.i'3 d /VʧayJ3 d /ʧ*>?~N3 d /ʧ@1Ċ3 d /ʧ@˧3 d /\ʧ`ͪv3 d /ʧ3 d /zʧ@+3 d /Aʧ*3 d / ʧ`3 d /ʧ@)3 d /ʧI3 d /< ʧ` '3 d /ʧ 3 d /~ͧӢ3 d /rͧ@f3 d / gͧ@03 d /ͧ Kv3 d /`!T/C3 d /`!@3 d /#`!ͧ4/3 d / `!@4(3 d /`! h93 d /:3 d /@8R3 d /@g3 d / A!3 d /u iׯy3 d /(Ѫ;x43 d /ubQ3 d /@6;3 d /R<: 3P3 d /qv`;追3 d /f; N3 d /= @ܿc3 d / @!`993 d /`(`A 3 d /@ 2]+3 d /+w63 d / g3 d /wXAQ3 d / S@Yf3 d /TbS3 d /J eş_a3 d /3 d /a@՝U͏3 d /a@ S-,3 d /<` r3 d /2< ^&3 d /bםߎEm3 d / ζ3 d /3b @3 d / ؝`HH3 d /[ Aⅸ3 d /`?E3 d /`-v3 d /'p;e$3 d /fpE3 d /@Eu3 d /l`fD3 d / IR3 d /'y3 d /a G*3 d /нJ3 d /u(3 d /}`.V,3 d /}IjZ3 d /M`qɼ3 d / ``:hD_3 d /4}W3 d /u`hV33 d /”Zh3 d /kA=3 d / Kg3 d /آ`M/S3 d /;N 3 d /=Խ3 d /P`&@-3 d /Ő3 d /tĆr 3 d /t#~w3 d /g`&X7(3 d /!#N&t3 d /u##3 d /g#`&i3 d /CC@ȸVP3 d /}`m@[xy3 d /x  53 d /JQ!I3 d /H O~?t3 d /v`2`2dxc3 d /b`2@M>+F3 d /`2@MW3 d /v`r^P3 d /B[n\3 d /h ι`)3 d /ι;3 d /;l-(3 d /#@ݞ\3 d /I@0E73 d /J ƴe3 d /kձ13 d / ;3 d /g;~3 d /g@;3 d /'&;R1=3 d /a ;追3 d /m;e3 d /h@@K3 d /0 @3$3 d /Cel3 d /)y`z3 d /h 5=3 d /r#3 d /=kJ}3 d /ş 23 d / @ӟ@r3 d /@ӟ; έ3 d / @ӟϴZx/3 d / @ӟ Xl3 d /2=@ӟ0s3 d /@ݟr3 d /ϣ@@4`*3 d /P @F4`*3 d /P @>I3 d //@ސC3 d /;c@@]83 d /@S+3 d / @0"3 d /с@l3 d /C@0i5~3 d /t! 8Y43 d /S,T3 d /`aii|i3 d /@W13 d /f` D3 d /0A3 d /~.Pz˽3 d /QPK3 d /@)Rh3 d /#*V3 d /.Y3 d /G@r3 d /F3 d /  3 d //@S3 d /0aS3 d /h2@Q3 d /4@JD3 d /2@Pq3 d /I@MC3 d /#@h3 d /1(@3 d /g@SV3 d /M/@ys3 d /@`Dv3 d /@`QA}3 d /@S9v3 d /@!0%3 d /R@ )p3 d /;$@`ErH3 d /@a93 d /,SnP3 d /awǽ3 d /(@@'3 d /D3 d /@^3 d /^+s3 d /0+3 d /@I3 d /X~f3 d /D@#[3 d /@g=3 d /p B̎3 d / !@S 3 d /[@5nd3 d /@!@`/3 d //3 d /=L3 d /T@@^;|I3 d /@x3 d /t@@ g3 d /@!bn3 d /@C3 d />@"%T3 d /8?@^>3 d /`r3 d /R&=3 d /0S@@ٷ3 d /i U` K]3 d / UWcC3 d /$ U@ 3Q 3 d /^ U@RS;3 d / U`b63 d / U`3 d / U93 d / U@Ế3 d / UX3 d /P U $ .'3 d /\U`a 3 d / UV3 d / U"F3 d / U ڝ 3 d /@ U'6Y3 d /Cd>ua3 d / e` ZTL3 d / e"3 d /w}=n3 d /04jO3 d /`&@@ӑ3 d /v 0@[v3 d /@@1YHH3 d /' @0&e3 d /p;E+V3 d /[@0 3 d /8@Ÿy>3 d /aǟB3 d /ҟ;Bߠ3 d /ҟ`³|b[3 d /Cҟ 9 F3 d /4֟@ H7R3 d //֟@LD3 d /֟Ԕ3 d /&؟3 d / +K3 d /@;{Һ3 d /X@43 d /R=@QY;3 d /@'3 d /r=@';3 d /1 ` 4a3 d /E "eq3 d /Dg 3 d /.we~3 d /اҟ&3 d /HFpbV3 d /:h;03 d / D03 d /`_[:3 d /Jk3 d /S )3 d /\c`9I3 d /}c 3 d /`Y3 d /cB[3 d /Iwy]BS3 d /Q&`&23 d /0!q3 d /2`Z3 d / 3ĞE3 d /`33 d /cu3 d /dwlxy3 d /-Dfmz3 d /Ph`& y3 d /a2)3 d /z 3+3 d /`3A3 d /{D;@t3 d / ;` d3 d /8;3 d /|;Ҋ3 d / 5;Ny33 d / 3;93 d /S ;Px3 d / ;43 d /;`D]=_3 d / ;@ r3 d /];@a`3 d /;`d3 d / ; U*l3 d /o;ͣ3 d / ; F3 d /;9BV+3 d / ;~-d3 d / ;^Qp3 d /5 ;UKA3 d /A;@$3 d /1 ;0>{3 d /V ;ad dG3 d /;a5V3 d /X ;*p~3 d / ;ͪ `3 d / ;@g3 d / ;*đe3 d /4 ;`ҿ3 d /Ĥ;@CR93 d /;03 d / ;ͪ;M3 d / ;`̧e3 d / ;̧3/3 d /! ; ͧC\3 d /Z ;` 4G3 d / ;@ D3 d /{ ;֝3 d /; n3 d /Ƞ;;53 d /; JcI3 d /;ͭ3 d / ;qH3 d /f&;0J3 d /;@ 3 d /{&;h9!3 d / {F3 d / || 3 d / 3 d / >3 d /?,3 d / @@9;3 d /d3 d / 3 d /^ ~0$}3 d /[`<;7>3 d / S^$3 d / Y(3 d / @0B3 d / Źn23 d /  ;3 d /;]T3 d /YG3 d /`c{=3 d /  @iw3 d / `3 d /"_S@3 d /`93 d /`!j3 d / @`D3 d / `#+3 d /L'l3 d /ԣ`';~e3 d /#-I3 d /!u3 d /+Ź OA3 d /;} 6%3 d /&3 d /DFBN|3 d /sBD,y3 d /B #23 d /y B3 d /I B"?3 d /B)3 d /DB#Uq3 d /hB;Pcj3 d /B83 d /sBAX3 d /&B`&&3 d /D&{x3 d /;93 d /3 d /m `3 d /8 s!v3 d / Tg3 d /` ``(3 d /p t~3 d / M3 d /} `1u3 d /D B3 d / `l3 d / ` a3 d /ฤ w3 d /% ฤ;]3 d /  AN3 d / `)6ޗ3 d / `33 d /Μ `B`3 d / `k 9^z3 d /) `@Z3 d /! @-E3 d /G L3 d /H #3 d /`@8˝3 d /# ` QR3 d /y?h$3 d /  s6X3 d /J  a3 d / 01s83 d / @Pa3 d /;P3 d /=@=]3 d /  @݀W3 d /6  ;}S3 d /@;l3 d /9'` >(Q,3 d /2>; r3 d / ವez3 d /H @\3 d / E@z3 d />  K3 d /N ë 3 d /- 3܅s3 d /G  g83 d /  C"3 d /W  3 d / R`3 d /y  3 d / ūP3 d /  W3 d /p ƫ=V3 d /" F3 d /%ڵm>]3 d /+ @,3 d / ѫQ3 d / `ѫz{3 d /t  =r3 d / J~3 d / ѫ䧀3 d /  ҫ593 d / 3 d /  u 3 d /P +Xy[3 d /T  }3 d /  3 d /׫;ӫ3 d /o׫<3 d /y׫`&-3 d /I׫03 d /, ׫׫BH33 d /R ѹѹ 3 d /۫;ӫ3 d /o۫<3 d /y۫`&-3 d /I۫03 d /, ۫۫BH33 d /R   PA3 d /5F3 d /V;@-3 d /zV03 d /W;@-3 d /zW0:n3 d /0 ൧γ33 d /r?@ߴ;U3 d /@ߴ0=3 d / @bY3 d / oŹz3 d / QT03 d //yQ;&3 d /k Q@ӟ53 d /   l;3 d /!`ɨ?3 d /0` w3 d /݆0z 3 d /0`&3 d /A0 ^3 d /GD`RL3 d /{`jR?3 d / @ Ү3 d /] @aP3 d / T3 d /Ir63 d /]@;Dс3 d /8 `۵3 d /_ ε43 d /`B`r3 d /c`;ʋ<3 d /`\2u3 d /@e;J3 d /# R;MP73 d /R#D3 d /E|3 d /+ S;OCw3 d /g@f;gtO3 d /|[3 d /aφ`3 d /$ap3 d /*dT3 d /b3 d / @ba 3 d /$`:U3 d /A@A3 d /u@bxRr3 d / @[>3 d / *( 3 d /@;sw3 d /S;e3n3 d /)@Ѩ;qZ3 d /0;{+3 d /;8<3 d /MLV3 d /eҨҨis3 d /@n 3С3 d /G@o;I]3 d /9 ;;3 d / n3 d /OFv"3 d /y`ײ~3 d /; G*3 d /E@;Hem3 d / ڲ=43 d /d rt=3 d / U"E!3 d /d2 3 d /i Z"3 d /3 d /y0h3 d /B3 d /@] 3 d /r @]E4 3 d / EبH43 d / ۨ`ب_qS3 d /ey W}3 d / '3 d /u _`ب63 d / HH-3 d />/<S3 d / V(3 d /5q6x3 d /h S+3 d /ο  5;lb3 d /  553 d /: 5 5Ѹ3 d / @ܬy03 d /D@c;3 d /fhQ3 d / jE3 d / I@mp3 d /@I;z3 d /p@f~3 d /FKzi3 d /K`& 3 d /`  vFa3 d /1E`$;<3 d /d`$`$mQ3 d / `$QS3 d /Q;w3 d / Q@H]Ek3 d /4 Q`$a? B3 d /J QQr3 d /"d*>3 d /`&@3 d /`&` 23 d /i3 d /E`&p3 d /rx`& 943 d /`& ,Ą݇3 d /<`&0aR33 d /x`&yD3 d /``&23 d /`&33 d /`&@ӟ53 d /H`&@hS3 d /h`&M3 d /`&`%DŽ3 d /``&`&b\<3 d /x`&'~[#3 d /R?&`A5Qk3 d / &*393 d / &@bHI 3 d /3 &`}*3 d /̥&@K3 d / &Gs5i3 d / & ΪF3 d /P&;?z23 d /'&K3 d /&`&1 73 d /#'&&aY3 d /\  '@P3 d / ',iR3 d / '2Z3 d /0A 'N $3 d /G '"3 d /  'D{3 d /  '` N3 d /  ' Pae3 d /σ '@ͼV3 d /l^ '`D7?[3 d /4H 'R-3 d /  '13 d /  '@S@)3 d /  '>3 d / '!G3 d /  'se3 d /|h 'H3 d / '`X3 d /  '@cS3 d /T '!,3 d /% 'T13 d /$ '9 3 d /  '7^3 d / '9-33 d / 'x3 d /  '`Ez3 d /%  'ag3 d / '@'3 d / '`Vt3 d / 'WG 3 d /x  ' b3 d / ''KH3 d /  'Nlb3 d /7  '@1 >3 d /  '`3 d /8 '@d,3 d /Z  '@`^3 d /  '$p3 d /  'Iu3 d /  '3 d /E '^)3 d /x '<3 d / '#98k3 d /d ';?Q3 d /8' '2xs3 d /Ke 'D3 d /M' ' 'I|3 d / '$a?3 d / '@sh.3 d /\'@Q;3 d / '*23 d /( '3 d / '`ZY3 d / '̪h3 d /U '0D3 d / 'a3X3 d /1 'a=3 d / '*K3 d /!'@b3 d /] '@1"v3 d /''oa3 d /m '@R3 d /^'*3 d /> '`IW03 d / '@7q=3 d / '1`(3 d /x';e'3 d /u'x3 d / ' 3 d /'ϴx3 d / 'g3 d /E'`&~3 d /"''˙%3 d /''3 d /*@x'3%mf3 d /g!3 d /e`4{{;3 d /`@&3 d / `)|2[3 d /``re53 d /ҟd3 d /;63 d /e@@_93 d /#@{+3 d /n @`_3 d /W@@iO3 d /4@@ӟg3 d /X ٥0&=3 d /ب&D%3 d /J9` 3 d /986;3 d /&l3 d /HT!3 d /PTֻӪ3 d /1Yz53 d /Au@2E%3 d /S 3 d /1 3 d / g3 d / 3 d /|u`]O3 d /VSc93 d /D23"3 d /|`3 d /`"3 d /S&@|3 d /9i3 d /raQ3 d /޲`ۺ3 d / I`3 d /T3 d /V`#WBd3 d /B ơ3 d /``XO3 d /`9!^3 d /%T93 d /@VA3 d /t`gt3 d /h@@-3 d /s'3 d /  R3 d /u) g3 d /2 <3 d / `nI3 d /ܝ `?(3 d /`T°؀3 d / `@B3 d /`93 d / `@ U3 d / ``{3 d /`V[3 d /}``DR3 d / `9vHZ3 d / ``]$%3 d /&``63 d /`!.'3 d /h``5G3 d /B`_'3 d / ` K883 d /P_`&t3 d / `@'o>3 d /Nm#3 d /H<obd3 d /6 OD$3 d /@ 3 d /7 8w3 d / ȣ3 d /w) _3 d /`x3 d / UK3 d /"0U73 d /  Ob3 d /`j;:3 d /  0D3 d /߄O 3 d /'`Ʒ;`3 d /: `Ʒ q&3 d /n@N; 3 d /@N`jW#T3 d /y,`ƷB|3 d /ɣOw3 d /i`?@3 d / @Q O3 d /@Qle83 d / Q;p3 d /P 3 d /S  ɱ3 d /dX3 d /> {3 d /y s'H@G3 d /nU_i3 d /y;p3 d /ħ 9Q<3 d / 9;Y3 d / 9%3 d /  9 9hj3 d /x  9 9ņQ3 d /z0Ü%A3 d /@0@.3 d /g03 d / 0`P33 d /90Q~@3 d /U0@OU3 d / 0` ߛ3 d /U 0` .v3 d / 0@-k3 d /0u3 d />0 iZ3 d /_0.-3 d /%0SZ3 d /H 0J)3 d /p 0` GK3 d /! 0@= 3 d /ȴ 0O)s3 d / 0@3 d /+ 0.3 d /073 d /! 0`T3 d /v03 d /03 d / 0@ }3 d /V 0S4;3 d /[g0U63 d /! 0+R3 d /v0@}3 d / 0T(3 d /$ 0'yc3 d / 0@b33 d /R 0^&&3 d /4`0@uI#3 d /0+3 d /w0@3 d /߃0 ѝP3 d /D 0@`O3 d /p0 3 d /0@3 d /0Pn3 d /0@BƝ3 d /f 0Ac3 d /H 0lS3 d /di0`D=3 d /0`Q $3 d / 0@Ļr3 d /60"O:q3 d /pU0RX Z3 d / 0@]X3 d /" 0@ 3 d / 0tDb3 d /I" 0@}3 d / 0@SbC3 d /g0S3 d /G 0֍F3 d / 0@,3 d /0}3 d /0p3 d / 0Sce3 d /m`0!e63 d /0 >V3 d /`0_3 d / 0`y3 d /0`3 d / 0Va3 d / 0`(ؕ3 d /03 d /q 0`83 d /0!sz3 d /L0Ta3 d /0_~c3 d / 0cuZ3 d / 0 UhΗ3 d /0\M3 d /`0Q3 d / 0EM 3 d /- 0 qy3 d /09ڛ3 d / 0`E=I3 d / 0tg3 d /X 0a3 d /00{3 d / 0`^G3 d / 0@VO3 d /0qL3 d /@ 03 d /80^@3 d /˟ 0@3 d /|g0`l3 d /)0̀3 d /Tw0H&~3 d /0 ʮo63 d /a0@&U3 d /i0@3 d /q 0`3 d / 0@˜z3 d /p 0` Ã.3 d / 0AE3 d / 0U3 d /`0!sT3 d /Z0`V=3 d /60QkI3 d /j0W3 d / 0!ѼQ3 d / 0`u03 d / 0@"OC 3 d /P%0"Io3 d /0^Xj3 d / 0#.3 d / 0@3H3 d /% 0 $KA3 d / 0$_ 3 d / 0t;E3 d /0oL3 d / 0@5e93 d /@ 0`.\A 3 d /0  3 d / 0"&v3 d /e 0;3 d / 0 W3 d // 0`%v".3 d /Z 0&Uj3 d /0*m3 d /0@:pH3 d /@ 0%I3 d /) 0W:d"l3 d /R 0&PS3 d /Ƨ0@'k3 d / 0'!"3 d / 0`c3 d /W0'ؤ3 d /u0@83 d /q0-13 d /0N43 d / 0*_Q3 d / 0`뗪3 d / 0@83 d / 0Vj3 d /"z0`(Ȥ,=3 d /  09Up3 d /@0՝V3 d /0@E+o-3 d /@0)6 B3 d /0F2*3 d /09b3 d /0F&3 d /F0@+9b3 d /0>)<3 d /f 0yiN3 d /0@79|3 d /,i0ҟ H3 d /0@*3 d /'0;Bh3 d /Bi0ј3 d / 0BWQ3 d /U0#H3 d / 0$3 d /t0{F3 d /0ϴ Q3 d /0`YfJ3 d /g0@ߴ r93 d /)0QջK 3 d /F03Y3 d /@0)33 d /30 bU3 d /x0`&QN3 d /Xi0&3 d /ni0 'v 3 d /:0'Z3 d /0q~3 d /8 0܀Z3 d /U0"L3 d /0)ܰE3 d /W0 mI3 d /0 9M3 d /H003 d /0`3_3 d /$`b`j 3 d /` x>23 d / Zƴ3 d /Qy*YZ3 d /&y@b%Pe3 d / y@11XI3 d /yʧpm3 d / y`ͪ, 3 d /y˧wT3 d /y̧-b˴3 d /- y3 d /ay@3 d /e y*3 d / y`"?3 d /Y$ y@53 d /y ΪG^3 d /y;3 d /y o3 d /? yN辧(3 d / yn3 d /y0R3 d /C yyJ3 d /hy Uw3 d /\ w1)3 d / ` k3 d / @{j3 d /$'\$ew3 d / |3 d /k!3 d /δ53 d /$  U>.3 d /τb3 d /@ `ES΂3 d / aV3 d /hŹdv/3 d /;@Z3 d /?a3 d /hyۺ=3 d /62,03 d /2дT 3 d /92 8 3 d /a2`&u&3 d /'2`3ؒ3 d /i2p[_3 d / 3ŷ3 d /i 33 d /7 3hV3 d /  3?3 d /  3 N3 d /z`3XC3 d /O`3m3 d /s`3K 63 d / (`3;|nw3 d /i`3_S3 d /`3`3Gu3 d /3;IX3 d /(35٥3 d /i3;U3 d /ҩ33SΥ3 d /h  4 43 d /@r;E`K3 d /- 6"E!3 d /dʳZ"3 d /@3 d /y@00 2 d 50D$`0 2 d 50D$༯0 2 d 50D$`0 2 d 50D$཯0 2 d 50D$`0 2 d 50D$ྯ0 2 d 50D$`0 2 d 50D$࿯0 2 d 50D$`@0 2 d 50D$0 2 d 50D$`0 2 d 50D$0 2 d 50D$`¯@0 2 d 50D$¯0 2 d 50D$ï0 2 d 50D$`į0 2 d 50D$į0 2 d 50D$`ů@0 2 d 50D$ů0 2 d 50D$`Ư0 2 d 50D$Ư0 2 d 50D$`ǯ0 2 d 50D$ǯ@0 2 d 50D$`ȯ0 2 d 50D$ȯ0 2 d 50D$`ɯ@H8搸 d r2$`H8搸 d r2$`H8搸 d r2$`¯@H8搸 d r2$¯H8搸 d r2$`ïH8搸 d r2$įH8搸 d r2$`ů@H8搸 d r2$ůH8搸 d r2$`ȯ`P d 4 %``P d 4 %`ů@`P d 4 %`ȯxh d 5p%`ȯ5 d 5%`5 d 5%`ȯ jiJ$ d C0U @  0 d C0 @  _Q& d C0@  kf8) d C0௷  }t d C0@  ms d C0@  N d C0  ˻N" d C0  Mh d C0zÜ@  č0r d C0?¸ FN d C0`  aF d C0 @@ 8 d C0  ?l d C03@ %i d C0 P d d C0x@  ×^ d C0V" I֜_ d C0 @@ Fmo d C0”5 _ d C0V@ w4 d C02 WI& d C0@@ 45s d C0f@ Da d C0@" 8J d C0 Z@ ה0 d C0  d C0  ]- d C0%@  o d C0ܷ  s`[ d C0m@!  d C0 g`@! 45s d C0f`! Da d C0*! 8J d C0+" ה0 d C0@"  d C0 " ]- d C0@-# o d C0޷# s`[ d C0m๪#  d C0 g$ H7$ d C01@( ɜ d C0ଧ(  d C0`)  d C0* , d C0k൧@+ o d C0V,  d C0ȹ, ! d C02Z- xR d C04 !T d C0xק4 @bz d C0Ub5 6F d C0Ѫ6 hu d C0{6 @ d C0> d6  d C0V7 71  d C0p@7 ᫀ d C0ɕ`)7 j0 d C08 9! d C0ZV9 } d C0@9 ' d C0f9 w%< d C0%@: 7d== d C0;  d C0`@; k  d C0pV; ZQ d C0Y`7> d d C0@> x d C0? a9 d C0`+@ i d C0`>A bf8 d C0?@A ~V sKcN d C0`fW 9+< d C03lW  . d C0.VlW M@ d C0|VX wN d C0[(X - d C0!4X@Wu d /w`@Z@\ d /1]`Xӵ& d 3W^`X  d 3P ^`X~ d 3_`XG& d 3+@_`X/? d 3K_`X d 3@M_`X=0 d 3@N``X ! d 3;4@P@``Xr? d 3%S``X c d 3%@^a`X6  d 3R4a`X(h d 3Agb`X;,<, d 3!@b`X$ d 3b`X d 3ҟ@c`X<{5 d 3 hҟc`XA9  d 3@ӟc`X'O* d 3 ֟d`X]  d 3V۟@d`X,* d 3Vd`Xer d 3@d`X֗/ d 3he =#֤ d /W@Bes5 d /;f  d C0U4{@f =Y d C0@~f 샿 d C0 h 7~ d C04@@h  d C0o4h 4/ d C0@i er d C0@i )1 d C0jj@@9Y d P2Cm  d /V@m" d /@Dn M d C0@r -R d C0r 򓉭 d C0`s@@v d P20WZs ? T d /5t@@ d P2u@A< d /&hB@v e d C0\`{@x ` d C0Vx |! d C0 y|6WZ' d H5(z1v d 7(@|@@цu d P2}@@` d P2g඲@} x d /}t d 7~OdA d 7`δ@~``B d 4H`ϳ~  d > ϴ~@<> d 1Ɩࣩ@! d ?`  5G d /fW '@ B9 d /L`' 0y} d /x`|p d p9I ~ TT d /V|X] d X<޴`\"^> d ?+`X@</ d h;V5_ d /4 S@<~/( d 1VJ@ $ d C0@nU d 6=@ӫb d 7xW@ @@@'g d P2׫ S d 7gث`\Iu d 49٫ݜ d 885 b d 7xW@@'g d P2۫@ S d 7gݫ`\Iu d 49ݫݜ d 885@ d /wg@߫@l d (6PV@@@{- d P2, 3 d /ݖM H d /WM  d /@N@  d /4N ? d /Oy' d 9 Z d /`-@ t d /`@  d /t@<ˁ d 1V@@<~ d 1`޵`XCn d 3@ -. d /ZQ@<^ d 1LW  ( d /x/@<D d 1g @@M d P2W@ Tl d C0 Wɨ$,p d / 1@`'MU d /0`X_i d 3~@@ >R d H: @@BU d P2ÿ ͨ@@@m d P2ͨ``c d ;V_ ^  d /A D d /\g`'U\ d / 6Bħ d x70@ hW56 d C0r4`8@<N + d 1V@@@tG d P2y&<{ d /T N d 84 Ю@@$O d P2Ө@ 5 d /:@@'xH d P2g@o@@@ d P2<Ө@<  d 14h`XI d 3`@@q, d P2ը@< d 1F@@@OY< d P2V d 7%5  AU d /$`@~ d /BW@@Q d / W@lW d /6W A  d C0 ֨@|T * d H54   d /BȆ: d @7 @@@yW d P2<\@@h d P2S@]@ G d /$`E Փ d /pE@@PGs% d P2R @@@-FI d P24 3o d (9PS@Ÿ@@k d P2g_Ÿ =/ d C04ß  d / @ß@<1y d 1`ß OM d C0?5`ğ@@  d P2`a@ğ@@< d P2@Ɵ9 d /ǟ;ܒf d /s5 \@ǟ@<9 d 1T 5ǟ@@ d P28 Wȟ U- d /TW` ɟ@<=P d 1]Iʟ@@o d P25f˟~G  d `9`̟|NCQ d \55`F@̟)XZX d /g &ϟ``B d H3ڗõϟJ} d /`LП  d /`&ҟ~gz d /&@ҟ 5j d /&ҟ@ d / 'ҟ@@.T d P2G'@ӟ Xb d C08 `إԟ  d C0ڥԟ 6 d C0՟ [0 d C07`@՟  g d C0] `՟  g d C0] ՟  d C0  ֟ K& d C0V@֟ K= d C0` ן _M d C0bW @ן n d C0ן (uD d C0"`ן Y d C0"@؟ d0 d /Y5O@ڟ ϻ d /gO۟@@Ho d P2`۟z0 d 7ܟ : d /P@ܟf d / W Qܟ^ d /4`Qܟ  d / 5Qݟ vi  d C0͔@ݟ|& d \5Zޟ  d /m V@@@ģ d P2`\'% d 4 9! d 5xV d 4×@f@@@vPz d 2g D^ d /W 0@@<US> d 1h(@,0@@ d / W@>y  d / 0 ݧ d /`2`T d 60@ 7  d /2h{ d /u(2@ . d /( 3@^ d /(,`3>0 d /,3 %@  d C0 4Qo d /`5|T * d H54  d / \*vendor/golang_org/x/crypto/cryptobyte/asn1**[][8]edwards25519.PreComputedGroupElement**[]func(*idxfile.MemoryIndex) (int, error)**[]struct { laddr net.TCPAddr; value int }**descriptor.DescriptorProto_ExtensionRange**descriptor.MethodOptions_IdempotencyLevel**dynamodb.CreateGlobalSecondaryIndexAction**dynamodb.DeleteGlobalSecondaryIndexAction**dynamodb.DescribeGlobalTableSettingsInput**dynamodb.PointInTimeRecoverySpecification**dynamodb.ProvisionedThroughputDescription**dynamodb.UpdateGlobalSecondaryIndexAction**func() (dnsmessage.ResourceHeader, error)**func() (interface {}, interface {}, bool)**func() (string, primitive.ObjectID, bool)**func() []*descriptor.FieldDescriptorProto**func() []*descriptor.OneofDescriptorProto**func() []*grpc_binarylog_v1.MetadataEntry**func(*[]net.IP, string, []net.IP, string)**func(*[]string, string, []string, string)**func(*bool, string, string, bool, string)**func(*edwards25519.CompletedGroupElement)**func(*index.Index) (plumbing.Hash, error)**func(*int8, string, string, int8, string)**func(*object.Tree) (*object.Patch, error)**func(*packp.ReferenceUpdateRequest) error**func(*uint, string, string, uint, string)**func([]uint8) (int, *net.UnixAddr, error)**func([]uint8, *net.UnixAddr) (int, error)**func([]uint8, []uint8, bool) interface {}**func(agenttasks.Executor, string, string)**func(bsonrw.ValueReader) ([]uint8, error)**func(bsontype.Type) (reflect.Type, error)**func(connectivity.State, balancer.Picker)**func(docker.ConfigurePluginOptions) error**func(docker.ExportContainerOptions) error**func(docker.RemoveContainerOptions) error**func(docker.RenameContainerOptions) error**func(func(http.http2Setting) error) error**func(func(interface {}, bool) bool) error**func(interface {}) *mongo.DeleteManyModel**func(interface {}) *mongo.ReplaceOneModel**func(interface {}) *mongo.UpdateManyModel**func(logrus.LevelHooks) logrus.LevelHooks**func(map[string]*string) *dynamodb.Delete**func(map[string]*string) *dynamodb.Update**func(pflag.Value, string, string, string)**func(plumbing.Hash) (*object.Blob, error)**func(plumbing.Hash) (*object.Tree, error)**func(string) (*docker.ExecInspect, error)**func(string) (*plumbing.Reference, error)**func(string) *dynamodb.BillingModeSummary**func(string) *dynamodb.DescribeTableInput**func(string) *dynamodb.ReplicaDescription**func(string) *dynamodb.SourceTableDetails**func(string) *dynamodb.UntagResourceInput**func(string) *sqs.DeleteMessageBatchInput**func(string) *sqs.GetQueueAttributesInput**func(string) *sqs.SetQueueAttributesInput**func(string, *tls.Conn) http.RoundTripper**func(string, bool, []uint8) (bool, error)**func(string, string) *pubsub.Subscription**func(string, time.Duration) time.Duration**func(string, uint, context.Context) error**func(template.FuncMap) *template.Template**func(time.Duration) *options.CountOptions**func(time.Duration) timeseries.Observable**func(uint32, http.http2OpenStreamOptions)**func(unsafe.Pointer, unsafe.Pointer) bool**interface { GRPCStatus() *status.Status }**map.bucket[*http.http2ClientConn][]string**map.bucket[anagent.TimerID]*anagent.Timer**map.bucket[reflect.Type]*redis.structSpec**map.bucket[runtime.typeOff]*runtime._type**map.bucket[string][]*http.http2ClientConn**map.bucket[string][]*multipart.FileHeader**map.bucket[string]docker.ContainerNetwork**map.bucket[string]errcode.ErrorDescriptor**map.bucket[uint32]*http.http2clientStream**map.bucket[uint32]*http.http2priorityNode**map.bucket[uint64]chan description.Server**map.hdr[*grpc.acBalancerWrapper]struct {}**map.hdr[metricproducer.Producer]struct {}**map.hdr[resolver.Address]balancer.SubConn**map.hdr[string]*sqs.MessageAttributeValue**map.iter[address.Address]*topology.Server**map.iter[chan<- os.Signal]*signal.handler**map.iter[docker.Port][]docker.PortBinding**map.iter[interface {}]measurable.HookFunc**map.iter[pflag.NormalizedName]*pflag.Flag**map.iter[uint64]chan description.Topology**map[logging.level]logging.LoggerInterface**map[string]*dynamodb.AttributeValueUpdate**struct { F uintptr; R *http.http2stream }**struct { F uintptr; R *http.persistConn }**struct { F uintptr; R *httpproxy.config }**struct { F uintptr; R json.floatEncoder }**struct { F uintptr; c *context.timerCtx }**struct { F uintptr; delay time.Duration }**struct { F uintptr; hs *[]plumbing.Hash }**struct { F uintptr; m *runtime.MemStats }**struct { F uintptr; p *git.objectWalker }**struct { F uintptr; ps []unsafe.Pointer }**struct { F uintptr; quit chan struct {} }**struct { F uintptr; rw *runtime.rwmutex }**struct { F uintptr; s *transport.Stream }**struct { ID interface {} "bson:\"_id\"" }**struct { addr uintptr; len int; cap int }**struct { handle []uint8; suffix []uint8 }**struct { tok revision.token; lit string } ArtefactPathmapstructure:"artefact_path" ClusterTimebson:"$clusterTime,omitempty" Extensionsasn1:"optional,explicit,tag:3" Extensionsasn1:"tag:0,optional,explicit" HandleSignalmapstructure:"handle_signal"Key%min:"1" type:"string" required:"true"LatestRestorableDateTimetype:"timestamp" MessageBodytype:"string" required:"true" NodeDeadlinemapstructure:"node_deadline" PreCPUStatsjson:"precpu_stats,omitempty" PrivateQueuemapstructure:"private_queue"ProgressMessagejson:"progress,omitempty"ReplicaSettingsUpdatemin:"1" type:"list" TargetValuetype:"double" required:"true" TaskDeadlinemapstructure:"task_deadline" TemplatePathmapstructure:"template_path" WebHookTokenmapstructure:"webhook_token" WriteTimeoutmapstructure:"write_timeout"+github.com/MottainaiCI/mottainai-cli/common+vendor/golang_org/x/crypto/chacha20poly1305+*[2]struct { laddr net.TCPAddr; value int }+*[6]func(*idxfile.MemoryIndex) (int, error)+*[]*descriptor.GeneratedCodeInfo_Annotation+*[]*descriptor.UninterpretedOption_NamePart+*[]*dynamodb.LocalSecondaryIndexDescription+*dynamodb.DescribeGlobalTableSettingsOutput+*func() (*object.File, *object.File, error)+*func() (http.http2FrameWriteRequest, bool)+*func() (plumbing.ObjectType, int64, error)+*func() (string, bsonrw.ValueReader, error)+*func() (string, primitive.ObjectID, error)+*func() []*descriptor.MethodDescriptorProto+*func() descriptor.FileOptions_OptimizeMode+*func(*credentials.Credentials) *aws.Config+*func(*edwards25519.ProjectiveGroupElement)+*func(*git.Repository, plumbing.Hash) error+*func(*http.Request) (http.Handler, string)+*func(*http.Request, []*http.Request) error+*func(*macaron.Macaron, ...macaron.Handler)+*func(*object.Tree) (object.Changes, error)+*func(*transport.Stream, metadata.MD) error+*func(*xml.Decoder, xml.StartElement) error+*func(*xml.Encoder, xml.StartElement) error+*func(...*options.TransactionOptions) error+*func([]*string) *dynamodb.ListTablesOutput+*func([]*string) *sqs.MessageAttributeValue+*func([][]uint8) *sqs.MessageAttributeValue+*func([]string, bool) gitignore.MatchResult+*func([]string, string, bool, interface {})+*func([]uint8) ([]hpack.HeaderField, error)+*func(balancer.SubConn, connectivity.State)+*func(bool) *options.ListCollectionsOptions+*func(bsonrw.DocumentWriter, []uint8) error+*func(context.Context) (*docker.Env, error)+*func(context.Context) (*iam.Policy, error)+*func(context.Context) (swarm.Swarm, error)+*func(context.Context, time.Duration) error+*func(hash.Hash, *packet.SignatureV3) error+*func(int, string, string, ...interface {})+*func(int64) *dynamodb.DescribeLimitsOutput+*func(interface {}) *options.FindOneOptions+*func(interface {}, xml.StartElement) error+*func(string) *dynamodb.AttributeDefinition+*func(string) *dynamodb.BatchWriteItemInput+*func(string) *dynamodb.CreateReplicaAction+*func(string) *dynamodb.DeleteReplicaAction+*func(string) *dynamodb.DescribeBackupInput+*func(string) *dynamodb.LocalSecondaryIndex+*func(string) *dynamodb.StreamSpecification+*func(string, ...interface {}) (int, error)+*func(string, ...string) *config.Subsection+*func(string, context.Context) (int, error)+*func(string, docker.TagImageOptions) error+*func(string, int) (*big.Float, int, error)+*func(string, io.Reader) (io.Reader, error)+*func(string, macaron.Handle) *macaron.Leaf+*func(string, net.IPNet, string) *net.IPNet+*func(string, string) (net.Listener, error)+*func(string, string) (string, bool, error)+*func(string, string, []int, string) *[]int+*func(string, string, int16, string) *int16+*func(string, string, int32, string) *int32+*func(string, string, int64, string) *int64+*func(string, string, string, string) error+*func(string, string, uint8, string) *uint8+*func(time.Time) *dynamodb.ListBackupsInput+*func(time.Time) *dynamodb.TableDescription+*func(uint32, bool, []uint8, []uint8) error+*func(uint32, http2.ErrCode, []uint8) error+*interface { SetDeadline(time.Time) error }+*map.bucket[*http.http2serverConn]struct {}+*map.bucket[*http.persistConn]*list.Element+*map.bucket[digest.Algorithm]*regexp.Regexp+*map.bucket[reflect.Type]*proto.discardInfo+*map.bucket[reflect.Type]*proto.marshalInfo+*map.bucket[string]*dynamodb.AttributeValue+*map.bucket[string]*stats.measureDescriptor+*map.bucket[string][]*dynamodb.WriteRequest+*map.bucket[string]docker.AuthConfiguration+*map.bucket[string]map[string]*macaron.Leaf+*map.bucket[uint64]proto.unmarshalFieldInfo+*map.hdr[plumbing.Hash]*packfile.deltaIndex+*map.hdr[string]*dynamodb.KeysAndAttributes+*map.iter[*grpc.acBalancerWrapper]struct {}+*map.iter[metricproducer.Producer]struct {}+*map.iter[resolver.Address]balancer.SubConn+*map.iter[string]*sqs.MessageAttributeValue+*map[http2.FrameType]map[http2.Flags]string+*map[string]struct { clear bool; flag int }+*struct { F uintptr; R *grpc.clientStream }+*struct { F uintptr; R *iterator.PageInfo }+*struct { F uintptr; R *json.arrayEncoder }+*struct { F uintptr; R *json.sliceEncoder }+*struct { F uintptr; a []string; x string }+*struct { F uintptr; as *strings.asciiSet }+*struct { F uintptr; c *context.cancelCtx }+*struct { F uintptr; fields *[]json.field }+*struct { F uintptr; fr *http.http2Framer }+*struct { F uintptr; ln *net.UnixListener }+*struct { F uintptr; t *topology.Topology }+*struct { F uintptr; u *proto.marshalInfo }+*struct { Untagged string; Deleted string }AdditionalPrimesasn1:"optional,omitempty" Architecturejson:"architecture,omitempty" BackupTypetype:"string" enum:"BackupType"BridgeNfIP6tablesjson:"BridgeNfIp6tables"CPURealtimePeriodjson:"CpuRealtimePeriod"ID'json:"Id,omitempty" yaml:"Id,omitempty" IsReplicaSetbson:"isreplicaset,omitempty" LxdConfigDirmapstructure:"lxd_config_dir"MemoryReservationjson:"MemoryReservation"NumberOfDecreasesTodaymin:"1" type:"long"PartitionEndpointjson:"partitionEndpoint"ReplicaBillingModeSummarytype:"structure"ReplicaUpdatestype:"list" required:"true"RootTask!json:"root_task" form:"root_task" SenderFaulttype:"boolean" required:"true"+SetGlobalTableProvisionedWriteCapacityUnits+SetTargetTrackingScalingPolicyConfigurationSignatureVersionsjson:"signatureVersions"SourceTableFeatureDetailstype:"structure"WriteConcernErrorbson:"writeConcernError",vendor/golang_org/x/crypto/internal/chacha20,*[32][8]edwards25519.PreComputedGroupElement,*[]*descriptor.DescriptorProto_ReservedRange,*[]*dynamodb.GlobalSecondaryIndexDescription,*[]func(string, *tls.Conn) http.RoundTripper,*func() (net.Conn, *bufio.ReadWriter, error),*func() *descriptor.FileOptions_OptimizeMode,*func() []*descriptor.ServiceDescriptorProto,*func() descriptor.FieldDescriptorProto_Type,*func() func(string, ...interface {}) string,*func() map[string]internal.PerMethodSummary,*func(*[]int, string, string, []int, string),*func(*amqp.Channel, *amqp.Connection) error,*func(*big.Int, *big.Int, *big.Int) *big.Int,*func(*dynamodb.ListTablesOutput, bool) bool,*func(*grpc_binarylog_v1.GrpcLogEntry) error,*func(*http.Request) (*http.Response, error),*func(*http.Server, *tls.Conn, http.Handler),*func(*idxfile.MemoryIndex, io.Reader) error,*func(*int16, string, string, int16, string),*func(*int32, string, string, int32, string),*func(*int64, string, string, int64, string),*func(*net.IPNet, string, net.IPNet, string),*func(*object.Commit) (*object.Patch, error),*func(*regexp.Regexp) *properties.Properties,*func(*ssh.algorithms, *ssh.kexResult) error,*func(*uint8, string, string, uint8, string),*func(...string) (*template.Template, error),*func([]*string) *dynamodb.KeysAndAttributes,*func(bool) *dynamodb.ExpectedAttributeValue,*func(bool) *options.FindOneAndUpdateOptions,*func(chan amqp.Blocking) chan amqp.Blocking,*func(context.Context) *pubsub.TopicIterator,*func(docker.AttachToContainerOptions) error,*func(docker.CopyFromContainerOptions) error,*func(func(*plumbing.Reference) error) error,*func(func(interface {}, interface {}) bool),*func(func(macaron.Handler) macaron.Handler),*func(int, string) ([]string, string, error),*func(int64) (*packfile.ObjectHeader, error),*func(int64) (plumbing.EncodedObject, error),*func(int64) *dynamodb.ListGlobalTablesInput,*func(int64) *dynamodb.ProvisionedThroughput,*func(int64) *dynamodb.ReplicaSettingsUpdate,*func(interface {}) ([]reflect.Value, error),*func(interface {}, *xml.StartElement) error,*func(io.Writer, jsonmessage.termInfo) error,*func(io.Writer, string, interface {}) error,*func(logrus.Level, string, ...interface {}),*func(map[string]*string) *sqs.TagQueueInput,*func(plumbing.Hash) (*object.Commit, error),*func(scram.NonceGeneratorFcn) *scram.Client,*func(scram.NonceGeneratorFcn) *scram.Server,*func(string) ([]docker.ImageHistory, error),*func(string) (bsonrw.DocumentWriter, error),*func(string) *dynamodb.AttributeValueUpdate,*func(string) *dynamodb.GlobalSecondaryIndex,*func(string, []uint8, int) ([]uint8, error),*func(string, bool, bool, bool) (int, error),*func(string, docker.StartExecOptions) error,*func(string, int, string) *machinery.Worker,*func(string, interface {}) opentracing.Span,*func(string, net.Addr, ssh.PublicKey) error,*func(string, string) (plumbing.Hash, error),*func(string, string, syscall.RawConn) error,*func(string, toml.SetOptions, interface {}),*func(time.Duration) *options.FindOneOptions,*func(uint32, http.http2PriorityParam) error,*grpc_binarylog_v1.GrpcLogEntry_ClientHeader,*grpc_binarylog_v1.GrpcLogEntry_ServerHeader,*map.bucket[address.Address]*topology.Server,*map.bucket[chan<- os.Signal]*signal.handler,*map.bucket[docker.Port][]docker.PortBinding,*map.bucket[interface {}]measurable.HookFunc,*map.bucket[pflag.NormalizedName]*pflag.Flag,*map.bucket[string][]errcode.ErrorDescriptor,*map.bucket[string]auth.AuthenticatorFactory,*map.bucket[string]internal.PerMethodSummary,*map.bucket[uint64]chan description.Topology,*map.hdr[reflect.Kind]bsoncodec.ValueDecoder,*map.hdr[reflect.Kind]bsoncodec.ValueEncoder,*map.hdr[reflect.Type]bsoncodec.ValueDecoder,*map.hdr[reflect.Type]bsoncodec.ValueEncoder,*map.hdr[uint64]*connection.pooledConnection,*map.iter[string]*dynamodb.KeysAndAttributes,*map[*x509.Certificate][][]*x509.Certificate,*map[capability.Capability]*capability.entry,*map[string]*dynamodb.ExpectedAttributeValue,*map[string]*sqs.SendMessageBatchResultEntry,*sqs.ChangeMessageVisibilityBatchResultEntry,*struct { F uintptr; R *json.structEncoder },*struct { F uintptr; R *net.resolverConfig },*struct { F uintptr; R *packp.ulReqDecoder },*struct { F uintptr; R *packp.ulReqEncoder },*struct { F uintptr; c *[]net.nssCriterion },*struct { F uintptr; config *config.Config },*struct { F uintptr; content io.ReadSeeker },*struct { F uintptr; di *proto.discardInfo },*struct { F uintptr; errChannel chan error },*struct { F uintptr; ids []int64; id int64 },*struct { F uintptr; rp *readpref.ReadPref },*struct { F uintptr; snapshot bytes.Reader },*struct { F uintptr; updateFuncs *[]func() }Action$type:"string" enum:"AttributeAction"AgentConcurrencymapstructure:"concurrency" AuthHosts!json:"authhosts" form:"authhosts"BrokerBindingKeymapstructure:"binding_key" ClientTimeoutmapstructure:"client_timeout" Directory!json:"directory" form:"directory" DockerKeepImgmapstructure:"docker_keepimg"EarliestRestorableDateTimetype:"timestamp"Manager#json:"is_manager" form:"is_manager"Message#protobuf:"bytes,3,req,name=message" Namespace!json:"namespace" form:"namespace" NamespacePathmapstructure:"namespace_path" Projection type:"structure" required:"true" ReceiptHandletype:"string" required:"true",SetReplicaGlobalSecondaryIndexSettingsUpdateTaskHistoryRetentionLimitjson:",omitempty"TypeId$protobuf:"varint,2,req,name=type_id"-github.com/MottainaiCI/mottainai-cli/cmd/node-github.com/MottainaiCI/mottainai-cli/cmd/plan-github.com/MottainaiCI/mottainai-cli/cmd/task-github.com/MottainaiCI/mottainai-cli/cmd/user-*[8]func(string, *tls.Conn) http.RoundTripper-*[]*descriptor.DescriptorProto_ExtensionRange-*[]struct { Untagged string; Deleted string }-*func() (*topology.ServerSubscription, error)-*func() *descriptor.FieldDescriptorProto_Type-*func() []*descriptor.SourceCodeInfo_Location-*func() descriptor.FieldDescriptorProto_Label-*func() grpc_binarylog_v1.GrpcLogEntry_Logger-*func(*bufio.Reader, io.Reader) io.ReadCloser-*func(*runtime.stkframe, unsafe.Pointer) bool-*func(...interface {}) []diffmatchpatch.Patch-*func([]*string) *dynamodb.UntagResourceInput-*func([]*string) *sqs.GetQueueAttributesInput-*func([][]uint8, [][]*x509.Certificate) error-*func([]uint8) (int, syscall.Sockaddr, error)-*func([]uint8, func([]uint8) []uint8) []uint8-*func([]uint8, interface {}) ([]uint8, error)-*func([]uint8, string, string, []int) []uint8-*func([]uint8, syscall.Sockaddr) (int, error)-*func(bool) *dynamodb.TimeToLiveSpecification-*func(bool) *options.FindOneAndReplaceOptions-*func(capability.Capability, ...string) error-*func(context.Context) (*object.Patch, error)-*func(int64, anagent.Handler) anagent.TimerID-*func(interface {}) *options.AggregateOptions-*func(internal.HealthChecker) grpc.DialOption-*func(map[string]*string) *dynamodb.ScanInput-*func(string) (*properties.Properties, error)-*func(string) (*tls.ClientSessionState, bool)-*func(string) ([]diffmatchpatch.Patch, error)-*func(string) *dynamodb.ListGlobalTablesInput-*func(string) *dynamodb.ReplicaSettingsUpdate-*func(string) *dynamodb.TimeToLiveDescription-*func(string) *dynamodb.TransactGetItemsInput-*func(string) *dynamodb.UpdateTimeToLiveInput-*func(string, docker.UpdateNodeOptions) error-*func(string, io.ReadSeeker, ...interface {})-*func(string, net.IPMask, string) *net.IPMask-*func(string, string, []bool, string) *[]bool-*func(string, string, []uint, string) *[]uint-*func(string, string, net.IP, string) *net.IP-*func(string, string, string) (string, error)-*func(string, string, string, string) *string-*func(string, string, uint16, string) *uint16-*func(string, string, uint32, string) *uint32-*func(string, string, uint64, string) *uint64-*func(time.Duration) ([]reflect.Value, error)-*func(time.Duration) *options.DistinctOptions-*func(time.Time) *dynamodb.BillingModeSummary-*func(time.Time) *dynamodb.SourceTableDetails-*map.bucket[*grpc.acBalancerWrapper]struct {}-*map.bucket[http2.FrameType]http2.frameParser-*map.bucket[ini.ASTKind]map[ini.TokenType]int-*map.bucket[int64]*connection.commandMetadata-*map.bucket[metricproducer.Producer]struct {}-*map.bucket[reflect.Type]*proto.unmarshalInfo-*map.bucket[reflect.Type]proto.defaultMessage-*map.bucket[resolver.Address]balancer.SubConn-*map.bucket[string]*sqs.MessageAttributeValue-*map.bucket[string]bsoncodec.fieldDescription-*map.hdr[plumbing.Hash]*packfile.ObjectToPack-*map.iter[reflect.Kind]bsoncodec.ValueDecoder-*map.iter[reflect.Kind]bsoncodec.ValueEncoder-*map.iter[reflect.Type]bsoncodec.ValueDecoder-*map.iter[reflect.Type]bsoncodec.ValueEncoder-*map.iter[uint64]*connection.pooledConnection-*map[string][]*dynamodb.ItemCollectionMetrics-*sqs.ChangeMessageVisibilityBatchRequestEntry-*struct { F uintptr; R *http.http2Transport }-*struct { F uintptr; R *packp.updReqDecoder }-*struct { F uintptr; R *ssh_config.sshLexer }-*struct { F uintptr; R bson.PrimitiveCodecs }-*struct { F uintptr; a []*token.File; x int }-*struct { F uintptr; a []float64; x float64 }-*struct { F uintptr; conf *http.http2Server }-*struct { F uintptr; config *setting.Config }-*struct { F uintptr; opts map[string]string }-*struct { F uintptr; v *vagrantutil.Vagrant }-*struct { sync.Mutex; table [64]big.divisor } BillingMode type:"string" enum:"BillingMode"CPURealtimeRuntimejson:"CpuRealtimeRuntime" IdentityTokenjson:"identitytoken,omitempty" IndexStatus type:"string" enum:"IndexStatus"LastEvaluatedTableNamemin:"3" type:"string"LogEntriesForSlowFollowersjson:",omitempty" NamedCurveOIDasn1:"optional,explicit,tag:0" RegistryTokenjson:"registrytoken,omitempty"ReplicationGrouptype:"list" required:"true" RestartPolicyjson:"RestartPolicy,omitempty" ServerAddressjson:"serveraddress,omitempty" ServiceConfigjson:"serviceConfig,omitempty"-SetProvisionedReadCapacityAutoScalingSettings TableStatus type:"string" enum:"TableStatus"Task'json:"default_task" form:"default_task" Visibility!json:"visbility" form:"visbility" d /qIW(> d / @JqmT( d /kN%y d /*@NZy d /m=Ġ d /wY$ {O d / Z$  d /ѯZ$o1 d /L[$Ӧ d /m@]$C2 d /`]bd d /y^b8  d /.@^bs d /ro^b\9 d /gQ d /l)@gR0 d /o@qW d /der,KT d /_@J,A< d /ze,Z{ d /Y$`, d /, d /!`,Ht d /X,8FF d /l`,l d /_,>° d /\s. d /gt' d /`C%'3 d /" 44W3 d /];I53 d /}33 d / 00!3 d /=  6n3 d /ض @0͗3 d / 9@x3 d / 0@;>y3 d /- 0'[3 d /]_00;~H3 d /~00$W;]3 d /~_ 3 3;p3 d /~ 3 3>3 d /_3;Xef3 d / 41U#3 d / '3 d /)`&;I3 d /+a@r;"f3 d /C;;1"n3 d /4;h3 d / 4`gL=3 d /]@@@i^3 d / @ڷ`& 3 d /q@JU3 d /]y3 d /V@3 d /  93 d /3`&3j3 d /԰ 3 53 d / ` 5Rl3 d /p>@!ס3 d /@3 d /Bf!`M3 d /3`[h3 d /<!$j3 d /"u3 d /!@ ?3 d /;@43 d /z@S!h3 d /D@SZ9R3 d /1!@vVb3 d /nE@3 d /N"`ZV3 d / @;;kd3 d /f!TDR3 d /4T3 d /=V!3 d /V1X3 d /Q`!@(3 d /M`@<迀3 d />``\0 3 d /5 @;;k3 d /7! 3 d /_ch3 d /ʔ!`E 3 d /`>$3 d /x89!r3 d /q9پ3 d /T"9`^$3 d / ;;-V3 d /`! cN3 d /` ms3 d /{!@3 d /D@2}3 d /g!91M3 d /\4O׎3 d />@!:c3 d /T@t73 d /&I!Sk3 d /[Mb3 d / !`Q3 d / `h3 d /:@!@,G3 d /4@@C3 d /2`!Z3 d /E`~u3 d /@!#Z3 d /_@3 d /{` !`IbII3 d /9E` `/3 d /j!@bp/3 d /"@)z3 d /I!!@fhS3 d /#\!@=AT3 d /hgW!3 d /4Wr3 d /"!!`a3 d /!`H[3 d / ?@"!fBYZ3 d /@"q33 d /#! @H3 d //##ɴ3 d /"@!`3 d /6@`k2R3 d /x? $!`G!A3 d / $`uW3 d /2#$!؉3 d /u$-]3 d /!`H3 d /q`&3 d /@!lQ83 d /r#@*3 d /Q`!d3 d /`#my3 d /R!$3 d /5AY3 d / !`Yf3 d /- `3 d /@`%! 3 d /`% ۭ3 d /&!@3 d /:&@ E3 d /|#!WE93 d /W{_3 d /?&!'3 d /;&J3 d /@'!పl3 d /2\@'పhf3 d /XR'!@;3 d /r'@^h*3 d / «O"%3 d /P Ź<9*w3 d / @Y@83 d /P @Yd3 d /C0\iW3 d / p0 ]}cN3 d /4 ȹ S )3 d /| ȹ`R@3 d /r ȹ03 d /@'%]c@3 d /,'f3 d / dd+3 d /k\d'r6I3 d /@f*3 d /p WV3 d /Ee@ժB?c3 d /XZS3 d / J;)u3 d / n `3 d /  =%3 d / ;H@3 d / @Ɵ_{L3 d /[՝D3 d /֝`:d3 d / $z3 d /XJ.y3 d /pp)83 d / `f`&K3 d /N `f`/3 d /  Gv|3 d /9 `I<3 d /X Ig3 d /x g 3 d /R43 d / `wr3 d /õ;)3 d //00Sm3 d /@r;3 d / 93 d /`& 3 d / N1gض3 d / , 3 d / #3 d /La;h9=3 d /ma25w3 d / ##N0B3 d / ###d3 d /d 7X3 d / OBЛE3 d /  Q9pZ3 d /  `23 d /$ ;;3 d /  @0`3 d /  M@3 d /(  @'{3 d /  @7Vw3 d / `^;;WH3 d /';/W3 d /D`2`2>3 d /bι`&`&3 d / @00A3 d /I  4;`3 d / @ 4;"73 d /r `&;h83 d /a  @;t3 d /H  @r;:3 d /u 0I3 d /. ٸw^3 d /}r3ϲpJO3 d /@w |% 3 d /P@ ny3 d / @ӟ`&C3 d / @FC3 d / @>WY3 d / @@?3 d / @S923 d /* @0oA3 d / @O /)3 d / e@^+@g3 d /!@!X3 d /.@?_Q3 d /h `&`&D3 d /"@0@ӟk3 d /@ӟs(h3 d /. @ӟ;EN=k3 d /@`8Y3 d /`@;;~L}3 d / @; 3 d /]@n B3 d / @'c3 d /<`.l3 d / \X3 d /D  3 d /\X3 d /D @܆C3 d /N N4P3 d /`&MO3 d / z'{3 d /u V|3 d /~@3 d /=ҟ=F3 d /7w+ 3 d /;83 d /  ܑT3 d /w;`&3 d / Ģa3 d /  `3 d /Y`&am5D#3 d /`&@cq3 d /=`&e9k3 d /=`&w3 d /}`&0l3 d / ' 1(3 d /c0s3 d /[3vW3 d /;ir3 d /w;`&hx33 d /;1<3 d /;k3 d /D;; 3 d /* ~gv3 d / ۷ŲG3 d /0 I;U3 d /=@/$3 d / ;'3 d /Ӏk3 d /K3 d /X @3 d /u 0$3 d /h@nO3 d /"`u/Y/3 d / 03 d /M ~fπ3 d / `1a3 d /*53 d /Ԝy^3 d /U`!3 d /Zȝ3 d /K@ɝK(3 d /@ H3 d /b` W]3 d / fi3 d /؝GC-3 d /_Gڢp3 d /*`3 d /@nZ3 d /E;xr3 d /  'ӑ3 d /W03 d / yz63 d / Wu3 d /gy@@^#_3 d /ਫ/%3 d / y; Ҹ3 d /dH00SB$+3 d /nBC3 d / &:3 d /Ф@0G:m3 d /Bhฤ`&'43 d /`k`³;SM3 d /yևM43 d /]y`+bSz3 d /}  z0[N3 d /[ 5`&Fs3 d /f 5003 d /@ӟ@ӟ%3 d /#  G3 d /0ವ J%3 d /,Qؐ3 d /s # R3 d /I3 d /Uā3 d /j`  3 d /|#0ǵ3 d /s X3 d /ԧ ;h3 d / `h3 d /Á@dC3 d /`ū0Dn3 d /tƫ]3 d /9@Xy3 d /%@ǫ@83 d / @_73 d /KǫXz3 d /Utȫr3 d /`ȫBR3 d /ȫi43 d / ɫV@<3 d /;mCwF3 d /`Ϋҏ63 d /G ϫ@T3 d /6ϫVu3 d /9@Ы@3 d /޴3 d /2޴Ā3 d /:  3 d / ׫Ӹt 3 d / ׫ 3 d / ۫`ոt 3 d / ۫?3 d / @ӟ3 d /yp3 d /is 0 @3 d /R QŹVC3 d / Q0@ӟ3 d / 006a3 d /HV`wP,3 d /``r"3 d /5I3 d /β Sc3 d / `Bk3 d / `Tw3 d /``B X3 d /  62g3 d /  6UJGW3 d / 6W-3 d /x"@N; %3 d /G T2T3 d /0 T@nkA3 d /6 T@n=?h3 d /p T@n+"83 d /@ T@n)3 d /? T@nkD3 d / T@n@Zr3 d /" T@n@,(ʁ3 d /8 T@n~3 d / T@nRR 3 d /~G T@no3 d /3 T@n@2,~.3 d /4 T@n-Ɔ3 d /5 T@n?3 d /7 T@ns3 d /@ T@n@u3 d /k7 T@n@f3 d / T@n.ȭ3 d /o T@n-u "3 d /T4 T@ne3 d /R$ T@n"3 d / T@n@Bo3 d /4 T@n$a3 d /E6 T@n`Pt3 d / T@n.9 z3 d /? T@nSŢ3 d /N3 d /:nB|3 d /A0; 3 d / 0;3 d /) >0ט;3 d /  A 3;Zl3 d /8@rL(3 d /$EEE 3 d /Vw3 d /c I #3 d /. `U3 d /9 `hxP$3 d / O3 d / ;J~3 d / @3 d /\V;^O,43 d /V 63 d /_?P.3 d /  '~3 d /e r8yF3 d /! d3 d /  31&3 d / ]V3 d / `3 33 d /e \?.Ռ3 d /K  \ '`43 d / 5p`93 d / I`Y3 d / I@F3 d /A]8c-3 d /Aǣp3 d / yf3 d / y@ժm3 d /Y `&` 3 d /``&@ߟy3 d /`&@Ώ3 d /'`&+H3 d / '';PL3 d /" '0+3 d /T'@@D3 d /C ' 3 d /h'򼰔3 d /^'@ӟ` zAЍ3 d /le';;N X3 d /l ' 5]ç3 d /e'`&b ,3 d /''` h3 d /''*f"3 d /@ '';&d3 d /'' &d3 d /''yL3 d /Ȧ'0B93 d /`\3 d /O ``Y3/3 d /i `@3 d / `@HY3 d /` '&v3 d /H ``sw3 d /`z3 d / `V\U3 d /e`0\3 d /5@ '[23 d /' @@io`3 d / @f3 d /y@&]3 d /I@;j33 d /r @ٍ3 d / @׫ٍ3 d / @۫9i3 d /E@ M 3 d /D @'3 d / @ 6)3 d / @0@ӟ/z3 d /+x~]3 d /3'3 d / Q 3;&3 d / ࠲@E3 d /@ r s)3 d / V ͨ`3 d / Vͨ o3 d /-v`³β9F3 d / ͨk,3 d /ͨ53 d /PI S.q3 d / ͨ3 d /]ͨ:3 d /q 9 :3 d /q 9˦3 d / 9 9 i3 d /S 9 9,P3 d /  9 9;c%W3 d /P 0@;ľj 3 d /_ 0@x9n3 d / 03 d /M0|3 d /U 0f3 d /= 0YW3 d /| 03 d /X 0o3 d /b 0' c3 d /T 0 3 d / 03 d /. 0^3 d / 0 -\B3 d / 0ɱ3 d / 0`$ 3 d / 0f]Vf3 d / 0*3 d / 0'׆3 d / 0`? V3 d / 0pa3 d / 03 d / 04tu3 d / 07U3 d / 0T3 d / 0F_3 d /Ѧ0;` 3 d /f0#;D3 d / 0*3 d /0 0Q+3 d /0`2T3 d / 0>4s3 d /hv0wMwB3 d / 0 a3 d / 0@FQ3 d /?0f=r3 d /0qŶ3 d / 0@D5q3 d / 0]X3 d / 0@x@3 d /0ҟ]B3 d /0ٟ3 d / 0@ߟ(_3 d /ͅ0@,L3 d / 053 d /?0[kf3 d /f0XI3 d /0; 3 d /0;00R3 d /g0`B3 d /:g0B掻3 d / 083 d / 0,W3 d / 0@o3 d /00 K?3 d /T0:4>3 d / 0SY3 d /! 0`IFў3 d /0YV63 d /A! 0 $3 d /, 0(d3 d /x0@̢3 d / 0`dv}3 d / 0*XL3 d / 0CK3 d / 06G3 d /0`&Y3 d /0&ވ3 d /0&!3 d /"0 '7[l3 d /0`'3 d /6 0'ܽP3 d /:0@=G\3 d / 023 d / 0"4T3 d /?0`Ʒi3 d /0,h63 d /]0NU13 d /\ 0O+x3 d /0@{}y3 d / 0r"S3 d / 0α;O3 d /m! 0`³;3 d /A00;D j+3 d /@00%3 d /? 0y3 d /027߱3 d /2@023 d /R@0 3@A3 d /r@0`3l3 d /`03k73 d / 0`93 d / 0R3 d //0:73 d /` 0@6Ft3 d /" 0_3 d /60. ٸ^T؃3 d /s0.`\|3 d /w0@ߴ)3 d /a0ş 3 d /R0şabfV3 d /+0@ӟ3 d /P 0@ӟ3 d / 0@ӟ0 c3 d / 0@Ftj03 d /h0@dN3 d /w0@013 d /2A0@g*n3 d /Xz0;;_" 3 d /0;( 3 d /F0;`&3 d /!h0;zN3 d /Bh0BB3 d /" 0şl#q3 d /" 0 q0Y63 d /0`;*eM3 d / 0@; 3 d /x0 C#13 d /0 r^3 d /\0 3 d / 0SyM3 d /f 0|3 d /0 3h3 d /0`c?3 d / 0I)3 d /0磍g3 d /033 d /<0 (3 d / 0'J3 d / 0_63 d / 03 d / 00^3 d / 0`H 3 d /w 0`&   3 d /0`&@cZ#3 d /RA0`&d3 d /0`&@3 d /0`&`&Ց3 d /0`&0j3 d /t 0&@733 d /0 ' 'À%3 d /%# 0'ŹI3 d /0'E3 d /3 0'@ߴG3 d / 0''#&3 d / 0 h@ӟ3 d /ި0 sH{3 d /٠ 00`P~{3 d / 00QmW[3 d / 00@EWq3 d /P 00H6h3 d / 00F1 3 d /1 00F23 d /001 3 d /1 00>.ɗ3 d /ch00@<ij3 d /00;.Є3 d /00֊C3 d / 00@ߴ63 d /Ť00`&롳3 d /000i3 d / 00@ӟBn3 d /00J23 d / 0yySx3 d /02P^3 d /sz022V3 d /0`3`33 d /_ ~000C3 d / y^T3 d / y0.3 d /&y`&@3 d /jy`&͠3 d /,y@-ͅ3 d / y`&NP3 d /X'!}3 d /: 2д vq3 d /@ 2 隄3 d /A 2E9=#3 d / 3;m$3 d /^ 3 4Hմt3 d /"x 3f;؈3 d /A 3 3VCF3 d /  3`@ŀ3 d /  3,M3 d /j  3P/\`3 d /M  3U3 d /U 3 3*L^3 d /5`3;"GV3 d / `33{3 d /B3|^3 d /X30&3 d /z3`&0 A3 d /w30`&~3 d /2B33$&3 d /  433rsu3 d /  4 4;$B 3 d /ޱ-B3 d /iޱD{ 3 d /G%ޱ@3 d /Kޱ83 d /ޱT'3 d /ޱv3 d /.ޱɳg.3 d /oޱ UW[3 d /ޱ`Ȣd d /0x6 d /%@hs d /``:I d / MI# d /@4D1 d /,0+ d /,0lx d /l@0U%{ d /) 1  d / 1'{ d /R@ 1ҫb d /l 1|~ d /@ 1E d /E 1R d /') 1R d /u 10PWM d /@ 1h d /K@ 1r d /5 1U d /A 1q2 d /;6@ 1v d /q(%? d /!@  d / @ԖQ d /OXXM/ d /S:X01 d /0D/ d /` tT d /@i| d /n% Nu d /% N;v d /@ d / d /NG51 d /  d /o|.>) d /0:T d /]%@ ;<&S d /"7/m d //9 d /=6 z d /V d /@*p d /*-l d /̨p*چ d /H`* nR d /`* d /o`*6@ d /o*$m d /p`*-? d /*@ d /`*Jpa d /ߨ*tD d /g*_l d /[.`*& d /p.*Lc d /.`*F. d /.*,r~ d /`*+h d /`*. d /0@;6C d /3 !* d /23 !fO( d /   o1  d / z d /x6ҧ d /8@6V*) d /@ 2g d /m LjI d /n;Ʈ d /; d /L;\ d /I(@7 $FM d /z NX d /Yoa d /*@Ysv3 d /e d /yW+ d /<`\@ d /@"ԝ d /$". d /`" ٥ d /#p_s d /(`&+_" d /n@.+  d /S.+mך d /M@4 '7 d /4 'G d /@5 'յk d /5 'l d /QM5 ' d /-@6 'Ǣ d /@p6 '(, d /8n9`7_N d /k@;`7ֻ d /8<`7a> d /`7i d /J;DG d /P ,i~#d d /a7@S,?2 d /{@,D2 d /U@yaY d /C.V@| d /`f@V9 d /W줌1 d /4j_, d /mi1? d /j1LA d / m< d /Tn= d /q=% d /os=ű d /x$s=Jq d /=t=Q d /u`0) d /j{ d /)|)K d /~ H d /F~ `b d / *crF d /`l d /@D\  d /-"@D+2 d /aDv d /?Dky d /@DȨ d / 9Mh d /h 9uW d /v\@@ w d /]y-}A d /^@XbM d /Z d /@qh߭ d /p@*. d /*Q d /0=L d /8@0 3 d /v䪪 d /@>E d / Uy  d /}! d /'%@? d /Y% d /\z d /$ d /8p d /ZZWj d /kO d /v3< d /D-Jk d /6# d /F?W d /m@ d /K; d / d /HqS d /,΀ d /<@A d /E? d /N' d /qW d /@'-Z d /xxn d /@- d /- d /+1,%7ӈ d /#@5(~. d /j@(X d /6( d /(_B>f d /`J d /"\: d /o]| d / _ d /e!  Y d / |> d /  5A d /b N d /ccUˤ d /`@ G d /[ | d /`f@ 9 d / .github.com/MottainaiCI/mottainai-cli/cmd/token.**sqs.ChangeMessageVisibilityBatchRequestEntry.*[]func(*http.Server, *tls.Conn, http.Handler).*[]func(*idxfile.MemoryIndex, io.Reader) error.*func() (*pubsub.StreamingPullResponse, error).*func() (int, syscall.Sockaddr, string, error).*func() (string, bsonrw.DocumentReader, error).*func() *descriptor.FieldDescriptorProto_Label.*func() []*descriptor.EnumValueDescriptorProto.*func(*[]bool, string, string, []bool, string).*func(*[]uint, string, string, []uint, string).*func(*big.Int, *big.Int) (*big.Int, *big.Int).*func(*bsoncodec.Registry, interface {}) error.*func(*bufio.Writer, io.Writer) io.WriteCloser.*func(*dynamodb.BatchGetItemOutput, bool) bool.*func(*dynamodb.Get) *dynamodb.TransactGetItem.*func(*net.IP, string, string, net.IP, string).*func(*net.IPMask, string, net.IPMask, string).*func(*object.TreeEntry) (*object.File, error).*func(*options.Collation) *options.FindOptions.*func(*string, string, string, string, string).*func(*transport.Stream, *status.Status) error.*func(*uint16, string, string, uint16, string).*func(*uint32, string, string, uint32, string).*func(*uint64, string, string, uint64, string).*func(...macaron.Handler) *macaron.ComboRouter.*func([]interface {}) ([]reflect.Value, error).*func([]string, toml.SetOptions, interface {}).*func([]uint8) (*properties.Properties, error).*func([]uint8) (bsontype.Type, []uint8, error).*func([]uint8, []uint8) (cipher.Stream, error).*func(agenttasks.Task) (string, string, error).*func(balancer.SubConn, balancer.SubConnState).*func(bool, func(int32) bool) ([]uint8, error).*func(context.Context, *git.PullOptions) error.*func(context.Context, *git.PushOptions) error.*func(context.Context, *pubsub.Snapshot) error.*func(context.Context, *tasks.Signature) error.*func(context.Context, string) (string, error).*func(context.Context, string) context.Context.*func(docker.InitSwarmOptions) (string, error).*func(int, int) (int, syscall.Sockaddr, error).*func(int64) *sqs.ChangeMessageVisibilityInput.*func(int64) *sqs.SendMessageBatchRequestEntry.*func(io.Writer, ...interface {}) (int, error).*func(map[string]*string) *dynamodb.QueryInput.*func(map[string]interface {}) agenttasks.Plan.*func(map[string]interface {}) agenttasks.Task.*func(net.Conn) (*http.http2ClientConn, error).*func(options.CursorType) *options.FindOptions.*func(plumbing.ObjectType, int64, int64) error.*func(string) ([]docker.APIImageSearch, error).*func(string) *dynamodb.CreateGlobalTableInput.*func(string) *dynamodb.ExpectedAttributeValue.*func(string) *dynamodb.GlobalTableDescription.*func(string) *dynamodb.ListGlobalTablesOutput.*func(string) *dynamodb.UpdateGlobalTableInput.*func(string) *sqs.SendMessageBatchResultEntry.*func(string, ...interface {}) (string, error).*func(string, ...interface {}) *packfile.Error.*func(string, docker.RemoveImageOptions) error.*func(string, int) ([]*tasks.TaskState, error).*func(string, string, *agenttasks.Task) string.*func(string, string, string, ...interface {}).*func(textproto.MIMEHeader) (io.Writer, error).*func(time.Duration) *options.AggregateOptions.*func(viper.RemoteProvider) (io.Reader, error).*map.bucket[jwalterweatherman.Threshold]string.*map.bucket[plumbing.Hash]*packfile.deltaIndex.*map.bucket[plumbing.Hash]*packfile.objectInfo.*map.bucket[proto.extPropKey]*proto.Properties.*map.bucket[scram.KeyFactors]scram.derivedKeys.*map.bucket[string]*dynamodb.KeysAndAttributes.*map[errcode.ErrorCode]errcode.ErrorDescriptor.*map[http.connectMethodKey][]*http.persistConn.*map[http.http2FrameType]http.http2frameParser.*map[reflect.Type]*bsoncodec.structDescription.*struct { F uintptr; R *http.http2ClientConn }.*struct { F uintptr; R *http.http2serverConn }.*struct { F uintptr; R *json.condAddrEncoder }.*struct { F uintptr; R *knownhosts.hostKeyDB }.*struct { F uintptr; R *pubsub.TopicIterator }.*struct { F uintptr; R *ssh_config.sshParser }.*struct { F uintptr; R *transport.writeQuota }.*struct { F uintptr; R bsoncodec.CodecZeroer }.*struct { F uintptr; R bsonx.PrimitiveCodecs }.*struct { F uintptr; addr *uint32; ret int32 }.*struct { F uintptr; errs *scanner.ErrorList }.*struct { F uintptr; hf *[]hpack.HeaderField }.*struct { F uintptr; m map[string]*flag.Flag }.*struct { F uintptr; net string; portnum int }.*struct { F uintptr; snapshot strings.Reader }.*struct { sync.Once; u *user.User; err error } AvatarURL#json:"avatar_url" form:"avatar_url"ConnectTimeoutmapstructure:"connect_timeout"ContinuousBackupsDescriptiontype:"structure"DockerEndpointmapstructure:"docker_endpoint" DockerVersionjson:"docker_version,omitempty"ExclusiveStartTableNamemin:"3" type:"string" KeySchema#min:"1" type:"list" required:"true"LastEvaluatedBackupArnmin:"37" type:"string" ReturnValues type:"string" enum:"ReturnValue".SetProvisionedWriteCapacityAutoScalingSettings StartTime#json:"start_time" form:"start_time"TableMaxReadCapacityUnitsmin:"1" type:"long" ThrottledTimejson:"throttled_time,omitempty"/*[6]func(*idxfile.MemoryIndex, io.Reader) error/*[8]func(*http.Server, *tls.Conn, http.Handler)/*[]*sqs.ChangeMessageVisibilityBatchResultEntry/*func(*cryptobyte.String, *bool, asn1.Tag) bool/*func(*http.http2serverConn, interface {}) bool/*func(*options.Collation) *mongo.DeleteOneModel/*func(*options.Collation) *mongo.UpdateOneModel/*func(*options.Collation) *options.CountOptions/*func(*options.Collation) *options.IndexOptions/*func(*packet.PrivateKey, *packet.Config) error/*func(*template.escaper, template.context) bool/*func(...proto.Message) (*status.Status, error)/*func([]*sqs.Message) *sqs.ReceiveMessageOutput/*func([]string) (*properties.Properties, error)/*func([]uint8, []uint8, []uint8, []int) []uint8/*func([]uint8, []uint8, bool) (int, int, error)/*func(agenttasks.StateRequest, agenttasks.Task)/*func(bool) *dynamodb.AutoScalingSettingsUpdate/*func(context.Context, *git.FetchOptions) error/*func(context.Context, connectivity.State) bool/*func(context.Context, interface {}, int) error/*func(func(plumbing.EncodedObject) error) error/*func(interface {}, interface {}) (bool, error)/*func(io.Writer, bool, bool) bsonrw.ValueWriter/*func(map[string]*string) *sqs.CreateQueueInput/*func(scram.KeyFactors) scram.StoredCredentials/*func(string) *dynamodb.AutoScalingPolicyUpdate/*func(string) *dynamodb.DescribeTimeToLiveInput/*func(string) *dynamodb.ListTagsOfResourceInput/*func(string) *dynamodb.LocalSecondaryIndexInfo/*func(string) *dynamodb.TimeToLiveSpecification/*func(string) *dynamodb.TransactWriteItemsInput/*func(string) *sqs.ChangeMessageVisibilityInput/*func(string) *sqs.SendMessageBatchRequestEntry/*func(string, docker.UpdateConfigOptions) error/*func(string, docker.UpdateSecretOptions) error/*func(string, string) (docker.TopResult, error)/*func(string, string, []uint8, string) *[]uint8/*func(string, string, float32, string) *float32/*func(string, string, float64, string) *float64/*func(string, string, string, amqp.Table) error/*func(time.Time, time.Duration) trace.eventLogs/*func(uint32, *runtime.siginfo, unsafe.Pointer)/*func(uint32, http.http2ErrCode, []uint8) error/*map.bucket[balancer.SubConn]connectivity.State/*map.bucket[reflect.Kind]bsoncodec.ValueDecoder/*map.bucket[reflect.Kind]bsoncodec.ValueEncoder/*map.bucket[reflect.Type]*proto.marshalElemInfo/*map.bucket[reflect.Type]bsoncodec.ValueDecoder/*map.bucket[reflect.Type]bsoncodec.ValueEncoder/*map.bucket[uint64]*connection.pooledConnection/*struct { F uintptr; R *bsoncodec.StructCodec }/*struct { F uintptr; R *pubsub.StringIterator }/*struct { F uintptr; R *runtime.itabTableType }/*struct { F uintptr; R *transport.http2Client }/*struct { F uintptr; cc *http.http2ClientConn }/*struct { F uintptr; f internal.HealthChecker }/*struct { F uintptr; fn func(viper.FlagValue) }/*struct { F uintptr; it *pubsub.TopicIterator }/*struct { F uintptr; objects *[]plumbing.Hash }/*struct { F uintptr; pw *os.File; c *exec.Cmd }/*struct { F uintptr; res *[]uint8; err *error }/*struct { F uintptr; sc *http.http2serverConn }/*struct { F uintptr; sub *proto.unmarshalInfo }/*struct { F uintptr; t *transport.http2Client }/*struct { F uintptr; tlist *[]agenttasks.Plan }/*struct { F uintptr; tlist *[]agenttasks.Task }/*struct { F uintptr; traceIDUpperBound uint64 }/*struct { F uintptr; w io.Writer; pr *os.File }/*struct { Name string; E *big.Int; N *big.Int }/*struct { Name string; ID string; Key []uint8 }/*struct { compIndex uint8; td uint8; ta uint8 }/*struct { runtime.timersBucket; pad [28]uint8 } AuxAddress#json:"AuxiliaryAddresses,omitempty" BackupStatus!type:"string" enum:"BackupStatus"ClientHostNamejson:"clientHostName,omitempty"ClientLanguagejson:"clientLanguage,omitempty"DockerCapsDropmapstructure:"docker_caps_drop"DockerInDockermapstructure:"docker_in_docker"EndpointConfigjson:"EndpointConfig,omitempty" Entrypoint#json:"entrypoint" form:"entrypoint"ExclusiveStartBackupArnmin:"37" type:"string" Identities#json:"identities" form:"identities"IsRegionalizedjson:"isRegionalized,omitempty"MD5OfMessageBodytype:"string" required:"true"MaxWireVersionbson:"maxWireVersion,omitempty"MinWireVersionbson:"minWireVersion,omitempty"Name)json:"pipeline_name" form:"pipeline_name"NoOverwriteDirNonDirqs:"noOverwriteDirNonDir"TableMaxWriteCapacityUnitsmin:"1" type:"long"UpdateExpressiontype:"string" required:"true"WebHookGitHubTokenmapstructure:"github_token"0github.com/MottainaiCI/mottainai-cli/cmd/profile0github.com/MottainaiCI/mottainai-cli/cmd/storage0github.com/MottainaiCI/mottainai-cli/cmd/webhook0*[]*sqs.ChangeMessageVisibilityBatchRequestEntry0*func() (map[int32]proto.Extension, sync.Locker)0*func() func(io.Writer, string, ...interface {})0*func() grpc_binarylog_v1.GrpcLogEntry_EventType0*func() grpc_binarylog_v1.isGrpcLogEntry_Payload0*func() pubsub.isPushConfig_AuthenticationMethod0*func(*[]uint8, string, string, []uint8, string)0*func(*config.RemoteConfig) (*git.Remote, error)0*func(*dynamodb.Put) *dynamodb.TransactWriteItem0*func(*float32, string, string, float32, string)0*func(*float64, string, string, float64, string)0*func(*options.Collation) *mongo.DeleteManyModel0*func(*options.Collation) *mongo.ReplaceOneModel0*func(*options.Collation) *mongo.UpdateManyModel0*func(*options.Collation) *options.DeleteOptions0*func(*options.Collation) *options.UpdateOptions0*func(*readpref.ReadPref) *options.RunCmdOptions0*func(*tls.ClientHelloInfo) (*tls.Config, error)0*func([]*dynamodb.Replica) *dynamodb.GlobalTable0*func(client.Request) (event.APIResponse, error)0*func(client.Request, string, string, int) error0*func(context.Context) (object.FileStats, error)0*func(context.Context, *readpref.ReadPref) error0*func(context.Context, string) ([]string, error)0*func(context.Context, string) (net.Conn, error)0*func(int64) *dynamodb.AutoScalingSettingsUpdate0*func(interface {}) *options.ChangeStreamOptions0*func(interface {}, *list.Element) *list.Element0*func(interface {}, asn1.Tag, interface {}) bool0*func(map[string]*string) *dynamodb.GetItemInput0*func(map[string]*string) *dynamodb.PutItemInput0*func(plumbing.Revision) (*plumbing.Hash, error)0*func(reflect.Value, reflect.Type) reflect.Value0*func(string) *dynamodb.DescribeGlobalTableInput0*func(string) *dynamodb.GlobalSecondaryIndexInfo0*func(string) *dynamodb.ListTagsOfResourceOutput0*func(string) *sqs.DeleteMessageBatchResultEntry0*func(string, ...macaron.Handler) *macaron.Route0*func(string, bool) (amqp.Delivery, bool, error)0*func(string, docker.UpdateServiceOptions) error0*func(string, int, int, ssh.TerminalModes) error0*func(string, string) (event.APIResponse, error)0*func(string, string) (string, string, []string)0*func(time.Duration) *options.DropIndexesOptions0*func(time.Duration) *options.ListIndexesOptions0*func(wiremessage.WireMessage) *command.IsMaster0*map.bucket[http.connectMethodKey]chan struct {}0*map.bucket[plumbing.Hash]*packfile.ObjectToPack0*map.bucket[reflect.Type]*proto.StructProperties0*map.bucket[string]*binarylog.methodLoggerConfig0*map.hdr[string]*sqs.SendMessageBatchResultEntry0*map[reflect.Type]map[gob.typeId]**gob.decEngine0*map[reflect.Type]map[int32]*proto.ExtensionDesc0*struct { F uintptr; R *http.http2clientStream }0*struct { F uintptr; R *http.onceCloseListener }0*struct { F uintptr; R *pubsub.messageIterator }0*struct { F uintptr; a []token.lineInfo; x int }0*struct { F uintptr; codes []bzip2.huffmanCode }0*struct { F uintptr; enginePtr **gob.decEngine }0*struct { F uintptr; hashFunc func() hash.Hash }0*struct { F uintptr; it *pubsub.StringIterator }0*struct { F uintptr; n *int; buf *bytes.Buffer }0*struct { F uintptr; pp *runtime.p; sc uintptr }0*struct { F uintptr; s stringprep.Set; r int32 }0*struct { F uintptr; src uintptr; dst *uintptr }0*struct { F uintptr; walkErr error; err *error }0*struct { docker.closerFunc; docker.waiterFunc }0*struct { root runtime.semaRoot; pad [52]uint8 }AccountMaxReadCapacityUnitsmin:"1" type:"long"BrokerDefaultQueuemapstructure:"default_queue"BrokerExchangeTypemapstructure:"exchange_type" IndexName%min:"3" type:"string" required:"true"PointInTimeRecoveryDescriptiontype:"structure"#ReplicaGlobalSecondaryIndexSettings type:"list"#ReplicaProvisionedReadCapacityUnits type:"long" RequestItems"min:"1" type:"map" required:"true"0SetGlobalTableGlobalSecondaryIndexSettingsUpdate TableName%min:"3" type:"string" required:"true"1github.com/MottainaiCI/mottainai-cli/cmd/pipeline1github.com/MottainaiCI/mottainai-cli/cmd/settings1github.com/MottainaiCI/mottainai-cli/cmd/simulate1*[]struct { compIndex uint8; td uint8; ta uint8 }1*[]struct { runtime.timersBucket; pad [28]uint8 }1*descriptor.EnumDescriptorProto_EnumReservedRange1*func() (ssh.Channel, <-chan *ssh.Request, error)1*func() (unsafe.Pointer, syscall._Socklen, error)1*func() descriptor.MethodOptions_IdempotencyLevel1*func(*amqp.Channel, string) (*amqp.Queue, error)1*func(*git.GrepOptions) ([]git.GrepResult, error)1*func(*git.LogOptions) (object.CommitIter, error)1*func(*options.Collation) *options.FindOneOptions1*func(*options.Collation) *options.ReplaceOptions1*func(*packet.PublicKey, *packet.Signature) error1*func(*readpref.ReadPref) *options.SessionOptions1*func(*transport.Endpoint) (storer.Storer, error)1*func([]*dynamodb.Tag) *dynamodb.CreateTableInput1*func([]*dynamodb.Tag) *dynamodb.TagResourceInput1*func([]*float64) *dynamodb.ItemCollectionMetrics1*func([]request.Option) (*request.Request, error)1*func([]string) (*cobra.Command, []string, error)1*func([]trace.Attribute, string, ...interface {})1*func([]uint8, []uint8, []uint8, []uint8) []uint81*func(address.Address) (description.Server, bool)1*func(context.Context, *event.CommandFailedEvent)1*func(context.Context, string) ([]*net.MX, error)1*func(context.Context, string) ([]*net.NS, error)1*func(context.Context, string, *iam.Policy) error1*func(docker.CreatePluginOptions) (string, error)1*func(idtools.Identity) (idtools.Identity, error)1*func(int, int64, int, int, int) ([]uint8, error)1*func(int64) *dynamodb.ReplicaSettingsDescription1*func(io.Reader, []uint8) (*ssh.Signature, error)1*func(options.ArrayFilters) *mongo.UpdateOneModel1*func(options.CursorType) *options.FindOneOptions1*func(reflect.Value, reflect.Value) (bool, error)1*func(string) *dynamodb.AutoScalingSettingsUpdate1*func(string) *sqs.DeleteMessageBatchRequestEntry1*func(string, string, []net.IP, string) *[]net.IP1*func(string, string, []string, string) *[]string1*func(string, string, bool) []diffmatchpatch.Diff1*func(string, string, string, string, bool) error1*func(string, url.Values) (*http.Response, error)1*func(time.Duration) (string, http.Header, error)1*func(time.Duration) *options.ChangeStreamOptions1*func(time.Duration, int) []timeseries.Observable1*func(time.Time) *dynamodb.GlobalTableDescription1*func(time.Time, time.Time) timeseries.Observable1*map.bucket[logging.level]logging.LoggerInterface1*map.bucket[string]*dynamodb.AttributeValueUpdate1*map[http.connectMethodKey]chan *http.persistConn1*map[string][]map[string]*dynamodb.AttributeValue1*struct { F uintptr; R *net.ipStackCapabilities }1*struct { F uintptr; R *pubsub.SnapshotIterator }1*struct { F uintptr; R *pubsub.SubscriberClient }1*struct { F uintptr; h hash.Hash; buf *[9]uint8 }1*struct { F uintptr; handlers []macaron.Handler }1*struct { F uintptr; ids []int64; startID int64 }1*struct { F uintptr; it *pubsub.messageIterator }1*struct { F uintptr; mergeInfo *proto.mergeInfo }1*struct { F uintptr; missingFlagNames *[]string }1*struct { F uintptr; result *[]string; s string }1*struct { F uintptr; sp uintptr; _g_ *runtime.g }1*struct { F uintptr; stopTimerCh chan struct {} }1*struct { F uintptr; u *big.Float; x *big.Float }1*struct { F uintptr; u *ssh_config.UserSettings }1*struct { F uintptr; v *viper.Viper; err *error }AccountMaxWriteCapacityUnitsmin:"1" type:"long"AttributeDefinitionstype:"list" required:"true" BackupArn&min:"37" type:"string" required:"true" BackupName%min:"3" type:"string" required:"true" BackupType%type:"string" enum:"BackupTypeFilter" CacheClean%json:"cache_clean" form:"cache_clean" CacheImage%json:"cache_image" form:"cache_image"CachePeriodInMinutestype:"long" required:"true"Config)json:"Config" yaml:"Config" toml:"Config"Driver)json:"Driver" yaml:"Driver" toml:"Driver" ExitStatus%json:"exit_status" form:"exit_status"Get,protobuf:"bytes,2,opt,name=get,proto3,oneof"GroupMetasTable mapstructure:"group_metas_table"HealthCheckExec mapstructure:"health_check_exec"Labels)json:"Labels" yaml:"Labels" toml:"Labels" LastReport%json:"last_report" form:"last_report"Name+json:"name,omitempty" yaml:"name,omitempty"ProvisionedReadCapacityUnitsmin:"1" type:"long"Put,protobuf:"bytes,3,opt,name=put,proto3,oneof"$ReplicaProvisionedWriteCapacityUnits type:"long" ReplicaStatus"type:"string" enum:"ReplicaStatus"RestoreDateTime type:"timestamp" required:"true"RestoreInProgresstype:"boolean" required:"true"ResultsExpireIn mapstructure:"results_expire_in"TaskStatesTable mapstructure:"task_states_table"UploadChunkSize mapstructure:"upload_chunk_size"Version(asn1:"optional,explicit,default:0,tag:0"VisibilityTimeouttype:"integer" required:"true"WebHookGitHubSecretmapstructure:"github_secret"dB3 d /6bQ = d /X dБ EW d /g3   d /kJ3%ѾX3 d /ʆ @ӟѾX3 d /ʆ ` @ӟP[3 d /`&`b0Ǥ3 d /  3 3 3 3 3 d /* @0f0;Y3 d /z @0ҟ0 R3 d /J 0ٟ043 d /w 0@0)3 d /q00@3 d /S 00[X@3 d / @r;D3 d / 00:G[f3 d /  0;83 d /+ 0;0bˁ3 d /s Ü0`B0jy3 d / Ĝ0B0MU@3 d /Ӝ`&৪Mv3 d /Zg`&@%3 d /ۜ''!ɪ3 d /w@Y@@Y@/j3 d /``3 d /lȹ0Qǚ3 d /-@f!{3 d /;`@fA|3 d /(@`@fA 3 d / 0`&0[ 3 d / 000+3 d / @0&03 d / 0&03 d / 0 '0á33 d / 0`'0V#3 d /[|00B/g3 d /}0"03`1 3 d /Ra3 d /c eXf3 d /l `&2)#3 d / 0`Ʒ0ڠ^3 d /!0,0aQ523 d / `W0N023 d /CF Q 93 d /< 0 E3 d /; 3 d /#??;fT3 d / @000١S3 d /\ɴ0y0O%43 d / 020Dv3 d / 0203 d / @0 3053 d /? 0`30z3 d / 0303 d / @r;.3 d /\@00fߒ3 d /2@Ÿ`@]qV 3 d /ǟ2FbP.>3 d /hǟ2"3 d /2ҟҟ;^3 d /!@@Y@d]3 d / @0;'G3 d /O]r=3 d /m 633 d /! `&@]]P@3 d / `&3 d /ߚ `&3 d / `&`j9!3 d / `&`bl]3 d /L @`&;3 d /q `&>A'y3 d / `&C3 d /w tr3 d /`L3 d / `&Rh3 d / g 3 d /9 ;'3 d / ;/>3 d /;`&13 d /`BC,3 d /x  '`&PY43 d / '3 d / `j`&CJ3 d /p `b`&򛜤3 d /  3`&<@x3 d /» 3`&_}3 d /1; t3 d /3 d / 0`Ъ&3 d /@Ӝ㨬W3 d /xSԜ(3 d /P#@k3 d /E@`23 d /`Vkp3 d /(N3 d /p23 d /3 d /w`!@(3 d /"D`"@3 d /~8`$\3 d /s`%y3 d /<`&(H?3 d /E`\n3 d /S@gD3 d /`I҂ț3 d /IW;B3 d /5NTN3 d /a5 Ө2.3 d /8%Tp+B3 d /'03 d /5'0y\3 d /#'2q+3 d /'`&pw3 d /<h`*]%3 d /k0,83 d /0Q*:3 d /@0`z3 d /"0L~_3 d /#0LQI3 d /0ٟZ3 d /0@8c~3 d /0#73 d /&003 d /H#0`G\#3 d /y;?R3 d /5b`Fv 3 d /Zr஫;஫Qc3 d /$ ஫`&#3 d / 00e3 d /)  `&`&H53 d /u@ӟ'"3 d /b@''3 d /&Ǩ''eZ3 d /6 000 93 d /Z$` Ш z3 d /$``B 9.)3 d /$ε` 9]3 d /`B 6y 3 d /g` 6S3 d /4@@@r3 d /&ge3 d /_'9 @Q)x3 d /  Tl13 d /A \Vk;3 d /& \ j}3 d /r \ ' 'b3 d /' 5;p:'A3 d /Ny@fvB.3 d /xõõ`& Bd3 d /i`&`&0Ŝd3 d /U `&`&`bj3 d / e`&`&0IK3 d / `&`& lI7S3 d /s `&`&מ]x3 d / `&`&؞@W|3 d /{ `&`&@؞3 d / `&`&ٞţ3 d /`&`&` w3 d /;`&`&;m=X3 d /M`&`&`&=+3 d /~ `&`&`& 9~Nt3 d /*e`&`&`& h3 d /p`&`&3`A^3 d /`& ';`&k3 d / `&00z3 d /u`&0'@ş`3 d /`&000թ-B3 d / `&00@ӟP[3 d /&ҴҴ`&iEz3 d /N '; .³3 d /ܥ '`& '=L03 d /5  ' '?; 3 d / ' '@;J3 d /v''; 03 d /u1''Ǩ3 d /^''';.#3 d /'@r';h&3 d /L$`<`s3 d /y @ ' 33 d /L@@ӟ`&>83 d /@;;`GFE3 d /@ `&N3 d / @0`&hHP3 d / @0'%Sw3 d /*i٨ǐj3 d / O00wbu3 d /g00)O3 d / 9;E:3 d /  9 9F*93 d /$ 9 9;<3 d /0`Hs;#c3 d /0@@%u3 d / 0r;P?x3 d /w00=3 d /0ffn3 d /0c׎"3 d /ֳ0@ժx3 d /K0e@ժFLD3 d /w0 U3 d /Qa0FU3 d /Qa0>3 d /*0@w |3 d /ܵ 0@ӟ`&i3 d /0@ӟ'3 d /0@ӟ0w!`3 d / 0f0@\W3 d / 0ҟ0@zW3 d /u" 0ٟ0ھt3 d /" 0@0 3 d /i00ꍳ3 d / 00Of3 d / 0K!T3 d / 00G3 d /R0;`&{J3 d /0;;dS3 d /P0;0V3 d /W0ޚ3 d /03 d /'0 23 d /8 0`&3 d /C 0`B0ÜAh3 d /m 0B0ĜP3 d /*0`_z;R3 d /&70޴^H3 d /20S Ja 3 d / 0`&;ܽ3 d /0`&_Ғ3 d /0`&;ʵ 3 d / 0`&`&`S3 d /rA0`&`&\_3 d / 0`&0 X3 d /0`&03 d /0`&003 d / 0&0@,3 d /$ 0&0 |3 d /J 0 '0w3 d /0`'0 3 d /0'=p=3 d /¶ 0``V<3 d / 00|3 d /043 d /0"0}*!3 d /b 0`j ]3 d / 0`Ʒ0wf3 d / 0,0$3 d / 0N0`Wv'3 d /T&0Q83 d /s00;3 d / 00B7#3 d /p 00;33 d /003 d /200ԫI3 d /Q# 00@eAp3 d / 00n@]T3 d / 00@{e3 d / 00g3 d /L 00OR3 d / 000;֠#3 d /( 000H3 d /00¸0~Ua3 d /@x00şFZ3 d /Lj00şhe3 d /x 00@"H3 d /%00;93 d /}# 00;'-៓3 d /00`&9T3 d /h00`&`&kˑ3 d /00`&0)t3 d / 00`Ʒ;3 d / 000 z3 d / 000@N3 d / 000\3 d /000@ӟ1!ĵ3 d / 00@{083 d /a00f13 d / 0y0ɴqF3 d /0yy@70D)3 d /-$ 0SmW3 d /3 02c:3 d /(020F]y03 d / 020FB3 d / 0 30@*.{3 d / 0`30m3 d / 030{N"3 d /&y0`?a3 d /"yy~3 d /,y`&@%e3 d /  3 4=3 d /h  3;*=3 d /F  3`@K3 d /$  3`~3 d / 3PY3 d /  3 33nsu)3 d /`3;; < d /M@]  d /nk!0@ ـE d /n,  "? d / ; Q d /Rv`&` w&) d /F.`3* l- d /'3* * d /``s3 .S d /_ '6 W d /H#13  9H d /@ޝy WL d / m@x= ·5 d /ʤ@ 3$}/5 d / +௷@^ .5 d /J;4j 5 d /X d0`,]o5 d /| dpO5 d /p0 ,u0k5 d /`;4CH5 d / `70,c45 d /E@0@,s.5 d /g;45 d /"0, g5 d /m `LFk5 d /K 2Lķ5 d /0 ,H5 d / @ 5 d / 0,Wۃ5 d / `@@Lf5 d /E;4Ͻ5 d /#`&LL5 d /`f@` @5 d /׌l0l5 d /"l  WD 5 d /Dl R5 d /8#1@lH<5 d /@B0@ lG` 5 d /@ d LʡZ5 d /=C0 Lm5 d /~`  Rv5 d /D0 T8J@&5 d /  LG8*5 d /@ Lva5 d /2F L](5 d /;@ 4R9#5 d /Ѩ L 5 d /AZ l_5 d /BB` XZ25 d / ඲ lG?5 d /y0 lz5 d /$ 'ڥLy~5 d /1`'`&L 5 d /`| ~@ ,25 d /5L 5 d /h J '75 d /J0`Lݦɂ5 d / ٫ Z ݦɂ5 d / ݫ+  sI5 d /XV`w>5 d /W#M0l(5 d //KM0@l‡T5 d /@N0lmxD5 d /_N0lp5 d /O0`l5 d /A`-`&LFQ5 d /ׯ L5 d /]0lۡl5 d / ൧lY%5 d / `޵ι@l[5 d /İ`޵llf5 d /Y /0lf5 d /  l}5 d / @ $ q5 d /Sz 435 d /m`;@uD5 d / 6TF5 d / @lCJK5 d / `Tkw5 d /v Ө0L5 d /@:0 lJs`5 d /&Ө0L?@5 d /` e5 d /l`&l2K5 d /F`@`EL P5 d /`@0`l 5 d /IK@0TP5 d / @ ֨ 4Y5 d / @`4$&O5 d /}@0Tw5 d /  A;@$|Ҧ*5 d / A0\25 d / `3~5 d / @]E`l5 5 d /~`E;4~ȭ5 d /F`E`@ LfA5 d / S@] ,$m_5 d /]S0 dRA5 d / 0@!lPmx5 d /#`!l+.5 d /@"J_5 d /' `.`"q߲5 d / D"j_5 d /  # F5 d /}K;#A5 d / W#<5 d /h '@$!rg5 d /#0$(5 d /F \;%.5 d /@ 5;%Tkr 5 d / 5 &`zc5 d /Qn` &!!|45 d / I@&l5 d /I;@'Tؔߠ5 d / &@'L1N25 d / &%(Lؔߠ5 d / &``(L1N25 d / &@-(Lz 95 d /~&@ )L9w5 d /de&;)4އD5 d /&@ @*އD5 d /&*(C5 d /&`-+Lk6JY5 d /p&B`+L"P(45 d / &&+LG֍5 d /(&0 ,l.R5 d /%& 4,Lk6JY5 d /p& \,Lt5 d / '@@-l. 5 d /M 'ק-lg{5 d /v# '`+.lw5 d /0 '`>`.lsU]5 d /T '?.l6>5 d / '? /l[]5 d /+ '`,/lց5 d /M '/lp8D5 d /+ '@0 #35 d /2 '0525 d /rn ' \1Tc5 d /cK ''`125 d /< '01~5 d /î '0 2L}5 d /Zl`& e2La5 d /J`&@2 5 d /pl`&`E@3LPX#5 d /`&`&3L&\5 d /ve`&04lc5 d /o'@`4l5 d /F'ƴ4l5 d /'@ӟ 5 Td5 d /x'5 B5 d /'@5 Q5 d / '`@6liS5 d /n''6MME5 d /M'07P5 d /'0`7L=#5 d /O07lc.5 d /O0 8l,:5 d / @P8 ,S5 d /'@~8,ޔ5 d /' @@9#&5 d /0n`&9C9 5 d /RFP0:l5 d /_ Q0`:Typ5 d /`Q:4t825 d /;`Q@ ;4l5 d /ō`Q0;T5 d /rFQ;;${5 d /Q0@<\tx5 d / V<Lw$|i5 d /Վ V`=L{5 d /F Vɨ`=LUԀ5 d / V ͨ=l2Ū5 d /9 Vͨ >lgS5 d /#@>laJn5 d /#>leg5 d /@?lr]5 d /!( ?lrw<5 d / @l:?85 d /d %`@l[5 d /& ܷ@lo5 d /U @ AlQt5 d / `Alr]5 d /!( Alrw<5 d /  @Bl:?85 d /d @-Bl[5 d /& ޷Clo5 d /U ๪`ClQt5 d / Clh15 d /2 ଧ DlԆn5 d /lZDl6=5 d /z DlQ5 d /n@E ,5 d /c;ET5 d /2GZFj<5 d /#`Fl )|5 d / ثF  )|5 d / ݫ G |!5 d /GɨGl[w5 d /; 1GTgh5 d /  ͨ@H65 d / ͨH5 d /`&Il N 5 d /`إ`Il6=5 d /O`Il6=5 d /O Jl]X&5 d / 9J t=5 d /0JM5 d /c 9 9@K |cK5 d /$ 90K l`"5 d /K;Lv5 d /g0`LL85 d /X 0ôLLh#15 d /O$0 Mlʷ5 d /|0ÜMl&5 d /M 0` Ml5 d /L 0@@Nl=Tk5 d /n0 NlNR5 d /0OlA:5 d / 0P`Ol̇5 d /+ 0@ Ol n5 d / 0" Pl5 d /( 0@Pl5 d /0@Pl d5 d / 0@QlF85 d /rG0@Qlߗ35 d / 0@"Rlߗ35 d / 0*`Rl!ZC5 d /0$01Rl|95 d /o0 SlS5 d /t 0ѪSl0Y5 d /$0{Sl5 d /zo0 d@Tl:o5 d /n$0`)Tl%5 d /G0Ul9!5 d /10`Ul05 d /0Ul5 d /̰0 Vl V5 d /Yo0@Vl9?5 d /ͩ0Vlζ5 d /O0@Wl@e5 d /M( 0Wl |5 d /0Xl5w5 d /03`Xl:5 d /K0 YlQz5 d /0`?Yl5 d /0Ylp5 d /RG0?@Zl=b5 d /Ï0pZlP6d5 d /0[lMU5 d /G0`[l_w5 d /K0z[lAn5 d /0 \l;Q5 d /8o0F\l5 d /n0\lϯ+5 d /0@+@]lhr,5 d / 0@4]l5 d /05^lc5 d /l0@`^l;Q5 d /8o0>^lux5 d /K+0 _lA5 d /0_la5 d /ڮ0`_,5 d /o0@` 7'5 d /p 0` 5 d / 0a \u5 d /$0+`a 5 d / 0Ka D5 d /;0@M b kd5 d /~ 0@Nb >[5 d / 0b (.5 d /P0ҟ@c &65 d /X0@ӟc 5 d /((0֟d $mA5 d /m0۟`d '>@5 d /,0@d  x5 d /l0 e 5 d / @,0;eTT5 d /0@fl%5 d /K0fl 5 d /d0g5 d /k0`{`gl5 d /} 0glߴ5 d /u0 h^a5 d /0 hl6v5 d /u0h ^3U5 d / 0@i;}5 d /o0i5 d /$0`δj! 5 d /G0`ϳ`j Q$5 d / 0 ~k L:c5 d / 0޴@l0i25 d / 0`XlL&5 d /0m(zK5 d /)0 S`m@Lߵq 5 d /o0@nml6.3*5 d /0@ӫ nѹ5 d /!0׫nѹ5 d /!0۫niL5 d /0@߫@o,5 d / 0o,5Iw5 d /Y0@p Pd5 d /0`p8,5 d /C 0_p,;zm5 d /! 0`8ql5 d /0! 0 Юq,NI5 d /50@o@rM5 d /f%0VrK<5 d /m0 s 5 d /G0 `s\q5 d /$0\s[N 5 d /0`E tlO5 d /0 tt85 d /K0 tp@5 d /G%0_@u^!5 d /0`au@:5 d /0@v:v5 d /0`vF5 d /0fvI[5 d /0` w L^h5 d /0`Fw&5 d /0 &wT85 d /%0õ@x "5 d /%0`LxTJ5 d /e,0`&yl<5 d /x0&`y\5 d /0&yl`5 d /0 ' zbq5 d /,0'ziX5 d / %0 zl5 d / 0` @{l2^;m5 d /0 {l})5 d /0|l5 d /(%0``|lQ_ 5 d /2H0"|l5 d /H0` }5 d /0Z}s{3 d /F@S-3 d / 00`&07/y3 d /} @00&0l3 d / 00&0X@3 d / 00 '0'3 d /+ 00`'0̠{3 d /&|000! 3 d /F}00"03 d /Vq/3 d /[a3 d /f$ |3 d /00`Ʒ0re(3 d /[00,0ux<3 d /`W00N0h3 d /Br@ 4;;;s3 d /@ 4;3;Ü23 d /@0000E3 d /2ɴ00y0H2 3 d / 00204x3 d /0020T3 d /G@00 30X73 d /x00`30(3 d / 0030b 93 d /'00;3 d /ҟ!3 d /D"WL3 d /׫;WL3 d /۫;h3 d /0`B 6 W3 d /`&+3 d /@ 00ҟ3 d />Ӝ`&৪n3 d /5`&@>,3 d /ٍ@@t+=3 d /@`P@*3 d /=O@ &3 d /H`@Smi3 d /@`/>3 d /LS@3 d /@`!3 d /vBT@L43 d /@@`aX3 d /+>@:C3 d /h@@`Ay3 d /`@y3 d /@`jT3 d /@@3 d />@ PBnE3 d /7@@G3 d /X@`Os3 d /@XWhI3 d /&@@A3 d /@S@IiV3 d /B@@Rk3 d /|`Z@93 d /@=?^3 d /V@%j13 d /\`@@Xf3 d /``\@+hG3 d / @$tz3 d /@`03 d /9@Uk3 d /9`^@*G3 d /`@ 3 d /@@3 d /N@?3 d /7@@`d3 d /Y@h3 d / @`L3 d /z@@@^3 d /LC`@O3 d /@@,Q+3 d /t` @`p~3 d /@@3 d / Z!@@[*V3 d /W@s.3 d / x!@`3 d /7@"@ 3 d /#@ |5U3 d /ox@@`ߏz3 d /c8 $@`-o3 d /x$@53 d /@`_N3 d /u@@3 d /F]`@_< 3 d /]@R3 d /c1 @`$3 d /ځ`%@ !vՒ3 d /G&@@p3 d /5y@Wp=3 d /8&@->3 d /qs@'@ప3 d /^'@@]x83 d /X@` h3 d /TY`T`ϻ3 d /`U>3 d /|`V3 d /c`  i@_c3 d /`  i/863 d /,hr.3 d /? @3 d /ێ@3 d /Fw` ibp3 d /8@ @!3 d /C@ @!P3 d /Y `(LQ3 d /r `(3 d /':`!`W13 d /`"`XR3 d /`#`Y}Ԧ)3 d /"`$`Z(3 d /jJ`%`[bQ3 d /`&3 d /&`\wl3 d /-`] x3 d /`] ;3 d /:`' t 3 d /`' ${3 d / 13 d /` { 3 d /@!@!Tl$3 d /\@!@!3 d /^3`(`(M'3 d /E`(`(3 d /`` izf$3 d /`` i|63 d /m`a@!c3 d /`a@!j 3 d /`b`($d3 d / `b`(3 d /i^.@Ƚ4d3 d /D@-@aC3 d /1@ӟ@1@b'x3 d /J`0ٟy v3 d /s`.0=)3 d /V|@TNWK3 d / TTuT-3 d /W TTI|<3 d /D TT ̮.Ȱ3 d /' TT̮(O3 d /K TT ʩv3 d /cE TT ͮÆ3 d /d' TTͮ3 d /52 TT ήpͰp3 d /E TT  co3 d /& TTʩ&LS3 d /' TT $3 d /hZ TT '*3 d /h@@] :T3 d /Z'@-0$#3 d /'-@)PX3 d / '@. 'e3 d /'/a ?3 d /6'103 d /\'1b3 d /h'10 Nz3 d /Q'2@/N3 d /BK'2gn\+3 d /;'20~i3 d /''@0sv3 d /''0Ԅ3 d /F0/I3 d /0@@L0F3 d /`&0@>0Q3 d / `&0@0Yߍ3 d /%`&00'@şf)3 d /$ ' ' '@@; S3 d /&`S 3 d /{H`@`3 d /`%Č3 d /w`0 3 d /_@0@ӟ`&e 3 d /B@0 `&93 d /01`Q Q 3b3 d /t;;f3 d /T V V''3g3 d /(U''3 d /I0'@şcG3 d /:0'@ş0{g3 d /30"` 3 d /T00ҟҟ@vI]x3 d /z 000;l3 d /Q0000@m3 d /00.3 d /<00@w |t83 d /0 00f0@0 3 d / 00ҟ0@X)3 d /%00ٟ0-3 d /%00@0Km#@3 d /00023 d /` 000/C=H3 d /d000+Ҷ3 d /# 00;0"3 d /00`B0ÜL**3 d /00B0ĜG~O3 d / 00`&0QP]3 d /ַ 00&0@TL3 d / 00&0/`3 d /2 00 '0D93 d /# 00`'0E3 d /x00`QY3 d /000||R@3 d /b:00"0}Zs3 d / 00`Ʒ0@֎3 d / 00,0yV|Q3 d /00N0`Wiu3 d /000@aqoS]3 d / 0000Eq3 d /000)KW3 d /0000@E@W 3 d / 0000@Ms3 d /` 0000*3 d /R00y0ɴ\73 d /$ 00203 d / 0020$br3 d /P 00 30@w/3 d / 00`30x3 d / 0030|3 d /  3;g3 d / 3@`Dg 3 d /h@@! nD3 d /@@@ˍl3 d /(@0;,F"3 d /@RR3 d /(@@@;V3 d /&ӓ3 d /d ;гYЬ3 d /@/L.3 d /S/@m"3 d /`&Y*Ӡ3 d /+< ӵ3 d / !0R|3 d /q@VͧzX3 d /p!J3 d /,@)`+yy3 d /@+!|lO3 d /W8`7@{9T3 d /z@tM$3 d /l@ 3 d /['@Z d /p/@i Bm/ d /O4qg %B d /A q4@P = d /$0ye ׅ( d /5% pn ci d /z   d /a :e [ d /t 021 ƛ2 d /1jp Ѫ d /pe ", @ d /B e 6*[12]struct { v interface {}; tag string; l []string }6*[7]struct { id uint8; hash crypto.Hash; name string }6*[]*dynamodb.ReplicaGlobalSecondaryIndexSettingsUpdate6*[]struct { mcentral runtime.mcentral; pad [32]uint8 }6*func() (pubsub.Subscriber_StreamingPullClient, error)6*func(*big.Int, *big.Int, *big.Int, *big.Int) *big.Int6*func(*dynamodb.ConsumedCapacity) *dynamodb.ScanOutput6*func(*git.ListOptions) ([]*plumbing.Reference, error)6*func(*map[string]int, string, map[string]int, string)6*func(*net.IPMask, string, string, net.IPMask, string)6*func(*sqs.TagQueueInput) (*sqs.TagQueueOutput, error)6*func(*tag.Map, interface {}, map[string]interface {})6*func([]*string) *sqs.ListDeadLetterSourceQueuesOutput6*func([]diffmatchpatch.Patch, string) (string, []bool)6*func([]string, func(*pflag.Flag, string) error) error6*func([]uint8) ([]uint8, packet.CipherFunction, error)6*func([]uint8, []uint8, *net.IPAddr) (int, int, error)6*func(bool) *dynamodb.PointInTimeRecoverySpecification6*func(client.Request, func(io.ReadCloser) error) error6*func(int, string) ([]*pubsub.Snapshot, string, error)6*func(int64) *dynamodb.GlobalSecondaryIndexDescription6*func(interface {}, ...interface {}) *emission.Emitter6*func(interface {}, interface {}) (interface {}, bool)6*func(io.Writer, string, ...interface {}) (int, error)6*func(map[string]*string) *sqs.SetQueueAttributesInput6*func(pflag.Value, string, string, string) *pflag.Flag6*func(plumbing.Hash) (storer.EncodedObjectIter, error)6*func(string) *dynamodb.AutoScalingSettingsDescription6*func(string) *dynamodb.DescribeContinuousBackupsInput6*func(string) *dynamodb.LocalSecondaryIndexDescription6*func(string) *dynamodb.PointInTimeRecoveryDescription6*func(string) *dynamodb.RestoreTableToPointInTimeInput6*func(string) *dynamodb.UpdateGlobalTableSettingsInput6*func(string, *parse.Tree) (*template.Template, error)6*func(string, ...macaron.Handler) *macaron.ComboRouter6*func(string, string, time.Time) []diffmatchpatch.Diff6*func(time.Duration) *options.FindOneAndReplaceOptions6*func(x509.SignatureAlgorithm, []uint8, []uint8) error6*map.bucket[plumbing.ReferenceName]*plumbing.Reference6*struct { F uintptr; R *packp.ReferenceUpdateRequest }6*struct { F uintptr; ch *amqp.Channel; e *amqp.Error }6*struct { F uintptr; connectionTimeout time.Duration }6*struct { F uintptr; err *error; trailer http.Header }6*struct { F uintptr; it *pubsub.SubscriptionIterator }6*struct { F uintptr; s *ssh.Session; stdin io.Reader }6*struct { F uintptr; sd *bsoncodec.structDescription }6*struct { a cast5.keyScheduleA; b cast5.keyScheduleB }DownloadRateLimit#mapstructure:"download_speed_limit"EmbedWebHookServer"mapstructure:"embed_webhookserver"GlobalTableName%min:"3" type:"string" required:"true"ReadCapacityUnits#min:"1" type:"long" required:"true"SourceTableName%min:"3" type:"string" required:"true"TargetTableName%min:"3" type:"string" required:"true" TrailerField(asn1:"optional,explicit,tag:3,default:1"7*[]struct { Size uint32; Mallocs uint64; Frees uint64 }7*[]struct { size uint32; nmalloc uint64; nfree uint64 }7*dynamodb.GlobalTableGlobalSecondaryIndexSettingsUpdate7*func(*big.Int, *big.Int, []uint8) (*big.Int, *big.Int)7*func(*dynamodb.ConsumedCapacity) *dynamodb.QueryOutput7*func(*readconcern.ReadConcern) *options.SessionOptions7*func(*tasks.Group, int) ([]*result.AsyncResult, error)7*func([]uint8, []uint8, *net.UDPAddr) (int, int, error)7*func(bsonrw.ValueWriter, bsontype.Type, []uint8) error7*func(context.Context) (wiremessage.WireMessage, error)7*func(func(int, interface {}) bool) (int, interface {})7*func(int64) *dynamodb.ProvisionedThroughputDescription7*func(interface {}, ...viper.DecoderConfigOption) error7*func(map[string]*string) *sqs.GetQueueAttributesOutput7*func(net.Conn) (net.Conn, credentials.AuthInfo, error)7*func(string) *dynamodb.GlobalSecondaryIndexDescription7*func(string) *dynamodb.UpdateGlobalTableSettingsOutput7*func(string, []time.Duration, string) *[]time.Duration7*func(string, func(http.ResponseWriter, *http.Request))7*func(string, string, []macaron.Handler) *macaron.Route7*func(time.Duration, int, func() timeseries.Observable)7*func(uint64, int, bool, bool, *strconv.floatInfo) bool7*map.bucket[reflect.Type]map[gob.typeId]**gob.decEngine7*map.bucket[reflect.Type]map[int32]*proto.ExtensionDesc7*map.hdr[wiremessage.CompressorID]compressor.Compressor7*map[string]func(*http.Server, *tls.Conn, http.Handler)7*struct { F uintptr; R *http.http2responseWriterState }7*struct { F uintptr; R *http.http2serverInternalState }7*struct { F uintptr; R bsoncodec.DefaultValueDecoders }7*struct { F uintptr; R bsoncodec.DefaultValueEncoders }7*struct { F uintptr; debugLevel *int; dnsMode *string }7*struct { F uintptr; fs []mapstructure.DecodeHookFunc }7*struct { F uintptr; measurements []stats.Measurement }7*struct { F uintptr; stacksize int32; newg *runtime.g }7*struct { UpdatedExisting bool; Upserted interface {} }7*struct { references int; anchor int; serialized bool } ArtefactPath)json:"artefact_path" form:"artefact_path"CacheRegistryCredentialsmapstructure:"cache_registry"Custom/protobuf:"bytes,8,opt,name=custom,proto3,oneof"Delete/protobuf:"bytes,5,opt,name=delete,proto3,oneof"ProvisionedThroughput type:"structure" required:"true"SaslSupportedMechs#bson:"saslSupportedMechs,omitempty"TableCreationDateTime type:"timestamp" required:"true" TagNamespace)json:"tag_namespace" form:"tag_namespace"TimeToLiveStatus%type:"string" enum:"TimeToLiveStatus"WriteCapacityUnits#min:"1" type:"long" required:"true"8**dynamodb.GlobalTableGlobalSecondaryIndexSettingsUpdate8*[]struct { a cast5.keyScheduleA; b cast5.keyScheduleB }8*dynamodb.ReplicaGlobalSecondaryIndexSettingsDescription8*func(*[]time.Duration, string, []time.Duration, string)8*func(*big.Int, *big.Int, *big.Int) (*big.Int, *big.Int)8*func(*dynamodb.ScanInput) (*dynamodb.ScanOutput, error)8*func(*primitive.Timestamp) *options.ChangeStreamOptions8*func(*readconcern.ReadConcern) *options.DatabaseOptions8*func(*runtime.hchan, unsafe.Pointer, bool) (bool, bool)8*func(...*options.SessionOptions) (mongo.Session, error)8*func(...writeconcern.Option) *writeconcern.WriteConcern8*func([]uint8, []uint8, *net.UnixAddr) (int, int, error)8*func(context.Context, string, string) (net.Conn, error)8*func(diffmatchpatch.Patch, string) diffmatchpatch.Patch8*func(docker.CreateConfigOptions) (*swarm.Config, error)8*func(docker.CreateSecretOptions) (*swarm.Secret, error)8*func(docker.ListConfigsOptions) ([]swarm.Config, error)8*func(docker.ListSecretsOptions) ([]swarm.Secret, error)8*func(func(*pflag.FlagSet, string) pflag.NormalizedName)8*func(http.http2writeContext, []uint8, bool, bool) error8*func(int, string, interface {}, ...macaron.HTMLOptions)8*func(map[string]*dynamodb.AttributeValue) *dynamodb.Get8*func(map[string]*dynamodb.AttributeValue) *dynamodb.Put8*func(options.FullDocument) *options.ChangeStreamOptions8*func(redis.Conn, ...interface {}) (interface {}, error)8*func(reflect.StructField) (bsoncodec.StructTags, error)8*func(string) (<-chan *vagrantutil.CommandOutput, error)8*func(string) *dynamodb.CreateGlobalSecondaryIndexAction8*func(string) *dynamodb.DeleteGlobalSecondaryIndexAction8*func(string) *dynamodb.DescribeGlobalTableSettingsInput8*func(string) *dynamodb.UpdateGlobalSecondaryIndexAction8*func(string, *docker.HostConfig, context.Context) error8*func(string, *git.CommitOptions) (plumbing.Hash, error)8*func(string, docker.DownloadFromContainerOptions) error8*func(string, string, ...macaron.Handler) *macaron.Route8*func(string, string, bool, bool, amqp.Publishing) error8*func(string, string, io.Reader) (*http.Response, error)8*func(template.context, []uint8) (template.context, int)8*func(time.Time, time.Time, int) []timeseries.Observable8*func(x509.VerifyOptions) ([][]*x509.Certificate, error)8*map.bucket[http.connectMethodKey]chan *http.persistConn8*map.bucket[string][]map[string]*dynamodb.AttributeValue8*map.iter[wiremessage.CompressorID]compressor.Compressor8*map[bsonrw.jsonParseState]map[bsonrw.jsonTokenType]bool8*struct { F uintptr; c *docker.Client; sockPath string }8*struct { F uintptr; found *bool; c *crr.EndpointCache }8*struct { F uintptr; in reflect.Value; e *yaml.encoder }8*struct { F uintptr; readMax int; f func([]uint8) bool }8*struct { F uintptr; remoteRefs map[plumbing.Hash]bool }8*struct { F uintptr; resultRefs *[]*plumbing.Reference }8*struct { F uintptr; source string; destination string }8*struct { F uintptr; srcPath string; excludes []string }8*struct { F uintptr; timeout time.Duration; err *error }BackupCreationDateTime type:"timestamp" required:"true"GlobalTableBillingMode type:"string" enum:"BillingMode"HealthCheckInterval#mapstructure:"healthcheck_interval"Owner1json:"pipeline_owner_id" form:"pipeline_owner_id"#ReplicaProvisionedReadCapacityUnitsmin:"1" type:"long"WebHookGitHubTokenUser mapstructure:"github_token_user"9*[134]struct { mcentral runtime.mcentral; pad [32]uint8 }9*[4]struct { a cast5.keyScheduleA; b cast5.keyScheduleB }9*[61]struct { Size uint32; Mallocs uint64; Frees uint64 }9*[67]struct { size uint32; nmalloc uint64; nfree uint64 }9*func() func(*pflag.FlagSet, string) pflag.NormalizedName9*func(*dynamodb.ConsumedCapacity) *dynamodb.GetItemOutput9*func(*dynamodb.ConsumedCapacity) *dynamodb.PutItemOutput9*func(*dynamodb.Projection) *dynamodb.LocalSecondaryIndex9*func(*runtime.hchan, unsafe.Pointer, bool, uintptr) bool9*func(*writeconcern.WriteConcern) *options.SessionOptions9*func([]*dynamodb.Tag) *dynamodb.ListTagsOfResourceOutput9*func(bsonrw.ValueReader) (bsontype.Type, []uint8, error)9*func(context.Context) (pubsub.SubscriptionConfig, error)9*func(context.Context, *git.SubmoduleUpdateOptions) error9*func(context.Context, *stats.RPCTagInfo) context.Context9*func(docker.CreateVolumeOptions) (*docker.Volume, error)9*func(docker.DiskUsageOptions) (*docker.DiskUsage, error)9*func(docker.ListVolumesOptions) ([]docker.Volume, error)9*func(docker.NetworkFilterOpts) ([]docker.Network, error)9*func(io.Reader, []uint8, string) (*ssh.Signature, error)9*func(map[string]*dynamodb.Condition) *dynamodb.ScanInput9*func(map[string]*sqs.MessageAttributeValue) *sqs.Message9*func(map[string]interface {}) (event.APIResponse, error)9*func(reflect.Type, string, string, *reflect.StructField)9*func(storer.Storer) (transport.UploadPackSession, error)9*func(string) *dynamodb.DescribeGlobalTableSettingsOutput9*func(string, *packet.PublicKey, *packet.Signature) error9*func(string, context.Context) (*docker.Container, error)9*func(time.Time) *dynamodb.PointInTimeRecoveryDescription9*func(time.Time) *dynamodb.RestoreTableToPointInTimeInput9*struct { F uintptr; first *bool; w http.ResponseWriter }9*struct { F uintptr; gp *runtime.g; gcw *runtime.gcWork }9*struct { F uintptr; lw *client.logWriter; logBody bool }9*struct { F uintptr; n uint32; t *transport.http2Client }9*struct { F uintptr; newConfig *tls.Config; c *tls.Conn }9*struct { F uintptr; x *cobra.Command; c *cobra.Command }9*struct { KeyBytes []uint8; Rest []uint8 "ssh:\"rest\"" }9*struct { sync.RWMutex; m map[reflect.Type][]yaml.field }AppBrandingLogo(mapstructure:"application_branding_logo"GlobalTableStatus&type:"string" enum:"GlobalTableStatus"Internal/json:"Internal" yaml:"Internal" toml:"Internal" MaxActive.yaml:"max_active" envconfig:"REDIS_MAX_ACTIVE"MaxMessageSizeBytes$bson:"maxMessageSizeBytes,omitempty"Message0protobuf:"bytes,8,opt,name=message,proto3,oneof"Pipeline/json:"default_pipeline" form:"default_pipeline"TimeToLiveSpecification type:"structure" required:"true"Trailer0protobuf:"bytes,9,opt,name=trailer,proto3,oneof"C~/, 03a /"-`3a*/Vm`3a$/3aƯ/13a7c3 d /@Ia ' .3 d /Ia0 0z/d\+ 3q ϔ(/W 3SxnX/|W`3S )3 d /ӭ`׭׭̄3 d /O`ԭ2-XyK3 d /E=ӭ`׭௷׭wk3 d /0ӭ௷`ԭ\3 d /j-}'3 d /f"M03 d /]@`&`& 3 d /g`&`&%NH.3 d /r`&`&93 d /;3 d /c,3 d /"ݮW<3 d /;`&`&۟~3 d /r`b`&`&G3 d /g0 I{6'63 d /f''2@ȧVq3 d /!''3@ȧ*R=3 d /a000`j=3 d /F073 d /,(0'@/@ӟ;3 d /f60''F' z3 d /+G0٨3 d /׫`&`&Ӹ;3 d /۫`&`&`ո;We3 d /6Ey; .P3 d /+t`V^m3 d /40;;.[3 d / 0;;;`&3 d /{x00;;`%;h3 d /00'@şT33 d /(00'@ş0 3 d / 000;)3 d / &0000;13 d /8`3`&;..EY3 d /j`3`&;;;X3 d /@`&y!3 d /@`:''Z3 d /b0@ӟv<3 d /8p@ _[3 d /4@/&;wn,3 d /sj&/@3 d /;0wŕ3 d /"@7`!3 d //e@kS3 d /#ek<\ d /;-3@xV 3 d / @m]÷3 d /-/+@Ωnȫ/@0`3@#F/a1`*]`P*y譖/.a@1\`P(u /n1&ҟ @(, /@2&ҟ `23 d /t7`70GBv3 d /&V@23 d /@~ `aq3 d /7S|'e83 d /@D6u3 d /9@ 9&;!/3 d /@`K`g{3 d /@KK]P3 d /?@=Kx!}ȫ/ݦ@ 3$ @/F @ϟ$,N/l&ҟ@$UD/rO3@  d /j@_ 3 jm/>jc3  P;/` 3(v/X`3L d /P`3[ d /¨ zą'ZY d /{Xp0ox d / M͙A d /, @}PΙ0P(  d /eR}n 3$Z d /~'`& d /Rߖ2~|? d /4Ps`& d /5@s`&ƣ6 d /5s`& d /*5s`&\ c d /?5Ps`&F d /T5@s`&}X+ d /i5t`&]^ d / (`33K3 d /'@P  ʑw1P/-@&ҟ0(u /n@&ҟ GBv3 d /& @A:*[]*dynamodb.GlobalTableGlobalSecondaryIndexSettingsUpdate:*[]func(template.context, []uint8) (template.context, int):*func(*cobra.Command, []string) (*cobra.Command, []string):*func(*dynamodb.BackupDetails) *dynamodb.BackupDescription:*func(*dynamodb.Projection) *dynamodb.GlobalSecondaryIndex:*func(*dynamodb.QueryInput) (*dynamodb.QueryOutput, error):*func(*dynamodb.RestoreSummary) *dynamodb.TableDescription:*func(*dynamodb.SSEDescription) *dynamodb.TableDescription:*func(*options.Collation) *options.FindOneAndDeleteOptions:*func(*options.Collation) *options.FindOneAndUpdateOptions:*func(*readconcern.ReadConcern) *options.CollectionOptions:*func(*runtime.siginfo, *runtime.sigctxt, *runtime.g) bool:*func(*sqs.ListQueuesInput) (*sqs.ListQueuesOutput, error):*func(*sqs.PurgeQueueInput) (*sqs.PurgeQueueOutput, error):*func(*sqs.UntagQueueInput) (*sqs.UntagQueueOutput, error):*func(*tasks.Chord, int) (*result.ChordAsyncResult, error):*func(*writeconcern.WriteConcern) *options.DatabaseOptions:*func(...func(string, string) bool) *properties.Properties:*func([]*dynamodb.AttributeValue) *dynamodb.AttributeValue:*func([]uint8, []uint8, []uint8, []uint8) ([]uint8, error):*func([]uint8, []uint8, []uint8, []uint8, []uint8) []uint8:*func(chan uint64, chan uint64) (chan uint64, chan uint64):*func(context.Context, *stats.ConnTagInfo) context.Context:*func(context.Context, string, []string) ([]string, error):*func(docker.CreateServiceOptions) (*swarm.Service, error):*func(docker.ListServicesOptions) ([]swarm.Service, error):*func(hash.Hash, *packet.PrivateKey, *packet.Config) error:*func(http2.FrameType, http2.Flags, uint32, []uint8) error:*func(int, string) ([]*pubsub.Subscription, string, error):*func(int64) *sqs.ChangeMessageVisibilityBatchRequestEntry:*func(io.Writer, string, properties.Encoding) (int, error):*func(map[string]*dynamodb.Condition) *dynamodb.QueryInput:*func(plumbing.ReferenceName) (*plumbing.Reference, error):*func(storer.Storer) (transport.ReceivePackSession, error):*func(string) *sqs.ChangeMessageVisibilityBatchResultEntry:*func(string, ...*options.DatabaseOptions) *mongo.Database:*map.bucket[http.http2FrameType]map[http.http2Flags]string:*map.bucket[wiremessage.CompressorID]compressor.Compressor:*struct { F uintptr; c *amqp.Connection; err *amqp.Error }:*struct { F uintptr; fset *token.FileSet; pos *token.Pos }:*struct { F uintptr; keyOp *gob.decOp; elemOp *gob.decOp }:*struct { F uintptr; p unsafe.Pointer; b *runtime.bucket }:*struct { buf [4096]uint8; i int; j int; nUnreadable int }:*struct { lock runtime.mutex; free [19]runtime.mSpanList }Current1json:"current,omitempty" yaml:"current,omitempty"End5protobuf:"varint,2,opt,name=end" json:"end,omitempty"End5protobuf:"varint,4,opt,name=end" json:"end,omitempty"PointInTimeRecoveryEnabledtype:"boolean" required:"true":SetReplicaProvisionedReadCapacityAutoScalingSettingsUpdate(TargetTrackingScalingPolicyConfigurationtype:"structure";*[]*dynamodb.ReplicaGlobalSecondaryIndexSettingsDescription;*func() []*descriptor.EnumDescriptorProto_EnumReservedRange;*func(*docker.AuthConfiguration) (docker.AuthStatus, error);*func(*dynamodb.BackupDetails) *dynamodb.CreateBackupOutput;*func(*dynamodb.ConditionCheck) *dynamodb.TransactWriteItem;*func(*http.Request, string) (*http.http2ClientConn, error);*func(*options.Collation) *options.FindOneAndReplaceOptions;*func(*readconcern.ReadConcern) *options.TransactionOptions;*func([]*dynamodb.Replica) *dynamodb.CreateGlobalTableInput;*func([]uint8, []uint8) (int, int, int, *net.IPAddr, error);*func([]uint8, []uint8, syscall.Sockaddr) (int, int, error);*func(context.Context, *object.Tree) (*object.Patch, error);*func(description.Server) (*topology.SelectedServer, error);*func(docker.CommitContainerOptions) (*docker.Image, error);*func(docker.CreateNetworkOptions) (*docker.Network, error);*func(docker.ListImagesOptions) ([]docker.APIImages, error);*func(func(int, interface {}) interface {}) *arraylist.List;*func(int64, int64, int64) ([]*channelz.SocketMetric, bool);*func(jmespath.ASTNode, interface {}) (interface {}, error);*func(map[string]*dynamodb.AttributeValue) *dynamodb.Delete;*func(map[string]*dynamodb.AttributeValue) *dynamodb.Update;*func(proto.Message, int, int, *proto.Buffer) (bool, error);*func(string) *sqs.ChangeMessageVisibilityBatchRequestEntry;*func(string, *net.TCPAddr, *net.TCPAddr) (net.Conn, error);*func(string, *packet.PublicKey, *packet.SignatureV3) error;*func(string, map[string]string, string) *map[string]string;*func(string, string, time.Duration, string) *time.Duration;*func(time.Duration) *options.EstimatedDocumentCountOptions;*func(time.Time) *dynamodb.ProvisionedThroughputDescription;*func(uint32, *runtime.siginfo, unsafe.Pointer, *runtime.g);*struct { F uintptr; fn func(time.Duration) time.Duration };*struct { F uintptr; frame *runtime.stkframe; bad uintptr };*struct { F uintptr; repl func(string) string; src string };*struct { F uintptr; tf reflect.Type; mi *proto.mergeInfo } BackupType/type:"string" required:"true" enum:"BackupType" BindingKey/yaml:"binding_key" envconfig:"AMQP_BINDING_KEY"ComparisonOperator'type:"string" enum:"ComparisonOperator"DockerEndpointDiD(mapstructure:"docker_in_docker_endpoint"Snapshot1protobuf:"bytes,3,opt,name=snapshot,proto3,oneof" d /.@$ps ^pYt; d /d /P$ps 0K d /(0$ps - d /cM$> d /S$+ d /)@3bps 0 + d /3b  d /e  P}v d /)7 Sps i T Sd3 d /}*@j`٭ 9Q@h d /j`)DP3 d /"k٭ 9;yt)3 d /*k@٭ 9Y d /p8ps s `n | d /l@9 7% d /l@m+ 63 d /n 9I d /=+<H iq6 d /@?` ` C d /kn![N d /b-@p!FE d /jyAps 8 7e>3 d /4`&`&`&@]3 d /m`&`&`&;&P&3 d /K`&`&`&nh3 d /~$`&`&`&`bR!m3 d /"0`@3 d /0000M==#&3 d /#`& '`&`&`&F 3 d /y`'@q}3 d /s@`&`&`&32 073 d /2000؟ d /&@y$5Iv3 d /^}0`&c| d /x`I $ 0ȍק d /%7A d /`%Ӥ" d /@ &3S  d /5S`&@9]| d /_@`&`:?F d /փ@N@ Oq+q<0 d /N@ 0OqP+q d / P` 2jj<^ d /$P` 3j"jP d /$P` p3j$jLdx3 d /''⢜ d / `( 1  d /!( 13 d /@''`&&0g d /@Q. }1@`1T$} d /IY`) d /CY )` p]]* .= d /ȬZxe /E)@g3 d /׬@ѹ`&`&* .= d /Ȭ[ xe ?=<g3 d /׬  `&`&c d /\ps z) d /@]) @H@)6- d /.-])1 H@0|I d /0^) NB d /@`^) `NA3 d /'`7" d /ߴ@`7 YW4 d /`7ps ZX{ڊ d /P`?`7q2 d /RH?`7 d / @M?;o d / N @;Bٳ d /@ ,ps a9aLi d /# , 0a8axC d / ,% a0@aOw d /t` , aP?a傽" d /  , `aaPp d /ܪ ,ps a@=azGK d / ,ps a=a d /  ,ps a>a; d /#|` ,ps ag d /0C d /& DL~ d /=@}e 3 d /j\,'I&3 d /D,n d /G@` E,3 d /`E8,+- d /j1 ;w;3_F d / b`0 L`0K`xk d /&` F@< y d / `F1u d /pF=8 d /LtFX d /@u G!Zq d /gv`G`: d / GByf  d /k"yG1hb d /1Ry H1ļ3 d /@Q ;3 d / e@Q s d /@eHԯj d /! I d /X `I 91@"1 d /@ >1#1>5 d /WU @=11yL^3 d / d /U-` 04.2-&߃ d /m 3.PM-Lm d /X  4.PN-V^ d /m 3.-U  d /m 2.-* d /@ p3..X) d /q 9K`K  d /$$ps pKPUK ߾ d /$ps KUK_" d /`N  d /,N 8h d /.NM~ d /  `P_^s d / a0U^6 d /g+ ,% n4 d /@,% Q? d /b( *@@(*  d /@(00*@$Jh d /`(ps .*( ri d / (ps H*`% d /)( `@*%*@#%7=1 d /+( =*`"% d /Y( C*%{=n d / (ps d*P % d /ˇ(ps i*!%̾ d /(ps i*!%^c d / `(ps m*%s8 d /C ( L*Н%ayb d /)( P*@y(׷ d /;( *y(d d /ASc  d /@050:@9Gkr d /lps !!F d /&`ps pN~t d /Pps N*M3 d /ПCྷTz d /Y@Оps E0E2 d /DОps @EE2|3 d /.@DО' d /H`  d /@ P u  d /@@ Й+*  d /, 0+@4+Ȕs d /, +*e d /12+1x d /|2+J d /@XW|- d /`2+eFu d /p[`X_N d /`2Xt[ d /2+" d / 2+ d />2+u d / @2+@)o d /,t  Q{׳ d /] Z,NЛ d /Q@`Z- d /8g@P.2 050a d /+@PK 5? d /Po, 0: d /, 0W@Z d /v ,ps @ d /z@ ` ps ,$#1+p d /$`  \ݜ d /,j  "# d /S!\ I3 d / `&K>g d /0! ]  d /&@"`] L~ d /= }e >*func(*dynamodb.AttributeValue) *dynamodb.AttributeValueUpdate>*func(*dynamodb.BillingModeSummary) *dynamodb.TableDescription>*func(*dynamodb.GetItemInput) (*dynamodb.GetItemOutput, error)>*func(*dynamodb.ItemCollectionMetrics) *dynamodb.PutItemOutput>*func(*dynamodb.Projection) *dynamodb.GlobalSecondaryIndexInfo>*func(*dynamodb.PutItemInput) (*dynamodb.PutItemOutput, error)>*func(*map[string]int, string, string, map[string]int, string)>*func([]*dynamodb.KeySchemaElement) *dynamodb.CreateTableInput>*func([]*dynamodb.KeySchemaElement) *dynamodb.TableDescription>*func([]plumbing.Hash, uint) ([]*packfile.ObjectToPack, error)>*func(context.Context, func(mongo.SessionContext) error) error>*func(context.Context, string) (*pubsub.SnapshotConfig, error)>*func(context.Context, string, string) (net.PacketConn, error)>*func(dnsmessage.ResourceHeader, dnsmessage.PTRResource) error>*func(dnsmessage.ResourceHeader, dnsmessage.SOAResource) error>*func(dnsmessage.ResourceHeader, dnsmessage.SRVResource) error>*func(dnsmessage.ResourceHeader, dnsmessage.TXTResource) error>*func(docker.PullImageOptions, docker.AuthConfiguration) error>*func(docker.PushImageOptions, docker.AuthConfiguration) error>*func(io.Writer, int, int, int, uint8, uint) *tabwriter.Writer>*func(map[string]*dynamodb.AttributeValue) *dynamodb.ScanInput>*func(options.ReturnDocument) *options.FindOneAndUpdateOptions>*func(string, ...*options.CollectionOptions) *mongo.Collection>*func(string, ...opentracing.StartSpanOption) opentracing.Span>*func(uintptr, uintptr, int, int, int, int64) (uintptr, error)>*map.bucket[string]func(*http.Server, *tls.Conn, http.Handler)>*struct { F uintptr; R *dynamodb.discovererDescribeEndpoints }>*struct { F uintptr; repl func([]uint8) []uint8; src []uint8 }>*struct { F uintptr; v string; k tag.Key; mds []tag.Metadata }>*struct { F uintptr; wg *sync.WaitGroup; f *json.encoderFunc })ReplicaGlobalSecondaryIndexSettingsUpdatemin:"1" type:"list"?github.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/oauth2?github.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/macaron.v1?*func(*dynamodb.BackupDescription) *dynamodb.DeleteBackupOutput?*func(*dynamodb.SourceTableDetails) *dynamodb.BackupDescription?*func(*dynamodb.StreamSpecification) *dynamodb.CreateTableInput?*func(*dynamodb.StreamSpecification) *dynamodb.TableDescription?*func(*dynamodb.StreamSpecification) *dynamodb.UpdateTableInput?*func(*dynamodb.TableDescription) *dynamodb.DescribeTableOutput?*func(*token.File, []uint8, scanner.ErrorHandler, scanner.Mode)?*func(...*options.CollectionOptions) (*mongo.Collection, error)?*func([]*dynamodb.GlobalTable) *dynamodb.ListGlobalTablesOutput?*func([]*sqs.BatchResultErrorEntry) *sqs.SendMessageBatchOutput?*func(dnsmessage.ResourceHeader, dnsmessage.AAAAResource) error?*func(docker.CreateContainerOptions) (*docker.Container, error)?*func(docker.RemovePluginOptions) (*docker.PluginDetail, error)?*func(map[string]*dynamodb.AttributeValue) *dynamodb.PutRequest?*func(map[string]*dynamodb.AttributeValue) *dynamodb.QueryInput?*func(map[string]*dynamodb.AttributeValue) *dynamodb.ScanOutput?*func(map[string]*dynamodb.Capacity) *dynamodb.ConsumedCapacity?*func(options.ReturnDocument) *options.FindOneAndReplaceOptions?*func(string, interface {}, ...viper.DecoderConfigOption) error?*func(string, string, []time.Duration, string) *[]time.Duration?*func(string, string, bool, bool, bool, bool, amqp.Table) error?*map.bucket[bsonrw.jsonParseState]map[bsonrw.jsonTokenType]bool?*struct { E *big.Int; N *big.Int; Rest []uint8 "ssh:\"rest\"" }?*struct { F uintptr; c *runtime.mcache; spc runtime.spanClass }?*struct { F uintptr; t *template.Template; c template.context }?*struct { F uintptr; u *big.Float; v *big.Float; x *big.Float }AppBrandingFavicon+mapstructure:"application_branding_favicon" BackupStatus1type:"string" required:"true" enum:"BackupStatus"Field8protobuf:"bytes,2,rep,name=field" json:"field,omitempty"ID;json:"ID,omitempty" yaml:"ID,omitempty" toml:"ID,omitempty"ID;json:"Id,omitempty" yaml:"Id,omitempty" toml:"Id,omitempty"IP;json:"IP,omitempty" yaml:"IP,omitempty" toml:"IP,omitempty"LxdEphemeralContainers'mapstructure:"lxd_ephemeral_containers"OS;json:"Os,omitempty" yaml:"Os,omitempty" toml:"Os,omitempty"Op;json:"op,omitempty" yaml:"op,omitempty" toml:"op,omitempty"RW;json:"RW,omitempty" yaml:"RW,omitempty" toml:"RW,omitempty" ReadTimeout2yaml:"read_timeout" envconfig:"REDIS_READ_TIMEOUT" ResultBackend0yaml:"result_backend" envconfig:"RESULT_BACKEND"?SetGlobalTableProvisionedWriteCapacityAutoScalingSettingsUpdateValue8protobuf:"bytes,2,rep,name=value" json:"value,omitempty"Value8protobuf:"bytes,3,rep,name=value" json:"value,omitempty"@github.com/MottainaiCI/mottainai-cli/vendor/github.com/ijc/Gotty@github.com/MottainaiCI/mottainai-cli/vendor/github.com/xdg/scram@github.com/MottainaiCI/mottainai-cli/vendor/go.opencensus.io/tag@github.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/warnings.v0@*func(*[]time.Duration, string, string, []time.Duration, string)@*func(*big.Int, *big.Int, []uint8, []uint8) (*big.Int, *big.Int)@*func(*dynamodb.AttributeValue) *dynamodb.ExpectedAttributeValue@*func(*sqs.AddPermissionInput) (*sqs.AddPermissionOutput, error)@*func(*sqs.DeleteMessageInput) (*sqs.DeleteMessageOutput, error)@*func(*sqs.ListQueueTagsInput) (*sqs.ListQueueTagsOutput, error)@*func([]*dynamodb.ConsumedCapacity) *dynamodb.BatchGetItemOutput@*func([]*dynamodb.ItemResponse) *dynamodb.TransactGetItemsOutput@*func([]*dynamodb.KeySchemaElement) *dynamodb.SourceTableDetails@*func([]uint8, []uint8) (int, int, int, syscall.Sockaddr, error)@*func(connectivity.State, connectivity.State) connectivity.State@*func(crr.Discoverer, string, bool) (crr.WeightedAddress, error)@*func(dnsmessage.ResourceHeader, dnsmessage.CNAMEResource) error@*func(int, string, string, interface {}, ...macaron.HTMLOptions)@*func(int64) *dynamodb.ReplicaGlobalSecondaryIndexSettingsUpdate@*func(io.Reader, []uint8, crypto.DecrypterOpts) ([]uint8, error)@*func(map[string]*dynamodb.AttributeValue) *dynamodb.QueryOutput@*func(opentracing.SpanContext, interface {}, interface {}) error@*func(plumbing.ObjectType, plumbing.Hash) (object.Object, error)@*func(plumbing.ReferenceName, bool) (*plumbing.Reference, error)@*func(ssh.ConnMetadata, ssh.PublicKey) (*ssh.Permissions, error)@*func(string, []uint8) (ssh.Channel, <-chan *ssh.Request, error)@*func(string, context.Context) ([]docker.PluginPrivilege, error)@*struct { F uintptr; a *anagent.Anagent; listener interface {} }@*struct { F uintptr; d *agenttasks.TaskExecutor; folder string }@*struct { F uintptr; ok *bool; oldp *runtime.p; _g_ *runtime.g }@*struct { F uintptr; t *transport.http2Client; s http2.Setting }Begin9protobuf:"varint,3,opt,name=begin" json:"begin,omitempty"DelayedTasksPollPeriod(mapstructure:"delayed_tasks_poll_period"Key;protobuf:"bytes,1,opt,name=key,proto3" json:"key,omitempty"Start9protobuf:"varint,1,opt,name=start" json:"start,omitempty"Ttl;protobuf:"bytes,1,opt,name=ttl,proto3" json:"ttl,omitempty"!6 d /ٯ gaps eFeF(6 d /d\ڦqF6 K 6 d /@  0ps J JG+6 d /`0 JJ~56 d /+q`Pps ""s6 d /TPps ""޶6 d /PPy5%"%"R({6 d /d P+Vڈo6 d / P6`p d"d"x>6 d /@$ps ^^o/-6 d /IX`05GG&[6 d /jo``y z6 d /dP$ps 46 d /05W6 d /4h ~a05P"P"ɗ<6 d /8a05++rlF6 d /( $ps FgE6 d /)$1 pTpTF}6 d /5'$ETT 6 d /~#@Y$ps *!*!y6 d /2L@ bps R6 d /HqFbps @@H6 d /x@Zbps pphuo6 d /)bps 6 d / b ?6 d /$bps @@6 d /Fbps /6 d / bps Z6 d / b 6D6 d /0 Б61 PRPR|r6 d /gБ `V`VU6 d /`ps HL `6 d /ps 00q6N6 d /) Sps i i 9U6 d /h[H S05`[ `[ D9E6 d /NY S05f f o16 d /\^ps x6 d /`u @~N@~NO716 d /pps s s yu6 d /l  c6 d / ps (6 d /Sps NN(6 d /L५ps `` 6 d /| sps l݈6 d /fps M M!,T6 d /@ps MMf6 d /(+H 7qG6 d /hH @6 d /=+ H o26 d /d ps ~6 d /.i^-@h 88RA6 d /@[^-h 88/6 d /@ps %8%826 d / tps P!8P!8PJ6 d /jy!ps 886 d /ɱ ps 77k6 d / /t` "8"8Ї6 d /"eps 66s6 d /B%05  o6 d // fK X5*6 d /p  /` ii}D6 d /- f i iQ6 d /'` / PiPiq6 d /   / ii76 d /ࠩ @wC@i@iJ6 d /(@ @wCiiC\6 d /fmK`x _ _e6 d /Uv E^E^a~6 d /Hv @A^@A^r6 d /Q@Lv ?^?^{6 d / !v J^J^m56 d /&!v >^>^6 d / `cd` `^`^W6 d /v. x #FgL6 d /x % $ O6 d /7n@k3 pp/6 d /@9ps 0؊0؊L6 d /@@9Gd Пn6 d /S஬@r $$zy6 d /T`I@r %%^̼W6 d /l@ps jj&t6 d /L@Py5qq6 d /t@]6e pppp;w6 d /r#~' `Ej`Ej63$6 d / Pu pkjpkj 6 d /#  6 d /CP @~3q3q1,6 d /փ&@ OqOq&(6 d /&@ 0Oq0Oqb6 d /P@x` qqW!iU6 d /o(x` qqGY6 d /`x` qq*yg6 d / '` 2j2j76 d /$`'` 3j3j&16 d /$'` p3jp3jyM(6 d /(. }1}1~IB6 d /ë@ FFI#H6 d /{@@ps `QG`QGDz6 d /@ps QGQG6 d /`ī@ps FFVB6 d /=@@k9_ G G?;C6 d /@ʫ@ps HHmc0 6 d /=ʫ@ps PGPG66 d /7"଩@ps pGpG\6 d /0@@ps GG6 d /z˫@ps @G@GI0X6 d /L"`˫@ps @H@HD6 d /˫@ps `G`GA6 d /ͣ ̫@ps HHX҆6 d /H̫@ps `-H`-Hnn<6 d /a"̫@ps P=HP=H.6 d /"@r@i `H`H[y6 d /"`@2@i PHPHiG6 d /O`X zF zF#6 d /fX^F`FFU<6 d / իps .;.;i6 d /}@T vA;A;] 6 d /I )vgP:;P:;sa6 d /C`) )` p]p]P6 d /e ??_!6 d /Ȭ)xe /E/Ebo6 d /hu` @?@?P6 d / e `;`;_!6 d /Ȭ * xe ??bo6 d /h u` <<>ԥT6 d /*ps 6 d /<߫dNlj6 d /*) @H@H^6 d /.- +)1 HH(6 d /0`+) NNV6 d /@+) `N`N6 d /6 v@ ee?6 d / "`@wC@e@e w6 d /Tn eeQ6 d /4(Ũ eeI;z6 d / .ps 11 6 d /g@BBv 3 3z56 d /p  &; @:@:|6 d /}7 ]]X?6 d / 05JJ1e6 d /@Py5JJC,{6 d /`"` @o@o+6 d /8,` OpOpCb6 d /|`DFoFo^b6 d /I`>o>o6 d /`-` PpPpD6 d /zd` @Rp@RpAk6 d /u@@ 09[09[ dA6 d /-- N9`6 ``)6 d /w @3@3Ҍe6 d /Nq ^^_6]6 d / ҃@u ``B6 d /@br pkpkʁ=6 d /&P;@ ss|2F6 d /r.:~' vv\6 d /$.:~' `w`w$6 d /@n // `5`5K6 d /  pnPpnPރU6 d /u@)8BT#6 d /)!/& ..x6 d /m*6Ge ||˥6 d /'q@c+ps 0606gS6 d /u +ps 66,z6 d /mT+ps 6 6Rt}P6 d /_ 0+ps 66\M/6 d /L`0+ps 66ӵ6 d /# 0+ps p6p6h6 d /2౬+ 66=16 d /,a@ ps O O 6 d /z*c;ps p"Mp"MA6 d /,0 xe MM kX6 d /!. 1 NNm_m6 d /iNps >E6 d /i)N~@i X]b6 d /NgE P^P^Le6 d /d@Ops ۄۄ<~6 d /vu*@Oj&jۄۄ:` 6 d /kp@O ܄܄Qϗ16 d /:6ps zz6 d /:6ps zz@V6 d /`6ps zz[6 d /YR6rxyzzWw6 d /6ps zz+Y6 d /7`*6s`V@z@z+6 d /<6ps zz6 d /U*6tV`z`z!Ve6 d /`ϥPy5xxI6 d /W;@ѳps xx6 d / ps xx]6 d / 6; 0v0v*v6 d /@e6hs `v`v6 d /e6 vvY:m6 d /np6j&w PvPvNG{6 d /o`66X{ v v6 d /^@f6hs vv Q6 d /Hf ps P؉P؉zJ6 d /@g ps ىىm{6 d /#g Mnj)6 d /m@h ps pp'qR6 d /m * @u ෉෉(M6 d /ǀ@ ps ؉؉9"6 d /, ps ։։Pl6 d /c,q ps Ń6 d /h ps O6 d /; 44_6 d /_-;+Cv О6 d /Iĩ;@`* ``PF&6 d /@ũ;. ; 00;6 d /]ũ;@* 00K|=`6 d /l Ʃ;@ + }T6 d /`Ʃ;5 `  }hY86 d /ӐƩ;́  q6 d /2I ǩ;́  6 d /ǩ; ? 66b6 d /OǩVF ||-.6 d /q;@i/ps @|@|a6 d //ps ||xE6 d /7 Nps w w6 d /3i Nps `w`w,76 d / @j Nps wwI6 d /z 8 Nps @w@w3Ϙ6 d /_j7ps LLGȁ6 d /c>@k7ba @N@N2p6 d /k7ba pOpOS6 d / 7ba OOT~+6 d /}>@7ba S S A6 d />@7ba pSpS\6 d /.7ba SS 6 d /@ȩw- O''98i6 d /-Yȩw- OUUa͒6 d /Ql w- O@9@9;/6 d /llǮw- ONNO/i6 d /) ɮeP@i 1m6 d /#ɮeP@i ͅͅi6 d /@lWps Q{6 d / lWps t.h6 d /T ɩPy5}N 6 d /ps xx16 d /Rn@mps zzK36 d /X8ps {{6 d /E0> ȰQ6 d /4` bb[6 d /< 9 *}*}g1j6 d / {+`W0}0}s26 d /@iS/}/}6 d /͛`9 -}-}6 d /Z`ɩ`W}}t$6 d /ɩ`W}}Si6 d /iNps ||6 d /8mps @}@}U6 d /x9 }}46 d /$ : } }ξ6 d /$`: `}`}.6 d /n`& @2h@2ht6 d /l:`& /h/hI X6 d /p: ЗhЗh K16 d /`o2  hh-6 d /!/ EhEh6 d /ͩ!` p@hp@hAT6 d /pΩ+ %h%hX6 d /-ϩ+ P%hP%h]a6 d /w`;+e &h &hҊ;6 d /wԮ+,(@ 6 d /+,( PgPg6 d /oY;ps @@do6 d /l;ps #:"6 d /Y <ps .6 d /_ `<`0ps  6 d / ծ`2 `YV`YVtk6 d / 705@ZJ@ZJn5o6 d /}׮05^J^J6a&6 d /$<&ps WJWJ(/6 d /<&ps pWJpWJ s6 d /g? =&ps WJWJev6 d /\`=&ps PXJPXJb96 d /p=&ps XJXJ5 6 d /Q=&ps YJ YJAm6 d /L >&ps YJYJ^6 d /t-ϩ '@ ОKОKH6 d /7M '@` KKe6 d /(ٮ '`y KK"6 d / ڮ '05KKw%6 d /-  '05`K`Kc,[6 d /\ g`7@ @ Z@ ZDI6 d /*n`7@ fXfXa6 d /`>`7ps PxYPxY6 d /  `7ps mXmXP6 d /ߴ>`7 YYы6 d / `70w ;WW76 d />`7ps ZZ36 d /!@ `7P оXоX@=6 d /ݮ`7X @>6 d /3 ޮ`7ps 0 Y0 Y縜6 d /; =`7Ѓ 0X0X6 d /^k@W`7`y *Z*Z6 d /$ `7Py5nYnYERw6 d /j٩'ps ZZj6 d / ' ZZn6 d /1}@ک'ps ZZC^6 d /)' nZ nZը6 d /'~` ZZU&6 d /L}s'~` Z Ze_6 d /'~` sZsZ6 d / @ ,ps aaky6 d /#`@ , 0a0a?D6 d /@ ,% aaGoi6 d /t@ , aa~6 d /V ,^e aaؔI6 d / A , `a`aG 6 d /@p ,ps @a@a#G6 d /ܪ`A ,ps aai<6 d /Hک ,"6 d /A ,ps a a 6 d / A ,ps aaS6 d /#| B ,ps aay6 d /@ 1ps 5a5aYF6 d /z`B 1ps 6a 6a1ϗ6 d /* H6 d /BC2 PcPcC6 d /{`, d deZ6 d /\ҳ,D 'd'dy,*6 d /7, @c@cT6 d /n,D *d*d-(6 d /cp 0g0gƃ6 d /,jB"?QG6 d /~&h,,MG6 d /@05,,'I6 d / -,,HB6 d /`۩#J ffTQ6 d /۩#J `f`f? 6 d / ܩ#J ff*6 d /ܩ#J ff16 d /Kܩ#J @f@f+6 d / @ݩ#J f f A6 d /Jީx  XgXg6 d /'`ީx6 gg#Ҧ6 d /ީx6 ЮgЮgr6 d /s ߩ,y PePe|6 d /,#@q,` $6 d /5`,޾5e5ez6 d /q, @e@e6 d /D ,K07*e*e (6 d /  \S`S`!6 d /V[`CK07c`c`Ma]6 d /o 8K07l`l`Ruj6 d / E8@r i`i`PD6 d /| Y. P8dP8d6 d / Y. 8d8dEu6 d / Y. p8dp8d: 6 d / Y. 8d8d6 d / bE`0 L`L`f6 d /`8 n`n`(U6 d /@@<fN 0d0d)j6 d /@<fN 0d0dw6 d /:@<fN dd.A6 d /l"@<fN PdPdV6 d /:@<fN ddZE,6 d /l`"@<fN dd:6 d /l O@<fN ddM\6 d / Q16 ````E6 d /  F10@O ``UN6 d /=J  cV6 d /=05ccڞ6 d /sps VIVI26 d /aps VIVI` 86 d /+Jި`20909.q6 d /`pzZ 99 6 d /`299\6 d /%-/ 889]6 d /%`2p9p9C|6 d / `299Z46 d /WD~@i p[p[!,6 d / eD~@i [[[]6 d /^(D~F P[P[s6 d /(D~#[[1e6 d /,D~@i `[`[/b6 d /` D~`G [[7 .6 d /taD p]p]=Y"6 d /qD~@i [[j6(6 d /XD~@i 0[0[76 d /|1D~F [[؋6 d /@@tD @]@])6 d //(@ 9ps Pj[Pj[m\6 d / 9f9`[`[޳6 d /w`@ps qIqI6 d /oN`I@ IIYz6 d /.I@ PIPI|LM6 d /5@ps `rI`rIP᳎6 d /`4y u` OO76 d /tyh 2O2O#f6 d / buyh P2OP2O6 d /Q5@X `O`O!&ح6 d /(Zu 3`[`[>6 d /a`q II`%6 d /Bq I pIpIZA6 d / f9y @xS@xSV(6 d /@2 QQ_^6 d /`u2 QQ6 d /h<2/ 0Q0Qh6 d / `=@ps %R%RBZ6 d /.@OuRR2R~6 d /Y I6 QQ7﹚6 d / x`B PRPR 6 d /U@B DUUt6 d /l J`y DUUA66 d /yZO/ &{U{Uyr36 d /ycA!`J[`J[by6 d /bny DK[K[K6 d / B~`&U&Ux+6 d /D050J0J9Y&6 d /@EPy5JJ(6 d /,`J= SJSJ56)6 d /.@y!ps pLpL 6 d /ops P1P1a/ 6 d /#UJ >1>1i!6 d / K >1>1&[6 d /WU`K @=1@=1v(6 d /zm űps PO-PO-z6 d /U-K 04.04.6 d /m L 3.3. {;y6 d /X`L 4.4.%6 d /mL 3.3.8#6 d /mL 2.2.I>f6 d / M p3.p3.&6 d /`Mq 9K9K6<6 d / b0 3JJ[<6 d /  b0 3PJPJ3ؗ6 d /j b0 3JJh;6 d /j b0 3PJPJw6 d /෬ b0 3JJ|d|6 d / b0 30J0Jt_6 d / b0 3JJì6 d /0@z b0 3JJ6 d / k b0 3`J`Jt6 d / b0 3JJ$h6 d /Φ b0 3PJPJnj6 d / bx JJOq6 d /$M$ps pKpK-D6 d /M$ps KK6 d /ʤ ѥ$6 K K:6 d /I 05664u2,6 d /i 05SS k6 d /2d 05P=P=6 d /J 050<0<d6 d /N ``nw~76 d /:j@ps PaPa 6 d / O aaK}S6 d /Ʊ0 !!Q6 d /eL8@i м!м!÷6 d /05!!.6 d /}& M05!! 6 d /O  05!!6 d /g+`O,% \"6 d /v,% f~6 d /fO,%ps @@c6 d /O,%  @%6 d /,% j6 d /K&z,%3e Ǣ6 d /v,% S6 d /+@,%ps  qg@6 d /*@>*76 d /+`Q( =*=*6 d /@(ps \*\*76 d /{(^e C* C*6 d /YQ( C*C*6 d /b (+P%P%J@6 d /ݥS(ps й&й&O16 d /ຬ(Py5pb*pb*ˑs6 d /@|(ps Pd*Pd*۷6 d /j o(4 p%p%@G=!6 d / Q(ps d*d*6 d /B@()0e*0e*`<6 d /`(6 d /D@l(ps g* g*:ǝ6 d /ˇ R(ps i*i*k,6 d /`R(ps i*i*a.6 d / R(ps m*m*&k6 d /|(Py5p*p*PX6 d /CR( L*L*m.6 d /̫@}(d w*w*"6 d /6co(~`90\(0\(;'Y6 d /m(~`9y*y*w#6 d /(ps `{*`{*OP 6 d /H(Py5@~*@~* 6 d /`[(d %(%(K6 d /`(ps **{y6 d /j(d w*w*H6 d /) S( P*P*'-6 d /;`S( **l6 d /[(P((:l6 d /) (`*`*ǝ6 d / n(~`9**P6 d /{(05`*`*7U6 d / ཬ(ps **׽6 d /N@(Py5P*P* 76 d />| \@0599\I6 d /S@050:0:%[ .6 d /\ps !!6 d /l Tps !!ey6 d /ٶ\050!0!L6 d /&`Tps 6 d /PTps  k6 d /Ps ps {:6 d / ̱ z@i 36 d /|k]ps 66Fi6 d /Y UОps EE]6 d /D`UОps @E@E06 d /!-ͱОs PEPEd6 d /HU I6 d /@ V P P e6 d /*q^ps 0 0 m6 d /S0 _ B6 d /Peps **Y(6 d /@`V Й+Й+76 d /,V 0+0+json:"Cmd,omitempty" yaml:"Cmd,omitempty" toml:"Cmd,omitempty"DNS>json:"Dns,omitempty" yaml:"Dns,omitempty" toml:"Dns,omitempty"Data=protobuf:"bytes,1,opt,name=data,proto3" json:"data,omitempty"Data=protobuf:"bytes,2,opt,name=data,proto3" json:"data,omitempty"End>json:"End,omitempty" yaml:"End,omitempty" toml:"End,omitempty"Env>json:"Env,omitempty" yaml:"Env,omitempty" toml:"Env,omitempty"Etag=protobuf:"bytes,3,opt,name=etag,proto3" json:"etag,omitempty"GID>json:"GID,omitempty" yaml:"GID,omitempty" toml:"GID,omitempty" IdleTimeout6yaml:"max_idle_timeout" envconfig:"REDIS_IDLE_TIMEOUT"Key>json:"Key,omitempty" yaml:"Key,omitempty" toml:"Key,omitempty"Kind=protobuf:"bytes,1,opt,name=kind,proto3" json:"kind,omitempty"Lazy=protobuf:"varint,5,opt,name=lazy,def=0" json:"lazy,omitempty"Log>json:"Log,omitempty" yaml:"Log,omitempty" toml:"Log,omitempty"Name=protobuf:"bytes,1,opt,name=name,proto3" json:"name,omitempty"Number;protobuf:"varint,2,opt,name=number" json:"number,omitempty"Number;protobuf:"varint,3,opt,name=number" json:"number,omitempty"Packed;protobuf:"varint,2,opt,name=packed" json:"packed,omitempty"Path=protobuf:"bytes,2,opt,name=path,proto3" json:"path,omitempty"Pid>json:"Pid,omitempty" yaml:"Pid,omitempty" toml:"Pid,omitempty"1ProvisionedWriteCapacityAutoScalingSettingsUpdatetype:"structure" QueueUrls8locationNameList:"QueueUrl" type:"list" flattened:"true"1ReplicaProvisionedReadCapacityAutoScalingSettingstype:"structure"ReturnConsumedCapacity+type:"string" enum:"ReturnConsumedCapacity"Role=protobuf:"bytes,1,opt,name=role,proto3" json:"role,omitempty"Role=protobuf:"bytes,2,opt,name=role,proto3" json:"role,omitempty"Rss>json:"rss,omitempty" yaml:"rss,omitempty" toml:"rss,omitempty"Syntax;protobuf:"bytes,12,opt,name=syntax" json:"syntax,omitempty"Tag>json:"Tag,omitempty" yaml:"Tag,omitempty" toml:"Tag,omitempty"Tty>json:"Tty,omitempty" yaml:"Tty,omitempty" toml:"Tty,omitempty"Tty>json:"tty,omitempty" yaml:"tty,omitempty" toml:"tty,omitempty"UID>json:"UID,omitempty" yaml:"UID,omitempty" toml:"UID,omitempty"Dgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/hashicorp/hclDgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4D*func(*dynamodb.DeleteItemInput) (*dynamodb.DeleteItemOutput, error)D*func(*dynamodb.ListTablesInput) (*dynamodb.ListTablesOutput, error)D*func(*dynamodb.Projection) *dynamodb.LocalSecondaryIndexDescriptionD*func(*dynamodb.UpdateItemInput) (*dynamodb.UpdateItemOutput, error)D*func(*http.Request, http.http2RoundTripOpt) (*http.Response, error)D*func(*map[string]string, string, string, map[string]string, string)D*func(*transport.Stream, []uint8, []uint8, *transport.Options) errorD*func([]*dynamodb.ConsumedCapacity) *dynamodb.TransactGetItemsOutputD*func(context.Context, func(context.Context, *pubsub.Message)) errorD*func(description.SelectedServer) ([]wiremessage.WireMessage, error)D*func(docker.PruneImagesOptions) (*docker.PruneImagesResults, error)D*func(int64) *dynamodb.GlobalTableGlobalSecondaryIndexSettingsUpdateD*func(io.Reader, []uint8, crypto.SignerOpts) (*ssh.Signature, error)D*func(map[string]*dynamodb.AttributeValue) *dynamodb.DeleteItemInputD*func(map[string]*dynamodb.AttributeValue) *dynamodb.UpdateItemInputD*func(reflect.Type, bsoncodec.ValueCodec) *bsoncodec.RegistryBuilderD*func(string, interface {}, ...macaron.HTMLOptions) ([]uint8, error)D*struct { F uintptr; it *pubsub.SnapshotIterator; c *pubsub.Client }D*struct { F uintptr; maxStreams **uint32; t *transport.http2Client }D*struct { F uintptr; name string; tc *string; wait *sync.WaitGroup }D*struct { F uintptr; r *macaron.Router; handlers []macaron.Handler }D*struct { F uintptr; t *transport.http2Client; s *transport.Stream }AccessControlAllowOrigin*mapstructure:"access_control_allow_origin"AppBrandingLogoSmall.mapstructure:"application_branding_logo_small"Code>protobuf:"varint,1,opt,name=code,proto3" json:"code,omitempty"Path>protobuf:"varint,1,rep,packed,name=path" json:"path,omitempty"Peer>protobuf:"bytes,11,opt,name=peer,proto3" json:"peer,omitempty" PrefetchCount5yaml:"prefetch_count" envconfig:"AMQP_PREFETCH_COUNT"2ReplicaProvisionedWriteCapacityAutoScalingSettingstype:"structure"Span>protobuf:"varint,2,rep,packed,name=span" json:"span,omitempty"Weak>protobuf:"varint,10,opt,name=weak,def=0" json:"weak,omitempty"Egithub.com/MottainaiCI/mottainai-cli/vendor/github.com/go-stack/stackEgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/koding/loggingEgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/mudler/anagentEgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/streadway/amqpEgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/xdg/stringprepEgithub.com/MottainaiCI/mottainai-cli/vendor/go.opencensus.io/internalEgithub.com/MottainaiCI/mottainai-cli/vendor/go.opencensus.io/resourceEgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/cast5E*[]struct { extKeyUsage x509.ExtKeyUsage; oid asn1.ObjectIdentifier }E*func(*dynamodb.Projection) *dynamodb.GlobalSecondaryIndexDescriptionE*func(*dynamodb.ProvisionedThroughput) *dynamodb.GlobalSecondaryIndexE*func(*dynamodb.QueryInput) (*request.Request, *dynamodb.QueryOutput)E*func(*sqs.ListQueuesInput) (*request.Request, *sqs.ListQueuesOutput)E*func(*sqs.PurgeQueueInput) (*request.Request, *sqs.PurgeQueueOutput)E*func(*sqs.UntagQueueInput) (*request.Request, *sqs.UntagQueueOutput)E*func([]*dynamodb.KeySchemaElement) *dynamodb.LocalSecondaryIndexInfoE*func([]*sqs.SendMessageBatchRequestEntry) *sqs.SendMessageBatchInputE*func([]*sqs.SendMessageBatchResultEntry) *sqs.SendMessageBatchOutputE*func(context.Context, *tasks.Signature) (*result.AsyncResult, error)E*func(context.Context, *transport.CallHdr) (*transport.Stream, error)E*func(int64) *dynamodb.ReplicaGlobalSecondaryIndexSettingsDescriptionE*func(map[string]*dynamodb.AttributeValue) *dynamodb.DeleteItemOutputE*func(map[string]*dynamodb.AttributeValue) *dynamodb.UpdateItemOutputE*func(reflect.Kind, reflect.Kind, interface {}) (interface {}, error)E*func(reflect.Type, reflect.Type, interface {}) (interface {}, error)E*func(string) *dynamodb.GlobalTableGlobalSecondaryIndexSettingsUpdateE*func(string) func(context.Context, string, string) (net.Conn, error)E*func(string, bool, bool, bool, bool, amqp.Table) (amqp.Queue, error)E*func(viper.RemoteProvider) (<-chan *viper.RemoteResponse, chan bool)E*struct { Blob []uint8; Comment string; Rest []uint8 "ssh:\"rest\"" }E*struct { F uintptr; h *runtime.mheap; s *runtime.mspan; acct int32 }E*struct { F uintptr; waitForBodyRead chan bool; eofc chan struct {} }E*struct { Signal string; CoreDumped bool; Error string; Lang string }E*struct { value []uint8; length int; style yaml.yaml_scalar_style_t }CreatedCollectionAutomatically%bson:"createdCollectionAutomatically"Options% d /Q@)E V d /  } d /2`@ ?b d /u TY d /p @`2TY d /p@`23 d //$ѹ`& d /,@8 23 d / . @ & d /@ . u eD d // .` ` u >% d /Q . )E V d / . ¨   } d /2 .¨ @ ?b d / .¨ u 7Sj d /K .@è @2Ws d /m@ .è $c 3 d //@ $ `& d /, .`Ĩ 8 |L d / .Ĩ  t;: d /a@ Ũ F d /EŨ@wC> 3 d /4(_@Ũ eec d /# @ƨ C K d /@ ƨ C~' | d /g+ Ǩ N9`6 3 d /@$ V V''~3 d /$''C. d /N Ȩ;@ ; d /&@Ȩr  d /.nȨ/f{ ־ d /c@ɨ9o d /x{ɨ+ Oz643 d /r $';0i d /`_`ʨN,|1 ` d / \0ʨJ{ 0 d / 0 ˨@u 8 d /x @˨67 ;~ d /L˨6J{  d /z@̨6` 0 d /̨6rxy+ d / ͨ6@u B} d /#;`ͨ6s`VW= d /=;@ͨ6tVXR d /a Ψ6F ㎅ d /sΨ6WD S2w d /4 Ψ6^e m d /R`@ n@Ϩ` ^ d /~` nϨ7: A{w4 d /` nШЀ S? d / @ n`Ш~` _ d /Lm ;Ш ?.E] d /@ ; Ѩ z Vcp d /djѨ/6 vQI d /"Ѩ7ba $= d /_Ǭ@Ҩw- O+ d / ڬҨXt<h9 d /ڬӨ4l d /@`Ө`W,h d /( gӨ 0[ = d /.*o Ԩ,3@ B d /*oԨ  ; d /+qԨ!` ۜ d /n-{@ը+3  b d /'5 wը '@  d /k@Ow֨'~` >3 d /A*@P ,$@ X  d /Q֨C2  d />Te ר ^ d /zWsר#J 0o< d /y( YȬרx  +|E d /'@YȬ@بx6 `a d /Z|ب,y Z d /b٨K07N( d /_d`٨C@r  d / % @d٨Y. o d /dw ڨ' L5 d /̜ewڨ'X N d / @ewڨ'a S3 d /uIg$`_@0BK d /0@g`nۨ`8 3 d /g@ܨ@Ov ˎv d /Eg@`ܨ@<fN Ys d /h@ܨ@<  yI d /h ݨ10@O ʁ d /%jݨ10O m< d /8kݨ10O ?=3 d /+JS`2Ц8Ц8E d /d`eި`; 95w d /[@`eߨ`vsv; d /9 `ߨ 8  d /L ߨ C  d / D3 <  d /s(@Zu 3dx d /(Zu`3p d /\3U@Py5є5| d /3.t`X,( d /`u3.@i Y% d /"`39  A]% d /@@7/@i ,E2 d /@ @7 D7 d /*@ZO/ && d /+ɬy% g3 d / ʬ@z}.d 4 d /1/^e : d /o{` g0 d /@`   d /@  b0 3ᐘ d /   bx im d /$@p ` M d /$p 8 6 R8 d /*p@ r@i %( d / +@p 05Kb d /p m`E> d /;%p` 2s2 d /L%p i  d /+p  N1 _!F d /&+p Py5! d /@p jt,: d /~p@ „[ d /m&2,u,%pe QT d /~@2,u,% e =\ d /j2(`(qT L% d /W@3((0~ d /3( (s s d /3((d _b d /_#4((k` zK d /@4(@(e j d /o)5(() d /#5(( xh\ d /5(`(/@i ~߅ d /6(( sX d /E9( (4qg ɰ3 d /@:($6 km d />(( -W d /#?(@(~`9 d /k?((%"[ d /T.Ape . d /A` e ݱ d / 8p3dp`̭G) d /h 8p3dp1: d /p8p3dp@%n d /U) 8p3dp`K#g d /) 08p3dp_f d / 8p3dpa d / 8p3dp1B d / P8p3dp@r:: d /8p3dp d /(i8p3dp@& d /R@ip8p3dp:\ d /(8p3dp] d / i08p3dp@qOY d /ai8p3dpi{d d /) 8p3dp!ɪ d /:jP8p3dp୪&[j d /0 8p3dp๷` d /8p3dp%88 d / p8p3dp[ d /* 8p3dp`i= d /9 08p3dpŹWU  d /! 8p3dp^# d / 8p3dp@f4u d /) P8p3dp`/Tp0 d / 8p3dp~{( d /08p3dp i d /: p8p3dp`6jf d /( 8p3dpM d / 08p3dp  d /8p3dp@2 d /8p3dp@Ṛ? d /P8p3dp`$D  d / 8p3dp ٭D d /)) 8p3dp3a d /bp8p3dpKQ d / 8p3dpnba d / 08p3dpvq d / 8p3dpi! d / @j8p3dpв' d / P8p3dp  d / j8p3dpPS`V d /b j8p3dp`?{ d /\(p8p3dp3 d / 8p3dpE@ d /! 08p3dp t_e d /f 8p3dpOȵ d /( 8p3dp@C d /( P8p3dp`oV d /8p3dp  d / 8p3dpH d /p8p3dp`  d /k8p3dp`WGXA d /08p3dp| d /l8p3dp^!  d /y 8p3dpX+ d /P8p3dp``\l d /(8p3dp`%.  d /8p3dp@^qA d / p8p3dp`B d / 8p3dp`% { d /+08p3dp@=b d /; 8p3dp`յ d /8p3dp;: d /Ӧ P 8p3dpKpK d / 8p3dp #u d /`  8p3dp] 4 d /p 8p3dp@˨\G d /Vlk 8p3dp`Yٹ  d /l@k0 8p3dpHku d /% 8p3dp  d / 8p3dp 5Ψ^ d / P 8p3dpL ĭ  d / " k 8p3dp@ Xh" d /k 8p3dp hn d / lp 8p3dp@W4 d /# б p3p`̭{ * d /1* 0p3q{   d /! p3^0': d /N0fp3ʖj* d /0fPp30Ж@ko d / p3pD$rM d /- p3pEɷ d / tpp3pR d /6 tp3pTX d / t0p3ڛ@Ž d / + tp3p֠"a d /tp3X1֠0 d / @lPp3rRe d / p3?@- d /p3\`  l% d /9+ pp3 Jч d /# p3pO d /N +0p3cE d /f+p3ttt7 d // |p3p@r2I? d / NPp3(2I? d / +p3(2I? d / )p3(2I? d / mpp3('+ d /zmp3Ӗ2I? d / `)0p3(L" d /`)p3Ӗ2I? d / @]p3(2I? d / mPp3(2I? d / np3(2I? d / ]p3(2I? d / )pp3(Y" d / )p3pc d /A, )0p3p¸?|H d /)p3Ӗ2I? d / 6p3(2I? d / )Pp3(2I? d / ]p3( JA d / cp3dyf. d /) cpp3r  d /c cp3r@Acb d /~ c0p3r F d /l`-p3r@BA< d /m`-p3r  d /c@m`-Pp3r@Acb d /~m`-p3r$$u} d 1+ p3\{y2I? d / pp3(Q d /^p3p P d / t0 p3M: d / t p3p^ Qx d /Z @ p3H˖y o` d /}@P!p3p0 M d /e@!p3t0>k d /t"p3`&Vj|x d /" xp"p3p5TX d / @9"p3ڛ@f` d / @90#p3@, d /; @9#p3@ d / #p3Pۗ_ d / P$p32;c- d /)$p3$h@vܻn d /x%p3 |` Jч d /# p%p3p & d / %p3t d / o0&p3pܷp d / .&p35r _ d / .&p32; Jч d /# .P'p3p & d / .'p3t d / p .(p3p޷dq d /l ~p(p3іœ5d d /+ (p3pd d /|B0)p3ܥdq d /l )p3іœmA d /+@/)p3pª¤ d //P*p3p` d /P @q/*p3"?J d /m:+p3r :,i d /ܳ:p+p3{0&$<~ d /= @z+p3xi@ d /Q @z0,p3p@Y. d /}@z,p3$eǜ d /)@z,p3; d / zP-p3p p7 d /L{-p3r HS d /].p3` G d /cp.p3xXy d /c.p3[tZ UH d / 0/p3py'ڰ d /, ൭/p3paM d /ؾ ൭/p3p`* d /vڬP0p3r 0hB d /ڬ0p3rȢ  d /Jڬ1p3r ~łRU d /\ p1p3.t`! #< d />m`{1p3r d /' o02p3P@vC d /# o2p38xE9 d /# q2p3yh^r d /9 qP3p3^| ͩ: d / {3p3p ! d /@{4p3H``3 Tv d /[ p4p3pyK` d /`# @r`4p3p@{ʱY d /M |05p3r   d / 5p3r+Y d /]* 5p3p n d /* s|P6p3p_չ d /s|6p3pۨΫ| d /8# |7p3pB(X d /] t|p7p3ܘ@&Fc d / u7p3px d /08p3p@RW( d / 8p3 ! d / 8p3d[0y$ d / P9p3p e d /,)e9p3B1şgE d / :p3r@ d / p:p3pGq2 d /z{:p3P  d /{0;p3@z d /q ɬ;p3(@E' d / ;p3ʖ 3 d /X P<p3p> d /<p3q d /=p3p`Ix d /+ @ܬp=p39i d / =p3qp(l d /10>p3p`Ƹ-4 d / >p3pۊ d />p3 @g d /pP?p3p{ d /e+ @?p3͆@ߟ d / |@p3p@Ŵ d /B ,up@p3pZu d / ,u@p3˃DR d / ,u0Ap3s`1+T d / (Ap3x d /* (Ap3@e d /(PBp3rY d / @w(Bp3˃T  d / (Cp3 h O d /H w(pCp3pr5L d /* (Cp3-@ߟ JA d /(0Dp3dyJ d / (Dp3@u d /| (Dp3r@ Y d /" (PEp3@ I r d /B(Ep3s0j d /(Fp3p`\&8Y d /F(pFp3Vt^$ d / x(Fp3M<z]@ d /Ky(0Gp3M</ݿ d /*(Gp3@P d / (Gp3p`?1ت d / @PHp3pd[7C d / yHp3 3ڼ d /(Ip3r@ҟSE d /LpIp3rҟD d /pIp3rҟPz`'SL!H/tXʖ;ꄖ`& 2$N d /(pXRsv 2$N d /(@ .XRsv  P/  @z0Y`0;0 Ȱ/6d`Ypp 8 z`/I @ YF| $z0x d /PZV>KZ d /% Zɖ;augT d / [e d /Ip[͟Җ`#[ d / t[{l`& d /j ,u0\XΖ Ӗ`&0 IףAx/ @\p;p'T/N \(˖ 3;@Wx 07[P]ۆ` "`яK$ d /=]ۆ` `W@Z6R/>^4 Աz @ K"P/p^@ϖ` 4ܘm @ɲr/L^ )z 2> d /s 0_ 3r&@f d /: _o(@yzۡH'`P d C @_ƖvҖ` @8/ pP`Ɩvx0 b d 0 `ƖvpVXc d /@ yaرp0 q d /4paرp ܥ0 q d /4 .aرp`ܥ0  d /p@ @b b` SA  d / b c jF d /k*c ~wFgithub.com/MottainaiCI/mottainai-cli/vendor/cloud.google.com/go/pubsubFgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/go-unitsFgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/sirupsen/logrusFgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/argon2Fgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/bcryptFgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/sync/errgroupFgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-billy.v4F*func(*dynamodb.CreateTableInput) (*dynamodb.CreateTableOutput, error)F*func(*dynamodb.DeleteTableInput) (*dynamodb.DeleteTableOutput, error)F*func(*dynamodb.ListBackupsInput) (*dynamodb.ListBackupsOutput, error)F*func(*dynamodb.Projection) *dynamodb.CreateGlobalSecondaryIndexActionF*func(*dynamodb.SourceTableFeatureDetails) *dynamodb.BackupDescriptionF*func(*dynamodb.TagResourceInput) (*dynamodb.TagResourceOutput, error)F*func(*dynamodb.UpdateTableInput) (*dynamodb.UpdateTableOutput, error)F*func(*request.Operation, interface {}, interface {}) *request.RequestF*func(*sqs.RemovePermissionInput) (*sqs.RemovePermissionOutput, error)F*func(*sqs.SendMessageBatchInput) (*sqs.SendMessageBatchOutput, error)F*func(...func(*endpoints.Options)) (endpoints.ResolvedEndpoint, error)F*func([]*dynamodb.ConsumedCapacity) *dynamodb.TransactWriteItemsOutputF*func([]*dynamodb.KeySchemaElement) *dynamodb.GlobalSecondaryIndexInfoF*func([]*dynamodb.ReplicaDescription) *dynamodb.GlobalTableDescriptionF*func([]*dynamodb.TransactWriteItem) *dynamodb.TransactWriteItemsInputF*func(context.Context, *tasks.Chain) (*result.ChainAsyncResult, error)F*func(docker.PruneVolumesOptions) (*docker.PruneVolumesResults, error)F*func(reflect.Kind, bsoncodec.ValueDecoder) *bsoncodec.RegistryBuilderF*func(reflect.Kind, bsoncodec.ValueEncoder) *bsoncodec.RegistryBuilderF*func(reflect.Type, bsoncodec.ValueDecoder) *bsoncodec.RegistryBuilderF*func(reflect.Type, bsoncodec.ValueEncoder) *bsoncodec.RegistryBuilderF*func(string) *dynamodb.ReplicaGlobalSecondaryIndexSettingsDescriptionF*struct { F uintptr; ac *grpc.addrConn; done func(balancer.DoneInfo) }F*struct { F uintptr; r *parse.RangeNode; s *template.state; mark int }F*struct { F uintptr; t *transport.http2Client; hdrListSizeErr *error }F*struct { F uintptr; t plumbing.ObjectType; objSize int64; pos int64 }Entry?protobuf:"bytes,1,rep,name=entry,proto3" json:"entry,omitempty"Paths?protobuf:"bytes,1,rep,name=paths,proto3" json:"paths,omitempty"Rules?protobuf:"bytes,1,rep,name=rules,proto3" json:"rules,omitempty"Topic?protobuf:"bytes,1,opt,name=topic,proto3" json:"topic,omitempty"Topic?protobuf:"bytes,2,opt,name=topic,proto3" json:"topic,omitempty"Value?protobuf:"bytes,1,opt,name=value,proto3" json:"value,omitempty"Value?protobuf:"bytes,2,opt,name=value,proto3" json:"value,omitempty"Ggithub.com/MottainaiCI/mottainai-cli/vendor/github.com/src-d/gcfg/tokenGgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/src-d/gcfg/typesGgithub.com/MottainaiCI/mottainai-cli/vendor/go.opencensus.io/stats/viewGgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/blake2bGgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/ed25519Ggithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/openpgpGgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/sync/semaphoreGgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/peerG*[14]struct { extKeyUsage x509.ExtKeyUsage; oid asn1.ObjectIdentifier }G*func(*dynamodb.ScanInput, func(*dynamodb.ScanOutput, bool) bool) errorG*func(*sqs.CreateQueueInput) (*request.Request, *sqs.CreateQueueOutput)G*func(*sqs.DeleteQueueInput) (*request.Request, *sqs.DeleteQueueOutput)G*func(*sqs.GetQueueUrlInput) (*request.Request, *sqs.GetQueueUrlOutput)G*func(*sqs.SendMessageInput) (*request.Request, *sqs.SendMessageOutput)G*func(*strconv.decimalSlice, *strconv.extFloat, *strconv.extFloat) boolG*func(agenttasks.StateRequest, agenttasks.ArtefactMapping) (int, error)G*func(bsoncodec.DecodeContext, bsonrw.DocumentReader, *bsonx.Doc) errorG*func(bsoncodec.DecodeContext, bsonrw.ValueReader, reflect.Value) errorG*func(bsoncodec.EncodeContext, bsonrw.ValueWriter, reflect.Value) errorG*func(context.Context, wiremessage.ReadWriter) (result.IsMaster, error)G*func(docker.ListFilteredPluginsOptions) ([]docker.PluginDetail, error)G*func(string, func() (interface {}, error)) (interface {}, error, bool)G*struct { Curve string; KeyBytes []uint8; Rest []uint8 "ssh:\"rest\"" }G*struct { F uintptr; cache *runtime.pcvalueCache; gcw *runtime.gcWork }G*struct { F uintptr; iter *object.TagIter; cb func(*object.Tag) error }G*struct { Name string; P *big.Int; Q *big.Int; G *big.Int; Y *big.Int }AddrAjson:"Addr,omitempty" yaml:"Addr,omitempty" toml:"Addr,omitempty"ArgsAjson:"Args,omitempty" yaml:"Args,omitempty" toml:"Args,omitempty" AttributeType8type:"string" required:"true" enum:"ScalarAttributeType"CPUsAjson:"CPUs,omitempty" yaml:"CPUs,omitempty" toml:"CPUs,omitempty"DataAjson:"Data,omitempty" yaml:"Data,omitempty" toml:"Data,omitempty"DeadAjson:"Dead,omitempty" yaml:"Dead,omitempty" toml:"Dead,omitempty"GroupMetasTable6yaml:"group_metas_table" envconfig:"GROUP_METAS_TABLE"HardAjson:"Hard,omitempty" yaml:"Hard,omitempty" toml:"Hard,omitempty"ModeAjson:"Mode,omitempty" yaml:"Mode,omitempty" toml:"Mode,omitempty"NameAjson:"Name,omitempty" yaml:"Name,omitempty" toml:"Name,omitempty"NameAjson:"name,omitempty" yaml:"name,omitempty" toml:"name,omitempty"Nanos@protobuf:"varint,2,opt,name=nanos,proto3" json:"nanos,omitempty"NodeAjson:"Node,omitempty" yaml:"Node,omitempty" toml:"Node,omitempty"PathAjson:"Path,omitempty" yaml:"Path,omitempty" toml:"Path,omitempty"ReadAjson:"read,omitempty" yaml:"read,omitempty" toml:"read,omitempty"ResultsExpireIn6yaml:"results_expire_in" envconfig:"RESULTS_EXPIRE_IN"SizeAjson:"Size,omitempty" yaml:"Size,omitempty" toml:"Size,omitempty"SoftAjson:"Soft,omitempty" yaml:"Soft,omitempty" toml:"Soft,omitempty"SwapAjson:"swap,omitempty" yaml:"swap,omitempty" toml:"swap,omitempty"TagsAjson:"Tags,omitempty" yaml:"Tags,omitempty" toml:"Tags,omitempty"TaskStatesTable6yaml:"task_states_table" envconfig:"TASK_STATES_TABLE"TestAjson:"Test,omitempty" yaml:"Test,omitempty" toml:"Test,omitempty"TypeAjson:"Type,omitempty" yaml:"Type,omitempty" toml:"Type,omitempty"UserAjson:"User,omitempty" yaml:"User,omitempty" toml:"User,omitempty"UserAjson:"user,omitempty" yaml:"user,omitempty" toml:"user,omitempty"Value@protobuf:"varint,1,opt,name=value,proto3" json:"value,omitempty"Hgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/fsnotify/fsnotifyHgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/go-macaron/injectHgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/pelletier/go-tomlHgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/theckman/go-flockHgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/blowfishHgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/poly1305Hgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/net/http2/hpackHgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/codesHgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/statsH*dynamodb.AutoScalingTargetTrackingScalingPolicyConfigurationDescriptionH*func(*dynamodb.BatchGetItemInput) (*dynamodb.BatchGetItemOutput, error)H*func(*dynamodb.BillingModeSummary) *dynamodb.ReplicaSettingsDescriptionH*func(*dynamodb.CreateBackupInput) (*dynamodb.CreateBackupOutput, error)H*func(*dynamodb.DeleteBackupInput) (*dynamodb.DeleteBackupOutput, error)H*func(*dynamodb.StreamSpecification) *dynamodb.SourceTableFeatureDetailsH*func(*dynamodb.TableDescription) *dynamodb.RestoreTableFromBackupOutputH*func(*dynamodb.TimeToLiveSpecification) *dynamodb.UpdateTimeToLiveInputH*func([]*dynamodb.GlobalSecondaryIndexUpdate) *dynamodb.UpdateTableInputH*func([]map[string]*dynamodb.AttributeValue) *dynamodb.KeysAndAttributesH*func(context.Context, *tasks.Group, int) ([]*result.AsyncResult, error)H*func(context.Context, ...*options.DropIndexesOptions) (bson.Raw, error)H*func(context.Context, description.Server, wiremessage.ReadWriter) errorH*func(description.SelectedServer, wiremessage.WireMessage) *command.FindH*func(description.SelectedServer, wiremessage.WireMessage) *command.ReadH*func(docker.PruneNetworksOptions) (*docker.PruneNetworksResults, error)H*func(map[string][]*dynamodb.WriteRequest) *dynamodb.BatchWriteItemInputH*func(string, docker.AuthConfiguration) ([]docker.APIImageSearch, error)H*struct { F uintptr; artefactPath string; t *agenttasks.Task; s string }H*struct { F uintptr; g *iam.grpcClient; resource string; p *iam.Policy }H*struct { F uintptr; negate bool; re *regexp.Regexp; c **object.Commit }H*struct { F uintptr; p *properties.Properties; key string; def *string }H*struct { F uintptr; pc *http.persistConn; continueCh <-chan struct {} }ConnectTimeout8yaml:"connect_timeout" envconfig:"REDIS_CONNECT_TIMEOUT"Extendee>protobuf:"bytes,2,opt,name=extendee" json:"extendee,omitempty"Location>protobuf:"bytes,1,rep,name=location" json:"location,omitempty"ValueAprotobuf:"fixed32,1,opt,name=value,proto3" json:"value,omitempty"ValueAprotobuf:"fixed64,1,opt,name=value,proto3" json:"value,omitempty"Igithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/awsIgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/codegangsta/injectIgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/mattn/go-runewidthIgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/src-d/gcfg/scannerIgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/ssh/agentIgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/statusI*func(*dynamodb.GetItemInput) (*request.Request, *dynamodb.GetItemOutput)I*func(*dynamodb.GlobalTableDescription) *dynamodb.CreateGlobalTableOutputI*func(*dynamodb.GlobalTableDescription) *dynamodb.UpdateGlobalTableOutputI*func(*dynamodb.ProvisionedThroughput) *dynamodb.GlobalSecondaryIndexInfoI*func(*dynamodb.PutItemInput) (*request.Request, *dynamodb.PutItemOutput)I*func(*dynamodb.QueryInput, func(*dynamodb.QueryOutput, bool) bool) errorI*func(*dynamodb.TimeToLiveDescription) *dynamodb.DescribeTimeToLiveOutputI*func(*dynamodb.TimeToLiveSpecification) *dynamodb.UpdateTimeToLiveOutputI*func([]*sqs.DeleteMessageBatchRequestEntry) *sqs.DeleteMessageBatchInputI*func([]*sqs.DeleteMessageBatchResultEntry) *sqs.DeleteMessageBatchOutputI*func(description.SelectedServer, wiremessage.WireMessage) *command.CountI*func(description.SelectedServer, wiremessage.WireMessage) *command.WriteI*func(map[string]*dynamodb.ExpectedAttributeValue) *dynamodb.PutItemInputI*func(map[string]*dynamodb.KeysAndAttributes) *dynamodb.BatchGetItemInputI*func(map[string][]*dynamodb.WriteRequest) *dynamodb.BatchWriteItemOutputI*func(plumbing.ObjectType, plumbing.Hash) (plumbing.EncodedObject, error)I*struct { F uintptr; c *cobra.Command; debugflags *func(*cobra.Command) }I*struct { F uintptr; deadline time.Duration; it *pubsub.messageIterator }I*struct { F uintptr; iter *object.TreeIter; cb func(*object.Tree) error }I*struct { F uintptr; persistentFlags *pflag.FlagSet; out *pflag.FlagSet }I*struct { F uintptr; standaloneComments map[token.Pos]*ast.CommentGroup } Architecture;json:"Architecture,omitempty" yaml:"Architecture,omitempty"MemberAprotobuf:"bytes,3,opt,name=member,proto3" json:"member,omitempty"PointInTimeRecoveryStatus.type:"string" enum:"PointInTimeRecoveryStatus"PolicyAprotobuf:"bytes,2,opt,name=policy,proto3" json:"policy,omitempty"RemoteAprotobuf:"bytes,2,opt,name=remote,proto3" json:"remote,omitempty"7ReplicaProvisionedReadCapacityAutoScalingSettingsUpdatetype:"structure"SymbolAprotobuf:"bytes,2,opt,name=symbol,proto3" json:"symbol,omitempty"TopicsAprotobuf:"bytes,1,rep,name=topics,proto3" json:"topics,omitempty"E d /-`|бady`1 d /4o|бady| d /,Pf@Pp@Qt/FPtP$0W~ d //vܖ`tsO d /X`$ M`&k d /m`t$p od d /o_ bI  d /Tbbۖ`'\- d /NY7  S` 0& d /"j@͖@s ]/iࢫ d /@ldy- d /9`.' d /f ;. p9 d /(+;+  ^)D 9 d /`=+ W]9 d /=+ /09 d /R+>+@) D<c d 0`pZ ݩ萖/o@oਫI d /ɱ@B`.@D d /"eCӖp0+ d /kIԖ p ' n d /P!vu%dyW9 d /a хx9 d /@l.@6F` =5 d /c6p  d /h[4p- d /l/` n0P d //`x~ 3@ d //೩x~`3PD  d /`h .@ `̖0ֲ9 d /Ih . p@ҞA_ d /Ni . `̖0_=V3 d /é ( `3;> d /h \ 4p ^ d /` DҖ@hs d /g`Btҗ`& m6 d /M`ඩ7lP)L;*9 d />a@@7nՖ@c~7 d /#70iՕ9 d /Pa7 `~ d /```P{@Ep9 d /|@c``Y-ƍ9 d /٦ ` `@̖@ٷ3|9 d ///z\T9 d /!:๩(<  d /l@s@|֖@ 4 d / @*; d /*;#> d /^@s`N—0{̌ d /R@tN—0٫ d /^@u Nm0#6 d /`@wN;t  d /9w༩N;޴ d /@z@N{Ԗ;e d /^zN{Ԗ;S% d /@{Nm0[]W d /_{`Nm05R2 d /_@|N)ۖ;u d /9@} Nܖ0+ d /3 @Nm0? d /L ࿩NF0%V d /l@@N%0& d /  xNF2Tx6 d /4_N  3 d /`N  3KQ d /Np`/) d /n ©Np@ M{ d /zn©q  7n d /Y`zn©q / d /\@ n@é/@T d /mé v ' );Q d /gL@ĩ 6ɗ@ӟy d /x|`ĩ :': d /ĩ p'ߵt9 d /Iz ũ;rɴ=֙9 d /@{ũ;Gʧ$9 d /]{ũ;rɴ̰9 d /l |@Ʃ;rɴ9 d /`|Ʃ;ٚ59 d /Ӑ|ǩ;!N9 d /2I }`ǩ;!#9 d /}ǩ;&`!-c d /O} ȩVpΖ01e9 d / ȩws}h*:  d /-Yȩwm0 /# d /T  ٬@ɩx  d /Zɩ`nԋ d /@ʩ y  d /?`ʩNߖ@ӟ}p9 d /M@!ʩNڧ #Qm d /ɪ% ˩`&Ԗ@v2Ѫ9 d /@`{˩`+Ѫ9 d /4u`{˩`+Ѫ2Ij d / d /3@<ѩ`7pF 3+3 d /K=@ҩ`7"z 3  d /2K@>ҩ`7F 3l9 d /4ө`7 d /x``ө`7 ˖ڤG d /@?ө`7 0 P d /(@ ԩ`7 `7," d /(@Aԩ`7ҝ9 d /Aԩ`7И d s d /t@B@թ`7/pO d /"Dթ`7ɖ0w< d /E֩`70Als d /9"F`֩`70m d /+F֩`7ޖ0 d /F` ש`70A<; d /ׅ@Gש`7X0 o d /^@Jש;ܚ =O@ d /R6J@ة;`D = d /Jة;ܚ" d /K٩;  3 d /@K`٩; 3 ٞ9| d /N٩;(I kw5 d /j ک' Ƞ/1}`ک' i d /H@ |ک ,^ٲXTW̘ d 3e)!@۩CخA9 d /۩#`P% d /ܩ#Ծ0mxn d /``ܩ#}0< d /ܩ#_0, d /K  ݩ#E0 d / ݩ#0W9 d /ݩNr9 d /J@ީx@`^Z; d /'@ީx:0"`9 d /ߩxnF` d /Hbq0  d /F @cJEh d /c@C:ȗ;# d /V[@Cdyk;9 d /| `Y^@j,9 d / `Yئ`c9 d / Y@9 d /  Yئ`kk  d /@< ;thbb d /@< ;'7 d / @@@<r`3H d /1П 'iZ d /^kW`7`y *ZXG d /@D`W`7  }8Ru d /O |@X , P@} lP *B d / P |X , 2}d ۷e  kh d /1 1Ƹe e 'fD6 d /oS|`Y, ~ B + d /. , p/dd~ B /d`d d /.# 3` ff ff d /Y|N 3` `f@f ffa/ d /Y|Z, y@ #`C  d /Z|@[, !u.2 W;Y d /(@Z|[, !r.2 @d3 d /"@\,,0 I|fw3 d /)\,,0''}9 d /(b]|\, @`n` 9"U d /Da ] @r[/ 6$ d /Xc] F  ʤ7W d /CY 3` rd`3d sd3di  d /$ Y 3` psd1d sdp1d? d / `Y 3` Ptd2d td@2dt d /wZew_' <Me *~# d /[@h@`_@< r@i PyC 0 d /@v`_` @r>* $? d /0w` `` r > !0 d /p@x`1 me  + d /ky`1 me P o&k d / @aps VI`#Ik d /+~ a  @ v d /eeb > !<-`N d /`e`b` n1 0Ye d /)@`eb` \쏑? d /Rk@ c@X Z .2 - d /`k@c@X uc n d /* ۬c  r@i /   d /2@@ܬ@d@ ^e  {l d /o@@^e RFR `RFR!  d /@@^e RGR RGR; d /l@`e3 _ } (h d /ܵe3 r /` 5` d /RK f3 r /` ` d /`f`B / cE d /`f`B  8`8% d /* @g 60`c05(" d /cpg ` C@i 4 d /%@ph r@i 05V3 : d /%p`h 05N1 _z d /*%ph 05Py5z  d /c@p i i C@i  d /dpi r@i Py5ΰ, d /i 05S=9ѷ$ d /.@@j t G1 TT&x d /0.,uj,% & )t d /b2(k( P `@ Q l d /`k(d P;*V(rS d /6(k( p`< #- d /7( l( P lP # d /D@l(ps g*%+ d /f{(z %H %o d /:(@m( 2}d ۷e H7m d /\@=(m(  Ha ~c d /@n(~`9y*`^(? d /`n(~`9*0`(ʹ d /+Bpn  \ d /)0@% ! @ 0 jb d /)Lo ps M   d /#@ #@ _ L d / ps pMM PMD d /s ps MM MM ? d /2Oe  ƹ: d /g`q !  bˆ d /N|q, V/ 7 d /l`   @& d /@ r Pbajq b b9 d /o@r $8w yj d /Rk` @s ~wp[$U$ kh d /1` Ƹe e 7y# d /cps ##3 Ngithub.com/MottainaiCI/mottainai-cli/vendor/github.com/MottainaiCI/vagrantutilNgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/pkg/mountNgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/pkg/poolsNgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/hashicorp/hcl/hcl/tokenNgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/pelletier/go-buffruneioNgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/spf13/jwalterweathermanNgithub.com/MottainaiCI/mottainai-cli/vendor/go.opencensus.io/metric/metricdataNgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/openpgp/errorsNgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/openpgp/packetNgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/ssh/knownhostsNgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/credentialsN*func([]*dynamodb.KeySchemaElement) *dynamodb.CreateGlobalSecondaryIndexActionN*func([]*dynamodb.LocalSecondaryIndexInfo) *dynamodb.SourceTableFeatureDetailsN*func(context.Context, *pubsub.DeleteSnapshotRequest, ...gax.CallOption) errorN*func(context.Context, pubsub.TopicConfigToUpdate) (pubsub.TopicConfig, error)N*func(map[string]*sqs.MessageAttributeValue) *sqs.SendMessageBatchRequestEntryN*func(ssh.packetConn, io.Reader, *ssh.handshakeMagics) (*ssh.kexResult, error)N*func(string, ...func(*endpoints.Options)) (endpoints.ResolvedEndpoint, error)N*func(string, []interface {}, *jmespath.treeInterpreter) (interface {}, error)N*func(string, func() (interface {}, error)) (<-chan singleflight.Result, bool)N*struct { F uintptr; h plumbing.Hash; pos int64; crc uint32; content []uint8 }N*struct { F uintptr; onCloseCalled chan struct {}; reconnect *grpcsync.Event }N*struct { lock runtime.mutex; free runtime.mSpanList; busy runtime.mSpanList } AnnotationBprotobuf:"bytes,1,rep,name=annotation" json:"annotation,omitempty" DependencyBprotobuf:"bytes,3,rep,name=dependency" json:"dependency,omitempty"  r `H`Hx HH6 d / `d% 5{ܣ6 d /' `d% 5{Mv6 d /r]3@ ƌƌe ƌƌݺ(6 d /6w@9ps p׊p׊ī@ ׊׊y6 d /3- @9#4 PՊPՊ~' ( ՊՊrx6 d /Bo @94-` dm ггiRX6 d /[<\@r@i qq05qqc6 d /c98e =j=j` +` P.@P.@6 d / ps <<:e <<O6 d /I` E ;; `;`;׽I6 d /-/  F ;;@ ;;0"6 d /N ps <<ye <<Bj6 d /֩ g ==~ ==`hc6 d / V/ 0%?0%? %?%??J6 d /ޫ )>+` @<@<%N6 d /ޥ@a&s 117 11 ]6 d /&s Ь1Ь17 11^s6 d /a&s P1P17 @1@1uϸ6 d /ϛ@&s 117 11$6 d / [&s P1P17 11EͲ6 d /D[&s P1P17 0101#k6 d /> 0@% 11y 11#k6 d />.~@s 22 p2p2շ6 d /Υ  +8RΪ6 d /M7X{ ] ] ]]:6 d /M7X{ ]] @]@]'6 d /"@N7X{ ]] ]]vX6 d /N7X{ ]] ] ]76 d /O7X{ ]] `]`]&T6 d /@`~` PpPp pPppPpn6 d / `ps SpSp 0Tp0Tp̓A6 d /L@&s нZнZ ZZ4=6 d /$Dz@T` 0Z0Z ZZzs6 d /~Z`N` @ߊ@ߊ pߊpߊ6 d /ZN pTpTЃ` `j`j.6 d /, N @T@TЃ` aa6E6 d / `N TTЃ` a a6 d /@%N SSЃ` ^^C6 d /!N Ѓ` ``i6 d /@@@O p܄p܄ o6 d / ;6s`VzztVPzPzn6 d /@©% xx'` @x@xS6 d /Y©%a0w0w'` 0w0w>? e6 d /)@T xxC x x ?6 d /G R6hs PvPv vvpN6 d /`R6v vv 0v0vwz6 d /Q S6hs vv 0v0vW6 d /xm0 ps ` ppd6 d /x ĩ N TTz `T`Tji6 d /q ;5  @ v$6 d /;.`; @* H6 d / ;5  @ J^6 d /{@;` @, ``ˈz6 d / + ||r`o 0|0|gL6 d /VjS/hs` || p|p| j;6 d / Ǯw- OP-P-L ! `6`6k Pj6 d /0Y9@ P@}P@}3v ?}?}6 d / Tse p-}p-}P`- -}-}`<6 d /bbNse +}+}P`- P,}P,}ы6 d /T +}+} p+}p+}Je96 d /4`+|{ ThThyj 0Uh0Uhvv6 d /C1`+ ! GhGh8]e GhGh"j6 d /hs A {h{h xhxh 6 d /L7+e &h&h5@ %6 d /n+e (h(h5@ Row6 d /t 5`8C XVXVv XVXV6 d /Zr@i kJkJPy5jJjJz6 d / r@i pjJpjJPy5gJgJjq%6 d /n7 'ue KK@ KK֤6 d / '@` pKpK@ 0K0Kw$z6 d /(`U 'C/e ХLХLe 0L0L6 d /n '@` ~L~L@ 0wL0wL:>6 d /RIخ '@LL@ LLsR6 d /p ٮ 'WLL@ LL_I6 d /(' 8 '@` LL@ @L@Lw6 d /n 'r@i `L`L05LL6 d /!` 'r@i LL05pLpL`6 d /Щ0' `LW`LWPy5LWLW8J(6 d /0 0' @W@WPy5@>W@>Wha6 d /yڮ`7 })X)X8R2X2Xy 6 d /P ?`7>`X`XipXpX]6 d /x ө`7>XXiXXՃM=6 d /:k` `705WWPy5WW}6 d /``73 PLXPLXS MXMX4uT6 d / "ബ`73 @,Z@,ZS -Z -Z!6 d /o`7r@i ~Y ~YPy50Y0Yv6 d /Qi`7 }XX8RXX6 d /J' oZ oZ~` rZ rZ6 d / $ U , papay@i aa*46 d /1X 1Ƹe e hb6 d /w޲Cr @wc@wc0xc0xc6 d /@, (d(d~ B )d)dm6 d /.Y, p/dp/d~ B /d/d%6 d /X_?E! PNiPNi2@i MiMiyz!6 d / @/ `N1`N1_2 N1N1C6 d /* r@i ,,Py5,,A6 d /.Y# 3` f f ff6 d /Y|@ZN 3` `f`f ffCU66 d /)i९,y@ 0e0e#`C ee3 }6 d /Ji`,y@ ee#`C `e`e>h6 d /LbK, `e`e eeƵ6 d /D,@r[$e$e/ %e %ecIu6 d / , ee&e ee 6 d /lC@r[PV`PV`/ X`X`WM}a6 d /C]Y 3` rdrd sdsdl6 d /$ ^Y 3` psdpsd sdsd!Y_6 d / `^Y 3` PtdPtd tdtdx6 d /j`E1 ;;Pu z;z;8w6 d /@<7 dd0 ٤_6 d /&`E@<r@i ddPyC pdpd}Xc6 d /a #1)o`o`+̘p_6 d /h1| ``0 ;\g6 d /=s@i 0b0bPy5PbPbԸ6 d /)`%=<I'6 d /8 S=) 8b8b 8b8b9"6 d /^0@r>0Bc0Bc* GcGc#" 6 d /`GB@r>dcdc* dcdc$`I6 d /0 1me aaP aaNk6 d /]`1me aa aa6 d /+1me aa @a@aҡ6 d /Q, 1me papaP aaa6 d /k1me 0a0aP `a`a=6 d /`1me aaP aa(a6 d /)1me aaP aa2}l6 d /1me a aP PaPa6 d /t1me aaP aa%6 d /Ju@<ps `Q?`Q?q4@P pR?pR?E6 d /`.,(88@88'k6 d / YDe \\ \\ld6 d /^1@ p[Op[O` u @ZO@ZOʖ6 d /'@^e II `I`I 6 d /]`yH O O05`/O`/OCH6 d /<*@Xq OOj @O@Ov66 d / ] r@i pISpIS/ `GS`GS6 d /u@6 r@i JS JS/ ISIS7b6 d /q`q J II`I`Ig6 d /g7-`SSps SSwE h6 d /3(e SS1 S SQz6 d /8_ SSPy5SS#D6 d /ū905"T"TN1 _0#T0#Tg06 d /0@<2Z pNQpNQ.2 NQNQDc"#6 d /J'@r RR@i ׼6 d /a=@ps@i /R/RH` 0R0R56 d /o`d@^e RR `R`R&q6 d /@d@^e RR RR(6 d /@^e pRpR иRиR66 d /$`ps PUPU'B U U]6 d /ک 8UU`8PUPU 6 d /PjZaUUaUU.6 d /*`CZ 8}U}U`8|U|UN%`6 d /`B UUG  U U56 d /pBt P#UP#U I "U "U" 6 d /B=A p aUaU cUcU/ 6 d /*wr@i JJ05JJ6 d /k@xr@i JJPy5JJjq6 d /o`r@i `J`JPy5JJK6 d /$,x=r P*JP*J TJTJ6 d / d@ O/@i E E8x DDhe"6 d /Dd Py5??@@6 d /৯r@i 05(86 d /e Py5!!z@i ̀6 d /.m,,%1` pp 6 d /&DZ,%q J8 QD6 d /,%@<p<  @6 d /H v,% e PPaM6 d /:&`ĵ,%  MM ||X 6 d / l,%! `` 99kh6 d /j )(~e '' @'@'u6 d / (r@i $$05P$P$!؟+6 d /n(r@i @'@'05''bC`6 d /ܢ(V/ 09*09* 9*9*_]6 d / (r@i @{)@{)05y)y)J6 d /0{S(UG$dq6 d /)X( D*D*y@i E*E*QE6 d /c( e*e*Ha f*f*;rH6 d /b@W(- f*f*2 f*f*O6 d /f{l(z H k8p6 d /(r@i ''05'' 6 d /a`( h*h*Ha i*i*׮6 d /P  (ps 0k*0k*n k*k*uu6 d /(r@i 9&9&05:&:&sT16 d /өਯ(r@i q*q*05pq*pq*76 d / `( q*q*Ha Pr*Pr*(E6 d /uY( 0'0'Ha ''#6 d /H੯( r*r*Ha s* s*"6 d /i`+()>+*'*'uHp6 d /{-( s*s*Ha t*t*DV6 d /( t*t*Ha t*t*ub6 d /  Y( Pu*Pu*Ha u*u*V6 d /cY(R6 d / p(r@i ''05''O6 d /Zc(& `{(`{( {({(lA&6 d /i(8@i 0(0(`e 26 d / `N2e z=6 d /S@@r@i P:P:05::9 Z6 d /I`r@i `:$`:$Py5p8$p8$6 d /% ~!~!x |!|!ت6 d /`  ps vv e `w`w 6 d /@] ps ww e `x`xq6 d /)0n% ! 0 0 \6 d /e 9zط6 d /h б6 d /wps JJM IIcy6 d /o#@ #@ DZp6 d /pps  M  =yB6 d /h``ye x6 d /i -838zg>6 d /{)ɵT od6 d /^  ',(@ PdPd4pbpb 6 d /'ypp6966 d /W2++@k6 d /|sx6007@  6 d /s`pps M R56 d /u2`my@?@?"5//"~6 d /X2++ 6 d /n0@ P.P.撚6 d /2pOe ]6 d /w  +67ژ.v6 d /p @6 d /tqy))P4 D6 d /X2++6 d /qw3 P&P&NQ6 d /> Y2++;(6 d /@`sH @@ <'6 d /  !  b =6 d /+Py5  .%6 d /X !  b A;6 d /u ! ` `  b  B?A6 d /Kv ! P P  b` ` ISp6 d / ar@i HH2@i HHWR6 d /ar@i **05**aCI6 d / _V/ hh 0h0hhQE@6 d /`V/   t6 d / `V/  Y#6 d /KV/ ,, ,,DTX6 d / `V/     _]6 d /nv,V/ @@ /6 d /]Y,V/  6';6 d /llw,V/ .. 0.0..6 d /R 1,V/ -- --s(6 d /@ٱ,V/ 0)0) `)`)~46 d /@ 0bO/ 8x@ 6 d /lq   @@w6 d /} / _2  6 d /} / _2 ``_6 d /xe pEpE EEuI^6 d /^o,8w, vv1e uuV6 d /@r r PbPbjq bb~s6 d /n $8w a6 d / $8w ДДb6 d /Y@ $8ppw oo5+6 d /f $8qqw qq6 d / $8vvw PvPv 66 d /E= $8@x@xw xx 6 d /_=ɳ $8zzw yy-p-6 d /y=  $8  w  ^6 d /=` $8w *46 d /1`s` Ƹe e 6 d /ӣ bps # #3 ]lJX6 d /csps ##3 C6 d /* 8 r@i 0n#0n#Py5j#j#Qgithub.com/MottainaiCI/mottainai-cli/vendor/cloud.google.com/go/internal/optionalQgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/aws/awsutilQgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/aws/requestQgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/service/sqsQgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/golang/protobuf/ptypes/anyQgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/hashicorp/hcl/json/scannerQgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/opentracing/opentracing-goQgithub.com/MottainaiCI/mottainai-cli/vendor/go.opencensus.io/internal/tagencodingQgithub.com/MottainaiCI/mottainai-cli/vendor/golang.org/x/crypto/internal/chacha20Qgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/api/support/bundlerQgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/encoding/protoQgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/utils/ioutilQ*func(*dynamodb.CreateTableInput) (*request.Request, *dynamodb.CreateTableOutput)Q*func(*dynamodb.DeleteTableInput) (*request.Request, *dynamodb.DeleteTableOutput)Q*func(*dynamodb.ListBackupsInput) (*request.Request, *dynamodb.ListBackupsOutput)Q*func(*dynamodb.ProvisionedThroughput) *dynamodb.CreateGlobalSecondaryIndexActionQ*func(*dynamodb.ProvisionedThroughput) *dynamodb.UpdateGlobalSecondaryIndexActionQ*func(*dynamodb.TagResourceInput) (*request.Request, *dynamodb.TagResourceOutput)Q*func(*dynamodb.UpdateTableInput) (*request.Request, *dynamodb.UpdateTableOutput)Q*func(*sqs.RemovePermissionInput) (*request.Request, *sqs.RemovePermissionOutput)Q*func(*sqs.SendMessageBatchInput) (*request.Request, *sqs.SendMessageBatchOutput)Q*func([]*dynamodb.ReplicaSettingsUpdate) *dynamodb.UpdateGlobalTableSettingsInputQ*func(context.Context, *pubsub.ModifyAckDeadlineRequest, ...gax.CallOption) errorQ*func(description.SelectedServer, wiremessage.WireMessage) *command.CreateIndexesQ*func(description.SelectedServer, wiremessage.WireMessage) *command.ListDatabasesQ*func(uint64, int, bool, *strconv.floatInfo) (strconv.extFloat, strconv.extFloat)Q*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.AcknowledgeRequest }Q*struct { F uintptr; seen map[plumbing.Hash]bool; result map[plumbing.Hash]bool }CheckDuplicateAjson:"CheckDuplicate" yaml:"CheckDuplicate" toml:"CheckDuplicate" / d /hmK3aʉd dF F_d eFP F z]0 d /}K30 @JJs@ JJ 9 d / O`&hs` J PK e0! d /P3O `УF&  ;LTK d /QGO `F& @ ). d /Q`&O F& 0@6 5 d /o`O00Lx` qq-5 d /uh 0`8P&5 d /in0'zN~@i RRA5 d /vuo&ҟ) @Oj&jn 3 d /7@r6 ``B 9s`Vyyb3 d /Us6 ε` 9tV0y0y  d /~ ||r`o 0||%:3 d / { @@@`W0}0}>'\3 d /RB[,00[ IM 3 d /\,00'' \ On d /.m3,%1` p P }t d /{`X( s* 'Ha t* ' u\|F d /?{-p3H`&p Ţ :64 d /t-p3hp #ő d /X3P.p3x@\`  uj d /߿.p3?@W N d //p3HΖ@?@B d /'4p/p38txN d //p3t8t > d /+00p3tp#+ d / Ԗ0p3̖p@QY( d /A c0p3,yr 5 X3 d /Il cP1p3r@p` . d / c1p3p K\{@ xs d /J5 c2p3p Kb{,4 d / cp2p3ypQ Q! d /H`-2p3p`\{ $-M d /`-03p3p]\{`V UWW d /p8`-3p3p]\{ ld  d /R`-3p3p]\{ ] d /F`-P4p3p]\{`& ]x d /<`-4p3p]\{`\ %J d /_`-5p3p]Bۢ d /D جp5p3`3 N4 d /5p3b{dyœ }F  d /k(06p3p`)0AL d /{6p30ۗ0q  d /K6p30L[ ?* d /" P7p3pp K0 d /b7p3p@T; $s d /n8p3*s ; S * d /z8p8p3̖p@N jk! d /z@98p3pgX<0ߘ\ d /+|@909p30.@ 3 d /9p3 |``0E%k d /@o9p3pqr@6Q d /l4P:p3t$h@ 3 d / .:p3 |`0E%k d /p .;p3pqr !R^ d / .p;p3t>s๪ Oٰ d /@C@/;p3p๷P_.rJ d /((0<p3p*3' v d /<p3p[P_ } d /:c<p3p˖Ź  d /@zP=p3xx@Y  d /LA@z=p3p@Y@ǜ '@ d / @z>p3p@YΖ p P d /w @zp>p3rz`&`z`& & d /0B@z>p3Fܘ pz p  2 d /7@z0?p3p@Yp@Y  d /6z?p3&Ζ /V d /4+{?p3pNdyœ NZK d /gq]P@p37'&{`! d / o@p3p,p`& .n d / oAp3pp`& z4/ d /*pAp3p dy   d /bAp3 rȹp  d /@0Bp3ppp& \+ d /(Bp3pyx~ _  d / [`Bp3-ȉ`&id  d /cr`PCp3p@{Җ` q(> d / |Cp3px 뚓M d /|Dp3R|@t( 1k d /epDp3dypݪ W] d / Dp3qp0 wp d /|0Ep3q@B  w9* d /:@s|Ep3q@(m`; k*r d /|Ep3rsvo d /|PFp3p'9@ ޳ d /[+@t|Fp3P^@(m`;O d /- Gp3yҟr ' K d /`)pGp3yҟ ' 8" d /Gp3p`;h{ w d /f|n0Hp3ydyœ L # d /Hp3ә )} ) 1ݗ d /%JtHp3ZFp@R C4 d /PIp3p 3p@R D[ d /Ip3p@R˜œ c9 d /JJp3p@Rp} d /(@upJp3p@Rp U Q d /JeJp3p B1ş d /% 0Kp3z̖0 d /`Kp33t@\{Kc. d /Kp3Ldyœ # d /aPLp3V@q`  m d /&Lp3VFq ?P d /AMp3V`Gq q d /$pMp3V`Jq # d /`Mp3kY d /{0Np3r 9pl !h d /R+Np3p>põ  d /(Pp3px  d /3x(0Qp3`P@ @  d /(Qp3s`+œ W d /8(Qp3s`왗z yN d /Ix(PRp3Vt~z K]4 d / W(Rp32@ x d /@ySp3sTpྷ6a d /rypSp3p@sT ;R d /{ԖSp3Ģ{ 3~ d /ƵԖ0Tp3 q{0 JԦ d / ԖTp3k@p G&s d /ԖTp3kp0 ;< d /ԖPUp3kp E{ d /0*ԖUp3kp0 ʍN d /VVp3䂖@h{& aQ d /pVp3pj{p \q] d /`&Vp3Pʖ@y y d /0Wp3̖@\x3 h^ d /Wp3rx   d /GWp3ry(G d /PXp3r: ' KC d /Xp3rPr`& p`dQ d /Yp3$& _6 d /lpYp3 3 3 =/ d /Yp3p 4ph hB d /M0Zp3sVt3j d /Zp3@g@ Kd d /Zp3{&p@> - d /d*P[p3`t3x KT d /[p3{3y o  d /xm\p3Lp&|ic d / |p\p3p@vpB Epe d /p" |\p3pҟp`& " d /Ľ |0]p3p@p0  W] d / []p3qp0 k2P/!]Ֆ@df z d /V@hP^}0 ( /G d /&h^–0  ( 2 d /h_4pXp tp,/Uzp_ٖ; )0`—0ō׋/{_04pXpwm d /|0`0Yq0:v   d /4|`0HƖŘ((@ /}`0R 'XÖ; ko/Pa`3S`3J`3 譖/ a 3`3Ö`3 U!X/br3`0 jJP/ @^pb䂖3z`&x`& Sh/mb`&`&流;_s d /0cp'(|0p@ c d /WcӖ`&Җ #  pX/ tc]3t3t34(譖/+Pdۆ` "kpk 'P/dۆ` `W?`WZt#譖/ue 3 `3ϖ`3 /|pe  wpDdy jJP/ e䂖3z`&x`& El^ d /;! M#3@ Xse }7 0{Rgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/internal/iniRgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/pkg/fileutilsRgithub.com/MottainaiCI/mottainai-cli/vendor/go.opencensus.io/metric/metricproducerR*func(*dynamodb.CreateGlobalTableInput) (*dynamodb.CreateGlobalTableOutput, error)R*func(*dynamodb.DescribeEndpointsInput) (*dynamodb.DescribeEndpointsOutput, error)R*func(*dynamodb.UpdateGlobalTableInput) (*dynamodb.UpdateGlobalTableOutput, error)R*func(context.Context, *packp.ReferenceUpdateRequest) (*packp.ReportStatus, error)R*func(context.Context, *pubsub.DeleteSubscriptionRequest, ...gax.CallOption) errorR*func(description.SelectedServer, wiremessage.WireMessage) *command.DropCollectionR*func(float64) *dynamodb.AutoScalingTargetTrackingScalingPolicyConfigurationUpdateR*func(map[string][]*dynamodb.ItemCollectionMetrics) *dynamodb.BatchWriteItemOutputR*struct { Current uint64 "json:\"current,omitempty\" yaml:\"current,omitempty\"" }R*struct { F uintptr; connPool *http.http2clientConnPool; t2 *http.http2Transport }R*struct { F uintptr; cs *http.http2clientStream; resc chan error; body io.Reader }R*struct { F uintptr; srepl *string; repl []uint8; re *regexp.Regexp; src []uint8 } AuthorityGprotobuf:"bytes,3,opt,name=authority,proto3" json:"authority,omitempty" SnapshotsGprotobuf:"bytes,1,rep,name=snapshots,proto3" json:"snapshots,omitempty" TimestampGprotobuf:"bytes,1,opt,name=timestamp,proto3" json:"timestamp,omitempty"Sgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/aws/endpointsSgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/aws/signer/v4Sgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/golang/protobuf/ptypes/emptySgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/sergi/go-diff/diffmatchpatchSgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/bson/bsonrwSgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/backoffSgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/syscallSgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/hlandau/passlib.v1/hash/argon2Sgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/hlandau/passlib.v1/hash/bcryptSgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/hlandau/passlib.v1/hash/scryptSgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/cacheSgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/storage/memoryS*func(*dynamodb.AutoScalingSettingsUpdate) *dynamodb.UpdateGlobalTableSettingsInputS*func(*dynamodb.BatchGetItemInput) (*request.Request, *dynamodb.BatchGetItemOutput)S*func(*dynamodb.CreateBackupInput) (*request.Request, *dynamodb.CreateBackupOutput)S*func(*dynamodb.DeleteBackupInput) (*request.Request, *dynamodb.DeleteBackupOutput)S*func(*dynamodb.ListTablesInput, func(*dynamodb.ListTablesOutput, bool) bool) errorS*func([]uint8, []uint8, []uint8, ssh.directionAlgorithms) (ssh.packetCipher, error)S*func([]uint8, string, ssh.packetConn, io.Reader) (ssh.authResult, []string, error)S*func(context.Context, *dynamodb.DescribeTableInput, ...request.WaiterOption) errorS*func(context.Context, *packp.UploadPackRequest) (*packp.UploadPackResponse, error)S*func(context.Context, interface {}, ...*options.RunCmdOptions) *mongo.SingleResultS*func(description.SelectedServer, wiremessage.WireMessage) *command.ListCollectionsS*struct { F uintptr; iter *object.storerCommitIter; cb func(*object.Commit) error }S*struct { F uintptr; m *interface {}; hdr []uint8; payload []uint8; data *[]uint8 }S*struct { F uintptr; size *uintptr; needzero bool; noscan bool; s **runtime.mspan }AckIdLprotobuf:"bytes,1,opt,name=ack_id,json=ackId,proto3" json:"ack_id,omitempty"ActionsJlocationNameList:"ActionName" type:"list" flattened:"true" required:"true"AliasesJjson:"Aliases,omitempty" yaml:"Aliases,omitempty" toml:"Aliases,omitempty"CapDropJjson:"CapDrop,omitempty" yaml:"CapDrop,omitempty" toml:"CapDrop,omitempty"CommandJjson:"Command,omitempty" yaml:"Command,omitempty" toml:"Command,omitempty"CommentJjson:"Comment,omitempty" yaml:"Comment,omitempty" toml:"Comment,omitempty"CreatedJjson:"Created,omitempty" yaml:"Created,omitempty" toml:"Created,omitempty"DevicesJjson:"Devices,omitempty" yaml:"Devices,omitempty" toml:"Devices,omitempty"ExecIDsJjson:"ExecIDs,omitempty" yaml:"ExecIDs,omitempty" toml:"ExecIDs,omitempty"FailcntJjson:"failcnt,omitempty" yaml:"failcnt,omitempty" toml:"failcnt,omitempty"GatewayJjson:"Gateway,omitempty" yaml:"Gateway,omitempty" toml:"Gateway,omitempty"IpcModeJjson:"IpcMode,omitempty" yaml:"IpcMode,omitempty" toml:"IpcMode,omitempty"LogPathJjson:"LogPath,omitempty" yaml:"LogPath,omitempty" toml:"LogPath,omitempty"LxcConfJjson:"LxcConf,omitempty" yaml:"LxcConf,omitempty" toml:"LxcConf,omitempty"NetworkJjson:"Network,omitempty" yaml:"Network,omitempty" toml:"Network,omitempty"NetworkJjson:"network,omitempty" yaml:"network,omitempty" toml:"network,omitempty"OnBuildJjson:"OnBuild,omitempty" yaml:"OnBuild,omitempty" toml:"OnBuild,omitempty"OptionsJjson:"Options,omitempty" yaml:"Options,omitempty" toml:"Options,omitempty"PgfaultJjson:"pgfault,omitempty" yaml:"pgfault,omitempty" toml:"pgfault,omitempty"PgpgoutJjson:"pgpgout,omitempty" yaml:"pgpgout,omitempty" toml:"pgpgout,omitempty"PidModeJjson:"PidMode,omitempty" yaml:"PidMode,omitempty" toml:"PidMode,omitempty"PreReadJjson:"preread,omitempty" yaml:"preread,omitempty" toml:"preread,omitempty"RetriesJjson:"Retries,omitempty" yaml:"Retries,omitempty" toml:"Retries,omitempty"RunningJjson:"Running,omitempty" yaml:"Running,omitempty" toml:"Running,omitempty"RuntimeJjson:"Runtime,omitempty" yaml:"Runtime,omitempty" toml:"Runtime,omitempty"ShmSizeJjson:"ShmSize,omitempty" yaml:"ShmSize,omitempty" toml:"ShmSize,omitempty"SysctlsJjson:"Sysctls,omitempty" yaml:"Sysctls,omitempty" toml:"Sysctls,omitempty"TimeoutJjson:"Timeout,omitempty" yaml:"Timeout,omitempty" toml:"Timeout,omitempty"UTSModeJjson:"UTSMode,omitempty" yaml:"UTSMode,omitempty" toml:"UTSMode,omitempty"UlimitsJjson:"Ulimits,omitempty" yaml:"Ulimits,omitempty" toml:"Ulimits,omitempty"VolumesJjson:"Volumes,omitempty" yaml:"Volumes,omitempty" toml:"Volumes,omitempty"WaitTimeSecondsByaml:"receive_wait_time_seconds" envconfig:"SQS_WAIT_TIME_SECONDS"WorkDirJjson:"WorkDir,omitempty" yaml:"WorkDir,omitempty" toml:"WorkDir,omitempty"Tgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/api/types/mountTgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/api/types/swarmTgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/channelzTgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/grpcsyncTgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-billy.v4/helper/chrootTgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/objectTgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/storerT*func(*dynamodb.AutoScalingSettingsDescription) *dynamodb.ReplicaSettingsDescriptionT*func(*dynamodb.DescribeTimeToLiveInput) (*dynamodb.DescribeTimeToLiveOutput, error)T*func(*dynamodb.ListTagsOfResourceInput) (*dynamodb.ListTagsOfResourceOutput, error)T*func(*dynamodb.TransactWriteItemsInput) (*dynamodb.TransactWriteItemsOutput, error)T*func(*sqs.ChangeMessageVisibilityInput) (*sqs.ChangeMessageVisibilityOutput, error)T*func(bool) *dynamodb.AutoScalingTargetTrackingScalingPolicyConfigurationDescriptionT*func(context.Context, description.ServerSelector) (*topology.SelectedServer, error)T*func(context.Context, interface {}, ...*options.FindOneOptions) *mongo.SingleResultT*func(context.Context, interface {}, ...*options.FindOptions) (*mongo.Cursor, error)T*func(context.Context, string, interface {}, interface {}, ...grpc.CallOption) errorT*func(description.SelectedServer, wiremessage.WireMessage) *command.AbortTransactionT*func(description.SelectedServer, wiremessage.WireMessage) *command.FindOneAndDeleteT*func(description.SelectedServer, wiremessage.WireMessage) *command.FindOneAndUpdateT*func(map[string][]map[string]*dynamodb.AttributeValue) *dynamodb.BatchGetItemOutputT*struct { F uintptr; artefactPath string; t *agenttasks.Task; pos int; b3 *[]uint8 }T*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.DeleteSnapshotRequest }Ugithub.com/MottainaiCI/mottainai-cli/vendor/github.com/RichardKnop/machinery/v1/retryUgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/RichardKnop/machinery/v1/tasksUgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/aws/credentialsUgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/emirpasic/gods/lists/arraylistUgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/hashicorp/golang-lru/simplelruUgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/opentracing/opentracing-go/extUgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/opentracing/opentracing-go/logUgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/bson/bsontypeUgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/mongo/optionsUgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/binarylogUgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/envconfigUgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/transportUgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/revlistUgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/utils/merkletrieU*func(*dynamodb.ContinuousBackupsDescription) *dynamodb.UpdateContinuousBackupsOutputU*func(*dynamodb.DescribeTableInput) (*request.Request, *dynamodb.DescribeTableOutput)U*func(*dynamodb.UntagResourceInput) (*request.Request, *dynamodb.UntagResourceOutput)U*func(*sqs.DeleteMessageBatchInput) (*request.Request, *sqs.DeleteMessageBatchOutput)U*func(*sqs.GetQueueAttributesInput) (*request.Request, *sqs.GetQueueAttributesOutput)U*func(*sqs.SetQueueAttributesInput) (*request.Request, *sqs.SetQueueAttributesOutput)U*func(*transport.Endpoint, transport.AuthMethod) (transport.UploadPackSession, error)U*func(description.SelectedServer, wiremessage.WireMessage) *command.CommitTransactionU*func(description.SelectedServer, wiremessage.WireMessage) *command.FindOneAndReplaceU*func(int64) *dynamodb.AutoScalingTargetTrackingScalingPolicyConfigurationDescriptionU*struct { F uintptr; buf *bufio.Writer; w io.Writer; bufPool *pools.BufioWriterPool }U*struct { F uintptr; cancel chan struct {}; rt http.RoundTripper; req *http.Request }U*struct { F uintptr; ow *git.objectWalker; los storer.LooseObjectStorer; err *error }U*struct { F uintptr; owned bool; header http.Header; excludeHeader *map[string]bool }U*struct { F uintptr; r io.Reader; bufPool *pools.BufioReaderPool; buf *bufio.Reader }U*struct { F uintptr; s *ssh_config.sshLexer; previousState ssh_config.sshLexStateFn }ContinuousBackupsStatusQx/YO0f@0(Ӗ23V d /+0f0(ϖk6`&  O|Y d  CPfP(p&&0 d /d@-Pf`P(2z2j/$@PPfP( 2)&wt d /PPf P(p| 3&Ka/@+!pfp( z`&(P d /2`@t@$(Lyxq# d /S`+@`( `y `y ͷ$ d /A<U`+`(Bz`3ʅ`3U譖/"_V`$(R tp ( d / @V``$(苗}xpD)e d /8V(dphppb d /@X $(}~xŖ d /hM$(\`&}~1 d /)1$(Xp4p`&fN d /-@Y@$(0?een| q d //[t$( Ns`y w r  d /.wt$(D{eP#E d /A`t`$(D{  d /Zw@\$(dphpφ d /аt $(D{k7/pwt$(ϖ낖 ls  d /t$(D{nl d /`t@$(D{Ж04s d /yt$(D{z'l/ t$(\i낖 0(( d <1@_`b(Hږ`' r2  /%_b(C;3`&s d /@` b(qH;g{y d /]8`b(dphpZC d /@aࠫb(dphpLE d /b@b(Xp4p`& 0Qm(/Ӹ@cb(Ζ00((/n! 0.cb(PQ"(0(S1 d <1d`Б(DE`'YrX+ d /@dБ(.`'ɖ' h;Lh/a (0hqʒM d /`"@-(`&l d /q"i࣫(͖r6`&L̡ d /"@@(   /"k(0hq&/"(ࢫ}P d /b `(ࢫÖ M/S:(.u/L`:+ (~z0_ۖ 'Ȑ/;(ɖ 9w0 \f d /h@<+ফ(s  K d /m+@(;;G? d /"+(Ֆ   Q pА/I >+(p 9p01K[ d /k>+`(tXa@tO\/o(ਫɖ0  j/p (ǖ0Ŗ0 / A(v0A`&ga d /T੫(pྸҖ@[1{ d /q@(u*G3 d /FT' PPy /_@r(:v0ɖ}] d / !s|`,(}7e ~'  8/]@U (00 @/2l` 6(p@:0Y0. d /Nly6(%Q~'`S2@; ) d //Cଫ (0f~" C`/U c@ (p``0{ d /'D c (p`c<#Z d /pz (ٖ": O d / @E c` (p`c' d /{ c (~z`b{ 2ؑ/} (i0җ0 4  /f`#(/0.00/@௫ $(A0pÖ| d /g+@(9F H/M"(. ?%  d / W``d(7@ 5K0P/<`3(Ֆ` y mh/@@3(Ֆ`b0=s d /ծ @9((ĖaԜ J d /J@9(dL0hȖ/@ಫ@9(U06ә' ]/LL@@(ږx > d /P(:v0,E Υ <//(xG0]0,$r1)P@`@(t՘ }rz`&P0$՞aO1@@(t՘ }rzBPq& d /β@6!@ @(͆  _bq d /@(0;qT( d /@൫@(: ?` < [x(/\@@@4(sv{j ! d /k=:(`0 O ΋ H/,0(ś#; I d /@`0(01" RC[P/m0(k ' s80y~7 d L1J @A(́ɲdRX ㏉5 d /~5@ 1(0xD"|/p@ห 1(0ߚ ' vx@ d /@ 1(01" Se d /u 1(`ܚ@ t2/y 1(~003 d /"` 1({XK@zY' d /5 1(^/@ MЖ/x  1(ߖ0"0 e2/ 1(0ߚ0xp d 4໫ 1(1z@ `/n@ 1(ۖ0|0 ZF/6l 1('0E0 5/ʆ 1(00  d /@` 1(@i d / 1(   d /6@  1(ҡ d P9?@ 1(—P@ຫ> d /ݞfྫ(7O;~Q d /|@@@@A(@a@r d /_@:(͆ h͖`&pa} d /Z ":(-@ӟ`&\  d /Ac!`5(͆ (it d /55(h͖`&  d /"x ((' - d /_@~.(t 3̖ 3 ݈D d /@(g0J" 6ȆEx/!@«@(0hگ0/!@«@(Y0cZ ' x(/bë@(Y00 W=/ڞ`ë@(y0,0 뷲/Që@(/01Rȗ/4 ī@(Q 0d %藖/ī@(Û0ě0 urO/`Rī@(wޖ`&0 -B  d /b@ū@(y0fx"HI d h7`oū@(ȗ VdH<<GU d 1{oƫ@(2ʗdh  /q@`ƫ@(|0,0 @0/ƫ@(Ö;d ۰L d /= ǫ@(Dd ^G d /Ҵ ǫ@(Dd Q d /oǫ@(Dd IT d /Z@@ȫ@(Dd 1 d /ȫ@(Dd n d /oɫ@(Dd  b d /w`ɫ@(Dd z d /,ɫ@(}0ڇ" d /@d ʫ@(cq`Ʒ,ɒ `/Sʫ@(Yq0u7ph/=Sʫ@(Yq0u Pp/zU@˫@(P0—0s\x/L"`U˫@(Yq0uƁ/U̫@(Yq0u/ͣ V`̫@(Yq0uKP./HV̫@(Yq0u/a"V ͫ@(Yq0u d />ͫ@(,@措0׉v d /"ͫ@(:&& F/c@Ϋ@("0ș0 +s d /[Ϋ@(DdQ d /[ϫ@(K@ ' } d /`ϫ@(Dd$ d /@ϫ@(`F@ ' > d / Ы@(Dd a d /Ы@(Dd((; d /@Ы@(܏@ 'OrA#/9@ѫ@(0dOKx/@ѫ@(0d5@j蘖/Cҫ@(0d9"/`ҫ@(0d )6/xҫ@(y0z`& 23R d /s  ӫ@(}0Ɖ@ E#+ d /^ӫ@(/0Rٚ@ ->P/ӫ@(&լ 'y`&O d /h@@ԫ@(ޖ@Rd  d /Bԫ@(y0`{"? d / @@9ի@(1! 7e Py5 nX/X`ի( V`&0dIh d /k9ի(1! 7e Py5CE d / ֫w(Yؖ2Hɖ2 ! d /k@@֫@/(`0O]~ d /@֫(Ȗ&u&>k d /(@׫( 8w  d /ѱ׫(;I;? d /N@ث(('V d /`ث(@ 1 ` u ڝ g d /ث(@ҟCgt d /N ٫(`̖) rP/g٫(A 'lz& /@٫(#`̖&7 d />@ګ(} Qt/@ګ(d`̖)  d /h۫(/ҟB<  P/`۫(A 'lz&]~ d /۫ (Ȗ&u&>k d /( . ܫ ( 8w  d /ѱ@ܫ (;I;? d /N@ܫ (('ڝ g d / .@ݫ (ҟCgt d /N .ݫ (`̖ *@ / .ޫ (#`̖&7 d /A`ޫ (}" Qtș/ .ޫ (d`̖ *  d /j . ߫ (/ҟB< a d /@߫-(~w`&–`&x] d /<\.߫(pp@(f{ d /@(@ǖ E~,$u1I d D0 " _( ʖ@q~/``:(z'Ӗ'@<x߹ d 1*`D(`̖`³p| 9h*O/@` .(vVu(͡EP/ a (p`xWX/ b(p@x {r`/ (p`&dyl d /b`@`(@Ӗ?;"hp/<`(Xp`&hW; // N(ŖHJƨ  /b >! ` N(0 $uXD d /@ ;(;ј;}Q d /tr   ;(̖&& d /( @ߖ@@<K6: d 1 m@:(`̖`³p| 9h\{/Ut@@@/(2x`޵y rb d /p@(|Xז@(x\ d /jn( `U ' (/H@`(Mz;u d /_mu%(p&`&  d /@ /(e#;;  X/-/(z0w  }x/Т(.`  0:O d /n@m@(`&@G:O d /nm(`&G I*</c(ۆvC-;< d /@pv`&(z@6z@Bʮ d /Pz*(~' .2  ]?/z *(Ӗ@;ɜ/z*(Ӗ; 2ԇ/Mz*(͖H/0HP d /\z@*(}7e ~' ?/`z*(Ӗ@;E/o`z*(Ӗ;Kl/M`z`*(Ӗ; c/Nz*(Ӗ;A|2ț/!N`z *(Ӗ|;ꯚ}Л/Ez*(Ӗ};؛/z*(Ӗ;H d /@+(ɖpÖ+CN d /<@{+(%`Q@y`Q Q ʉm/ ] (H͖00'F d /` (}`&Ö g%/vN(s(0 #0ބN d /@ N(>%/}  : /TN({Ԗ;ܖ0 ((/ @N( ė`3>u;Ye0/ @N(xǖ3ɖ& o@/~ZwN(s(0 #0 =gX/v@rN( ė`3}!; `/r`N(—0ږ; ȠA/xN( ė`3;*` d /Z`w N(F2&} d/@ !(20PŖ`&[ d /O@ q !(?dy0 07/@0@(0r`t`B F/0(Irεt`DN / 6(pt ͨ(/? `6(ptͨ)P/} 6(:v0ɖ'($x/`F1m (, (&0@,$L d F1C(, (0ǖI@ / ( ז'Gʧ D_}/``@ ( ז'Gʧ / ( 'b9 d / z;($D@ӟG d /q}`;(ٚl* d /`};(Gʧrɴ' d / } ;(ٚlW@ d /{ ~;(Erɴ @/@(0ɖ0>)p/@7(MήƖѨ ] d /G7(e@+;'"/iǬw( 0͖ ]3/Ql`w(s(0 #09M d /Ǭw(e /4x  /`Ǭ w({?070 h |Ȟ/ Ǭw(h0@8 d /0Y(fٗIۆv G=螖/? @W(q002 d /8٬(pΖ`&}; d /(@~@c] d /(!`N(tH\ '|(/(!N(H͙ 'ą'\ d /w@# (t /{ F& ΃ d / !@$O(pI&`& $P/9,@%`&(– '@v EP/M&@`&(:v0<ė0 X/&`&(ɖ04;8`v d /ML g (Rsرk0 a + d /1(`P(.0ٖ" d /,)`{`+(0̊4 d /@9 `7("F"D d /5+9` `7(@d .2 ď 6 hk d /F+:` `7(9ז0}F\ 0ʳ d /QG `7(PE@'; 1z d /H`7(/0ܖvl/ d /H`7(@F 3 3\U/m4`@`7(C  0X d /I;(C0N h͞/`;(ɖ 8{ / k!`;(҃hRsv @ d /kM;(uW0' d /yM ;(E 3 A! d /CO;(9ז0  Р/)w'(߅0x0Q d / w@'(CL  d / w'(` Ζؠ/J@w'(;䂖 N@/@Q ` 1(`0Ӗ0 d /*] (@ TH/R ,(HPyޖ0$Ha d /v7@|,(Rsر`@0 E_ d /7|,(M0p@ӟd d /n|@,(Rsرpҥ0 0pP/@T`q`!(p 'і@;Fa d /zT@(Ɩ&ٖ& S d /`@(rw&f& ROv d /tm`(|0@ʖc d / -@ (@,{K% d /R\W( Ζ 9`&z2k d /ɬXN(*j@*C* udP/G`|@,(Rsvq@%?/5|,(p`q d /@_|,(గ`&p`m/D|`,(dyVt@]#Jno/G`|,(r@rVt@]ȡ/_ ,(TPBEB KW(С/`j`|,(Vt@]ҖE$ 2ء/^b`|,(tUaK/ d /\a@(r }o  ࡖ/@b(@× ^;8~ d /ٟc (r ނ lD ĻM d /Lbdw` '(|  @ @' d /F_@f@ @(@`n/ ` 9em d /f@ !@( u1s/ Z  d /"@ !@(\ 3Ֆ  S^҈ d /!!(p@Kp`& v/l@"@<( ;' ~/l"@<( ;'RW d /6h@#@<(y`3~z`3ct/a`#1(Rsرq0tpr d 5$#=(0;`Kʏ d /o $=(r z{Q d /q$=()= 3e 3B d / x$=(@?@ gh/6x@q@%=(r'@ d /)%=(?p d /@r&=()= 3e 3 XrI/nr`&=(&x;1ݙ6 d /7s&=(dy  d /!@s '=()= 3t`g_  d /et'(4s ɖdx/+u'!(|`j٨ d /v`@(`(:  l ޯ d /h@w(`(,E@ŸM0y d /{w)0(D9R`R a$(0M`)B(r(006/4x)1(K`jO`jk5/ *1(Ֆ;`&  /@y*1(q0B; .P/a@z*(Ŗ  ' e*袖/@|@+(Ŗ &}0 ݵ d /}+(=08BB3ڳ/j,(R Uj|0  G /}`,(U0rʙ0(/p` , 1(`0Ӗ ' 3ϓ8/ ৬ -W(ϯ`烖`&KF@/?!M`-`8(;`&` d /%e-(  ! d /%e@.( 0B1ş d /@e.(ۆر` 0M}Ӥ d /+e/(ۆر 0 d /u`e`/`(u  ` aH/2!@/@2(ϯ`d#0  d /T 0D( ( R/k1"0D(pp60a/h0D(u;ܚӼ /| @1D(Ֆ( Sh d /1D(ޖ6$7 d /^ 2( D{@EWqe8У/O1@`2 9(ܖιږ;@أ/d12 9(ܖιږ; @ࣖ/B@ 3 9(/0Ȗ`& !g d /@@p3@ (r % ^'@  + d /P3@ (:v 'ǖ 6/]@@4y(/0Ֆ@E t/ 4y(:v0ɖ0  d /~ 5y(0b`& d //*@`5@X(}. / /0  d /n^@@5@X(wb s We  /a@=@(PK 5wޖ0 I d / @=@(v0} [k d /o%>@(0Ht d /x `>@(&ǟǟ0(b d 0&>@(Q_ԗIg)2 d /`  ?6(pω@ Wś d /@?6(Iߖ@nc d /@?3(r v /` a+ d /ծ@@3(` `` Vv`_ d /@3(r v` /` {W$ d /`A3(:D&{`& +3 d /rK`A3(gr V`@4 d /K@`A`B(t` r@i , LJڹ d /)` B`B(t` r@i VD`L H/UB(Q0Y0Qo d /DݬB(/  48X/b`@C(s(0 #0 )Vx/*CZ(@ [r d /jɬDy( / D1D d /8e@`DB(x˜;Ř; d /^D[(x˜;Ř; nB d /  E(vܖ`a O d /` E(ߖ@a\+c/E(:v'ɖ'ŕ| d /@F(l` t`  j`yoȥ/@F(Ӗ'(|0  d /@%G(z`&Ӗ`&, d /`G(LJ d /iq@G(Ζ`'ϖ`' d /@t H$(x 3"|@Sͮ d /4Hq( `f / 6A d /8tH$(ʖ੡Ӗ v/(k@I(0: 6& d /nt@I(Rsvp` s80/J (dp`Xp 'r@ d /~kp`J (r@i 05Py5f視/(Q((I0|0R d /(@R((p3B;3 d /(R((s6p ե //@6(S((s`dyd> d /#(`S(({!r0 Nh/0{ S((~ @ F=/ݥ( T((I0|0?1 d /{8(T((otXp`& Dj/ (T((p@q@!H d /i9(@U((X;Hb;|xw d /. @9(U((p`<  q^=/rB`I!(V((r0U;92 d /` 0(r %%2 %%& d /b@(V((p&҃@FWak/:( W((uҴdy 2 d /b@0(- %%2 %% p ȧ/ (W((~z0;댋 d /;(@X((F& 05Py5 t d /;X((Hږ0Pؖ`? fsا/*@<(Y((b{Qdy z!, d /i(`Y((Rsv֗ԥ{+/ d /u@(Y((^ 3P f%_觖/c`( Z((dy0; h d /$c=(Z((z0@ je\ /#=(Z((p@ 0 o~/``(@[((j|0`&  />([((b{Qdy Mx0/@\((s(0 #0 k? @/>|@ `\@(pp` s0X/@\(I}`&v0 d /ٶ+ ](pҖ`& W/] (0u0/|k](0ug  d /C@@^(ppd m}-/oD^О(u00 ؑȨ/*q _(Hږ0 Vha d /S0`_(p 3h4$ d /h0E_(d|h͖ҟ$$Зu8p>ݬ<# `(:0 `Hdd)5j`?#`(:0  HFAwP7 B#`(:0  H44Q$1X1OD#@a(:0 H$$ZH;G#a(:0 HDD4h3P`J#b(:0  .H6 d /[F`b(` +d|+M# d /}0@Fb(Eӈ`$$}I"د1,# c(pіǵs`@$$د102#c(pіǵs`@ d /PGc(} 4Fv`&o d /H@d(˖; d /@IԖd(s 3p$y= d /q e(~ w0k d /@JԖ`e(h˖@, d /(JԖe(%@^xҟ n/P f(I}`V}0N d /TK+f(`&ʖҟA.9 d /K+f(p 3z ՜D d /y1M@g(~tôtôy d /1g(p&*[ d /Nh(ʖ 'g ' q#k0/Bi@P`h(`0ӖH˰ d /Y)Ph(xɖô 4? d /TiQ i(0˖&8˖ 3 ;wP/rRi( 31S d /Si(˖33 ":Y0+ 2U@j(>ءPҖ  | d /)@Vj("|@I 4) d /Vk(`.d 0:cq d /!2@W`k( q2 q I:P/iWk(`3 3w:N d /62`3 l(̖@,;2a/K2@Yl(T{q  V: d /\l(pWXA d /\@m(#Jz3y d /u2m(ۆ` ̖ d /2@]n(`.d| 0$$$ dد1]`n(d|ȵsô@υ- d /@n(ʖ 3g, [C/^ o(̖&`05 d /"o( 4B d /*@`o( s3r3&|r d / `@p(͆ W3-2W d /ap(| 4z`& d /`q(h&&yHZ d /`q(h&&PC d /tq(Xz3б/ r( ~Px %"_ d /dr(˖  5ȩ/P@er($0 3 d /X*`@s(̖D6/@@s(sz` p d /Btet(k`&ť d /jf|`t,(F& :/`e1` ~< d /+@ft,(:`́` 詖/4g u(X˖`&U0)/ d /u(䂖x  j d Fu($ӡ r@ 9B/K @v(MӖ0xS d /gv(Җ`&Ry`&3H d /n |w,(Җ& 3 i6P/x,`|`w,(pvB 3 _@lP/Zl|w,(FY  d /ll| x,(^ 1z`8E" d /,|x,(pP; d /lx (P` M` 0譖/|@@y (P੡M 3 !3 d /, y (}Fv 3V d /lz (Ɩ&ٖ&Rö d /S@`z (Pؖڱ} X d /az (||ɖmЪ/F) { (Pؖڱ}   d /@ { (n` 0 Py ~ d /f{ (֖2}pBM/S@| (|{v4 nJ/| (֖2/ w d /l@} (Fv2.2xUખ/ `} (0D{`|z  d /} (rw&& d /  ~ (rw&f&/6,~(`0Ӗ 9,(M- d 1`|~,(,p{pȳ,(+AZ d 1^o|@,(,p{pȳTr d /` |,(p̖;g/ d /0(0~2q2  d / ` ( s3r3PیȮ/f (2|q@m׶h9@  (Pؖޱ&}r漭vx/= (p0dy N/`` (`0Ӗ0 d /* ^@(@@/l@N@ (5 2 ROv d /tm[ (|0@ʖc d / - [` (@@Vgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/RichardKnop/machinery/v1/commonVgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/RichardKnop/machinery/v1/configVgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/internal/sdkrandVgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/private/protocolVgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/service/dynamodbVgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/api/types/networkVgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/emirpasic/gods/trees/binaryheapVgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/golang/protobuf/ptypes/durationVgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/bson/bsoncodecVgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/bson/primitiveVgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/mongo/readprefVgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/x/mongo/driverVgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/balancer/roundrobinVgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/hlandau/passlib.v1/hash/sha2cryptVgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-billy.v4/helper/polyfillVgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/internal/revisionVgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/filemodeV*func(*dynamodb.CreateGlobalSecondaryIndexAction) *dynamodb.GlobalSecondaryIndexUpdateV*func(*dynamodb.DeleteGlobalSecondaryIndexAction) *dynamodb.GlobalSecondaryIndexUpdateV*func(*dynamodb.DescribeGlobalTableInput) (*dynamodb.DescribeGlobalTableOutput, error)V*func(*dynamodb.PointInTimeRecoveryDescription) *dynamodb.ContinuousBackupsDescriptionV*func(*dynamodb.UpdateGlobalSecondaryIndexAction) *dynamodb.GlobalSecondaryIndexUpdateV*func(*transport.Endpoint, transport.AuthMethod) (transport.ReceivePackSession, error)V*func(context.Context, interface {}, ...*options.RunCmdOptions) (*mongo.Cursor, error)V*func(map[string][]*dynamodb.ItemCollectionMetrics) *dynamodb.TransactWriteItemsOutputV*func(string, string, ...func(*endpoints.Options)) (endpoints.ResolvedEndpoint, error)V*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.ModifyPushConfigRequest }V*struct { F uintptr; doneOnce *bool; s *topology.Server; conn *connection.Connection }V*struct { F uintptr; t *transport.http2Client; s *transport.Stream; eosReceived bool }V*struct { F uintptr; t reflect.Type; keyOp *gob.decOp; elemOp *gob.decOp; ovfl error } ClientHeaderHprotobuf:"bytes,6,opt,name=client_header,json=clientHeader,proto3,oneof" DeprecatedJprotobuf:"varint,23,opt,name=deprecated,def=0" json:"deprecated,omitempty" DeprecatedJprotobuf:"varint,33,opt,name=deprecated,def=0" json:"deprecated,omitempty"RssHugeMjson:"rss_huge,omitempty" yaml:"rss_huge,omitempty" toml:"rss_huge,omitempty"RxBytesMjson:"rx_bytes,omitempty" yaml:"rx_bytes,omitempty" toml:"rx_bytes,omitempty" ServerHeaderHprotobuf:"bytes,7,opt,name=server_header,json=serverHeader,proto3,oneof"TxBytesMjson:"tx_bytes,omitempty" yaml:"tx_bytes,omitempty" toml:"tx_bytes,omitempty"Wgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/RichardKnop/machinery/v1/tracingWgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/api/types/registryWgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/golang/protobuf/ptypes/timestampWgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/resolver/passthroughWgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/transportWgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/storage/filesystemW*func(*dynamodb.BatchGetItemInput, func(*dynamodb.BatchGetItemOutput, bool) bool) errorW*func(*dynamodb.BatchWriteItemInput) (*request.Request, *dynamodb.BatchWriteItemOutput)W*func(*dynamodb.ContinuousBackupsDescription) *dynamodb.DescribeContinuousBackupsOutputW*func(*dynamodb.DescribeBackupInput) (*request.Request, *dynamodb.DescribeBackupOutput)W*func(*dynamodb.DescribeLimitsInput) (*request.Request, *dynamodb.DescribeLimitsOutput)W*func([]*dynamodb.ReplicaSettingsDescription) *dynamodb.UpdateGlobalTableSettingsOutputW*func(anagent.TimerID, time.Time, time.Duration, bool, anagent.Handler) anagent.TimerIDW*func(context.Context, *options.SessionOptions, func(mongo.SessionContext) error) errorW*func(context.Context, string, pubsub.SubscriptionConfig) (*pubsub.Subscription, error)W*func(float64) *dynamodb.AutoScalingTargetTrackingScalingPolicyConfigurationDescriptionW*func(string, string, bool, bool, bool, bool, amqp.Table) (<-chan amqp.Delivery, error)W*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.ModifyAckDeadlineRequest }W*struct { F uintptr; keyOp *gob.encOp; elemOp *gob.encOp; keyIndir int; elemIndir int }W*struct { P *big.Int; Q *big.Int; G *big.Int; Y *big.Int; Rest []uint8 "ssh:\"rest\"" }AckIdsOprotobuf:"bytes,2,rep,name=ack_ids,json=ackIds,proto3" json:"ack_ids,omitempty"AckIdsOprotobuf:"bytes,4,rep,name=ack_ids,json=ackIds,proto3" json:"ack_ids,omitempty"CPUQuotaMjson:"CpuQuota,omitempty" yaml:"CpuQuota,omitempty" toml:"CpuQuota,omitempty"ExitCodeMjson:"ExitCode,omitempty" yaml:"ExitCode,omitempty" toml:"ExitCode,omitempty"GroupAddMjson:"GroupAdd,omitempty" yaml:"GroupAdd,omitempty" toml:"GroupAdd,omitempty"HostPortMjson:"HostPort,omitempty" yaml:"HostPort,omitempty" toml:"HostPort,omitempty"HostnameMjson:"Hostname,omitempty" yaml:"Hostname,omitempty" toml:"Hostname,omitempty"IntervalMjson:"Interval,omitempty" yaml:"Interval,omitempty" toml:"Interval,omitempty"NetworksMjson:"Networks,omitempty" yaml:"Networks,omitempty" toml:"Networks,omitempty"NetworksMjson:"networks,omitempty" yaml:"networks,omitempty" toml:"networks,omitempty"ParentIDMjson:"ParentId,omitempty" yaml:"ParentId,omitempty" toml:"ParentId,omitempty"ReadOnlyMjson:"ReadOnly,omitempty" yaml:"ReadOnly,omitempty" toml:"ReadOnly,omitempty"RepoTagsMjson:"RepoTags,omitempty" yaml:"RepoTags,omitempty" toml:"RepoTags,omitempty"SettableMjson:"Settable,omitempty" yaml:"Settable,omitempty" toml:"Settable,omitempty"SettingsMjson:"Settings,omitempty" yaml:"Settings,omitempty" toml:"Settings,omitempty"VisibilityTimeoutDyaml:"receive_visibility_timeout" envconfig:"SQS_VISIBILITY_TIMEOUT"Xgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/docker/docker/api/types/containerXgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncoreXgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/x/network/resultXgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/genproto/googleapis/iam/v1Xgithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/grpc/internal/balancerloadX*func(*dynamodb.PointInTimeRecoverySpecification) *dynamodb.UpdateContinuousBackupsInputX*func(*tls.Config, *tls.Certificate, *tls.clientKeyExchangeMsg, uint16) ([]uint8, error)X*func([]*dynamodb.AutoScalingPolicyDescription) *dynamodb.AutoScalingSettingsDescriptionX*func(context.Context, ...gax.CallOption) (pubsub.Subscriber_StreamingPullClient, error)X*func(context.Context, interface {}, ...*options.ListDatabasesOptions) ([]string, error)X*struct { F uintptr; buf *bytes.Buffer; pw *io.PipeWriter; dr *httputil.delegateReader }X*struct { F uintptr; c *pubsub.PublisherClient; req *pubsub.Topic; resp **pubsub.Topic }X*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.DeleteSubscriptionRequest }X*struct { F uintptr; opts *git.GrepOptions; treeName string; results *[]git.GrepResult }X*struct { F uintptr; typ *runtime._type; src unsafe.Pointer; off uintptr; size uintptr }CallIdPprotobuf:"varint,2,opt,name=call_id,json=callId,proto3" json:"call_id,omitempty" DescriptionKprotobuf:"bytes,2,opt,name=description,proto3" json:"description,omitempty"EnumTypeNprotobuf:"bytes,4,rep,name=enum_type,json=enumType" json:"enum_type,omitempty"EnumTypeNprotobuf:"bytes,5,rep,name=enum_type,json=enumType" json:"enum_type,omitempty"IpPortPprotobuf:"varint,3,opt,name=ip_port,json=ipPort,proto3" json:"ip_port,omitempty"NamePartNprotobuf:"bytes,1,req,name=name_part,json=namePart" json:"name_part,omitempty" PermissionsKprotobuf:"bytes,1,rep,name=permissions,proto3" json:"permissions,omitempty" PermissionsKprotobuf:"bytes,2,rep,name=permissions,proto3" json:"permissions,omitempty"TypeNameNprotobuf:"bytes,6,opt,name=type_name,json=typeName" json:"type_name,omitempty"Ygithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/aws/client/metadataYgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/mongo/readconcernYgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/x/network/addressYgithub.com/MottainaiCI/mottainai-cli/vendor/go.mongodb.org/mongo-driver/x/network/commandYgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/hlandau/passlib.v1/hash/bcryptsha256Ygithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/format/diffY*func([]*dynamodb.ReplicaSettingsDescription) *dynamodb.DescribeGlobalTableSettingsOutputY*func(context.Context, *iam.GetIamPolicyRequest, ...grpc.CallOption) (*iam.Policy, error)Y*func(context.Context, *iam.SetIamPolicyRequest, ...grpc.CallOption) (*iam.Policy, error)Y*func(context.Context, *pubsub.GetTopicRequest, ...gax.CallOption) (*pubsub.Topic, error)Y*func(context.Context, ...grpc.CallOption) (pubsub.Subscriber_StreamingPullClient, error)Y*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (int64, error)Y*func(context.Context, interface {}, ...*options.AggregateOptions) (*mongo.Cursor, error)Y*struct { F uintptr; createFunc func([]uint8, []uint8) (cipher.Stream, error); skip int }Y*struct { F uintptr; t *transport.http2Client; cleanup func(error); s *transport.Stream }JsonNameOprotobuf:"bytes,10,opt,name=json_name,json=jsonName" json:"json_name,omitempty"MapEntryOprotobuf:"varint,7,opt,name=map_entry,json=mapEntry" json:"map_entry,omitempty"9 d /8@0ବap`05+p%Mr d /$4@bups @'K& d /@6v0ps  AC d /6v0ps 0A d /d=+`̖ps  : d / J@@9(s0ps 0؊x}\b d /SJ @ܘǨr $hՏ9 d /POl.@x` q`q.= d /`Ol௬.@x` qq  d /`k@H(7 1Т1$\~^/`Ȗ 07 @1p1 ,<" d /2[@BHŖ@)7 1P1ٹ d /u`j{`+dyps 6P5b d /mTj{+dyps 65(9 d /2@l{ +̖ p 5 5& d /@@y&ҟ@O p܄ K! d /:`pಬ6.ps zzOk d /:p@6.ps zpzC` d / q6. 6ps zz | d / tn 'ps x xjUg d /`7:'ba O@"Ln d /q!`0/ Eh`5hG3 d / " `73 @NX@NXS NXNX+7 d / 1ups 5a@`N$ d /@൬` y8 n`@m`S 譖/'`3@^e I`tI `ItI-| d /]yvܖ`05`/O4O2 d / b$p30 3JPJe d /`` b$p20 3PJJL d /j  bxp30 3PJJ`- d /  bxp20 3JJ۳ d /:j~z0ps PakY 9 d /fฬp }05!!V d / \e MM7e MM PMM$! d /0`N0" 8 ;e Ѓ` ! d /!xN SЃ` ` S/  d / Ǭ w0r e /4x ! d /S` W,@z ||& | | ||\ d / @٬0p`CѲ@{ / V`Cfg d /Нڬ@0F 2 @s@i %`G!fM d /@(`v`&0B- H @ \ t)O d / ' pLK  *K d /j9```70i q d `[{[ d /i@C``70r@i !1X u WX. d /L#R C0D%@ r 2@ ]w d /, (d@d~ B )dd =x d /'<l10  P qN 8  K' d /+x@10R6 Ʈ?ю @" d /@@@D0}. p|` ` ď` d /-@0o` z 4 Z>)Xz~} d /&`20 O Y! .2 DP d /60r 0 1 K d /Vd`2sPy5 `U d /e.f0r@i 05m`EN1 _^ d /`,%ps ppe 0 e @? d /ܢ`@(V/ 09*{) 9*|)& d /1:((0 -U %@i y K d /c( e* 'Ha f* 'uN d /P `(ps 0k*i&n k*i&Q6x d /H=((0T@i s@i KR ` P\ d / ( t*'Ha t*'Ka d /S`@r@i P:905:9  d (7BPz1y `PQ744NY d 2jP0z1y෣PQ7`,,l=0 d 2 @Pz1y PQ7@PEV d 89 Pz1yPQ7,,TDd d 2HPPz1yࠣ PQ7P44ں d 2CPz1y ෣PQ7`,,x!H d 2p @Pz1y PQ7@P,,t d 2 Ppz1yࣣ PQ7P44O$ d 2CPz1y੣෣PQ7`,,Q d 2 P0z1yણ PQ7 PLL_ d 4 @Pz1y`༣PQ7@ LL' d 4jPz1y`PQ7 ,,0h'; d 2PPz1y PQ7 PQU d (7n Pz1yૣ PQ7 ,,>, d 2 @Pz1y  PQ7@ PLL d 4й Ppz1yୣPQ7 44)6 d 2 Pz1y`෣PQ7 `LL^ d 4 P0z1y`٣PQ7 Y;A d (7 @Pz1y  PQ7@ ll܄ d 57 Pz1y`PQ7 :Y d (7 PPz1y`PQ7  d (7Pz1y `PQ7 ll^id d 48 @P z1yౣ`Q7@ llkxW d 42DPp z1yPQ7 LL؈K d 4 P z1y๣ PQ7 LLQ7 d h4 P0 z1y  Q7 憅 d 5ۈ@P z1y``PQ7@ TTz d 3"P z1y Q7 LL? d 2 PP z1y໣`PQ7 LLgzD d 2P z1y໣`PQ7LL d 2 @P z1y໣ PQ7@4$ d /Pp z1y໣෣PQ73`LLf d 2_P z1y໣ PQ7llp d 4F P0 z1y໣PQ7z d /P z1y``Q73ll˚ d 4'P z1y` PQ7ll}t d 41@PPz1y`PQ7@LL d 2 Pz1y `ۣPQ7LBҐ d /RCPz1y`٣PQ73,,J+ d : Ppz1yPQ7PLL-B^ d 23 Pz1y PQ7r d 78 @P0z1y`£ണQ7@PLL( d 3lPz1y`£ Q7* d @6FPz1yã`Q7* d @6FPPz1y ţQ7> d 83 @Pz1yţPQ7@ll d 4^ Pz1y`ƣPQ7ll| d 4jPpz1yƣPQ7lldt d 4<Pz1yƣPQ7ll4] d 4 @P0z1y ǣPQ7@llS d 4 Pz1y`ǣPQ7L~ d /Pz1yǣ٣PQ73L|- d /e PPz1y`ȣ ȣPQ73llS d 4Pz1y`ȣPQ7ll4' d 85 Pz1yȣ`Q7llSAW d 85 @Ppz1yȣQ7@ll d 45^ Pz1yȣ`Q7" d 5L P0z1y`ɣ`PQ7? d p6I Pz1yɣQ7llU d 4@Pz1yɣPQ7@ll$ d 85 PPz1y ʣQ7*5 d <wPz1y`ˣˣQ744QBQL d 2Pz1ỵۣ Q7`bf&{ d / Ppz1ỵ෣ Q730TT D d T4` @Pz1y ͣ  Q7@ll<  d 85 P0z1yͣ`Q7TT d T4Pz1y`Σ Σ Q7LL2t d h40 Pz1yΣ Q7ll_1g d 4@PPz1y ϣPQ7@LLqXo d h4 Pz1yϣ Q7ۇ d 7 Pz1yϣ УQ7PLL  d h4 Ppz1y`У Q7ll Rc d 45@Pz1yУ٣Q7@L8 d /r P0z1y`ѣӣPQ73ll d 4Pz1y`ѣPQ7TT߷ d 3jPz1yѣ Q744@ d 2 PPz1yѣ`ң Q7`44i$ZJ d 2@Pz1yѣۣ Q7@`TTto d 3 Pz1yѣ Q7$e d /Ppz1y ң෣0Q73@\\ Ԏ d x3 Pz1y ң0Q7 d 8- @P0z1yңQ7@ll'+ d 5Pz1yӣ ԣQ74SI- d /aPz1yӣ෣PQ73`L=d d / PP z1yӣ`ѣPQ73,, d : P z1yԣӣQ7P[& d h9k P!z1yԣ Q7llY4 d 42C@Pp!z1yգPQ7@ll,( d 85! P!z1yգ`գQ79 d p8 P0"z1y֣PQ7^kS d p8PP"z1y֣ PQ7- d p8@P"z1y֣`PQ7@6- d p8PP#z1y֣PQ7]' d /9kP#z1y֣෣PQ73` e d @9 P$z1y֣ףPQ7}'= d /Pp$z1y֣ڣPQ73 ]& d / @P$z1y֣ PQ73PjV d / P0%z1y ף෣ Q730llA2 d 85nbP%z1y`ףৣQ7TTܲS d 3 P%z1y`ף෣Q7Ga d x6` PP&z1y`ף Q78u| d /X @P&z1yף֣PQ73llV d 85xP'z1y أ`Q7TT)@j d 3 Pp'z1y أ෣Q7LL  d 2 P'z1y`ڣPQ7LLBC% d 2 @P0(z1y`ڣ PQ7@LL  d 2 P(z1y`ڣ PQ7LLBC% d 2 P(z1y`ڣ`PQ7LLvHp d 2PP)z1y`ڣ PQ7ݳ* d 5I@P)z1y`ڣൣPQ7@4 d /PP*z1y`ڣ෣PQ73`\7 d H9ثPp*z1y`ڣ ãPQ7\7 d H9ثP*z1y`ڣ`ģPQ7L d / P0+z1y`ڣǣPQ73Lb d /H!P+z1y`ڣңPQ73Lȑ d /yJP+z1y`ڣ`ڣPQ73ll1L d 4}PP,z1y`ڣPQ7 LLR&M d 2Ȫ@P,z1y`ڣ PQ7@ Lb d /H!P-z1y`ڣPQ73ll? d 4Pp-z1yڣQ7 llA d 4 P-z1yڣQ7 ll1 d 4 P0.z1yڣ`Q7!ll~ d 4 @P.z1yڣQ7@!ll.V) d 4  P.z1yڣणQ7!ll d 4 PP/z1yڣ Q7!lliJ& d 4 P/z1yڣ`Q7"ll!$ d 4 @P0z1yڣQ7@"P d P7ePp0z1yڣ`Q7"Pk< d /AP0z1yڣ֣Q73T9: d / P01z1yڣ ףQ73  d 5kP1z1yڣڣQ7"M< d 5}P1z1yڣQ7#L°xq d /@PP2z1yڣ Q73LLZ d 2P2z1y٣`PQ7#2g d 5rCP3z1y٣ ɣPQ7#Li[( d /Pp3z1y٣ӣPQ73L( d /lP3z1y٣٣PQ73lld- d 4i@P04z1y٣PQ7@$ll/ d 5# P4z1yڣQ7$llS  d 5 P4z1yڣQ7$Ox d P8; PP5z1yڣ Q7%P+Q d P85 @P5z1yڣඣQ7@%P3. d P8P6z1yڣ Q7%Pll@> d 5g Pp6z1yڣ ֣Q7%  d 6 P6z1yڣڣQ7&l  d 6c@P07z1yڣQ7@&LL^ d h4$ P7z1yڣ Q7&ll 2 d 4u P7z1y`ޣPQ7&llZ@t d 4PP8z1yޣPQ7',,H m d 8; @P8z1y ߣೣQ7@'PǾ d 9yP9z1y ߣ`Q7'( d 9Pp9z1y ߣ`Q7'Q,z d 90 P9z1y ߣ٣Q7(llN d 4$ @P0:z1y`ߣPQ7@(TT$A d 3k P:z1yߣ Q7(44B" d 2P:z1yߣܣ Q7(`442& d 2 PP;z1yߣ` Q7)`TT  d 3V @P;z1yߣ Q7@)$z d /K P<z1y ෣0Q73@\\nxX( d x3 Pp<z1y 0Q7)LLPJ d 2 P<z1yຣPQ7*LLB\1 d 2 @P0=z1y`PQ7@*LL  d 2 P=z1yʣPQ7*lle d 4P=z1yˣPQ7*llqk d 4&PP>z1y ̣PQ7+llE d 5 @P>z1y `Q7@+ll? d 5 P?z1y Q7+llߠ d 5 Pp?z1y Q7+llk+g d 5P?z1y Q7,llkW d 5, @P0@z1y Q7@,lluK d 5XP@z1y  Q7,lls7+ d 5Z P@z1y `Q7,ll4r d 5a% PPAz1y Q7-ll( d 5` @PAz1y Q7@-llk+g d 5PBz1y Q7-llkW d 5, PpBz1y  Q7-lluK d 5XPBz1y `Q7.lls7+ d 5Z @P0Cz1y Q7@.ll4r d 5a% PCz1y Q7.ll( d 5` PCz1y  Q7.ll d 5Ȣ PPDz1y Q7/llC+ d 5E @PDz1y  Q7@/ll} d 5% PEz1y  Q7/P d P8 PpEz1y  Q7/PTTr$ d l4CPEz1y ෣Q70j d 65 @P0Fz1y Q7@0ll d 5 PFz1y ໣Q70  T d : PFz1y ãQ70  T d : PPGz1y ģQ71ll d 5 @PGz1y ʣQ7@1TTճ d l4B PHz1y ʣQ71J d 6PpHz1y ˣQ71~qk d 6PHz1y  ̣Q72ll.y d 5g!@P0Iz1y ٣Q7@2llm d 5jPIz1y  ۣQ72ll. d 54kPIz1y  ܣQ72ll. d 54kPPJz1y `ܣQ73)C d X8 @PJz1y `Q7@3Pp d 6PKz1y Q73̃F d 8 PpKz1y``Q73lli d `5B PKz1y` Q74^$. d 7Zk@P0Lz1y෣Q7@4 LL 7Y d 47 PLz1y  Q74LLo/Q d 2 PLz1y`ணPQ74lll d 85 PPMz1yQ75ll<. d 85C@PMz1y`Q7@5llJa d 85 PNz1yQ75ll,YW d 85'PpNz1y Q75ll8q5 d 85 PNz1y`Q76ll~Q d 85 @P0Oz1yQ7@6llZ^ d 85POz1yQ76lll۰ d 85POz1y Q76ll|yF d 85 PPPz1y`Q77llLT d 85@PPz1yQ7@7ll  d 85n PQz1y Q77ll-l d 85% PpQz1y`Q77llo] d 85 PQz1yQ78llf d 85& @P0Rz1y Q7@8llf d 85& PRz1y`Q78llM}j d 85h PRz1y`Q78ll^&_ d 85H PPSz1y Q79ll  d 85 @PSz1y Q7@9ll- d 85 PTz1y`Q79ll/ d 85 PpTz1yQ79ll_ d 85 PTz1y`Q7:llx| d 85 @P0Uz1yQ7@:ll> d 85 PUz1yࡣQ7:ll}y d 85PUz1y Q7:llH9 d 85 PPVz1y`Q7;llܸ d 85 @PVz1yQ7@;llj d 85PWz1yࢣQ7;ll~ d 85 PpWz1y`Q7;llVI d 85PWz1y Q7<ll4$C d 85T@P0Xz1y Q7@<ll[X d 85wPXz1y`Q7<llQ d 85 PXz1yQ7<ll"zY d 85{kPPYz1yণQ7=ll d 85 @PYz1y Q7@=lll ) d 85a PZz1y`Q7=ll| d 85\ PpZz1yQ7=ll4 d 85 PZz1yৣQ7>llˤ d 85ɉ@P0[z1yਣQ7@>ll\_ d 85 P[z1y Q7>llh d 85kP[z1yQ7>llm d 85CPP\z1y੣Q7?ll\_ d 85p @P\z1y`Q7@?llʫ d 85  P]z1yQ7?ll/r d 85!Pp]z1y Q7?ll] d 85% P]z1y Q7@llfՉ d 85 @P0^z1yQ7@@ll d 851P^z1y Q7@ll\_ d 85p P^z1y௣Q7@llm~ d 85kPP_z1yణQ7All[v d 85 @P_z1y`Q7@A?j d h6P`z1yQ7AoR d 7 Pp`z1y Q7APל d 7P`z1y`Q7BPa d 7 @P0az1yQ7@BPG d 7 Paz1yಣQ7BP? d 7O Paz1y Q7BPQ d 7DPPbz1y`Q7CP d 7" @Pbz1yQ7@CP|  d 7 Pcz1yQ7CP< 0 d 7}Ppcz1yQ7CPF|s d 7hPcz1y Q7DP$ d 7y@P0dz1y`Q7@DP d 7 Pdz1yQ7DPTJ d 7Pdz1y Q7DP" d 7NPPez1y`Q7EPTT2aB d 3J@Pez1y෣Q7@Ell7r d 858 Pfz1y Q7Ell0> d 85a Ppfz1y Q7Ell` d 45kPfz1y`Q7Fh d x6}@P0gz1y Q7@Fll d 85Pgz1yQ7Fll},m d 85aPgz1y Q7F. d 8PPhz1y`Q7Gll{?o d 85' @Phz1yQ7@G  V; d X:lPiz1yQ7G d x6QPpiz1yལQ7GB4 d 98 Piz1yQ7H d 9L @P0jz1yྣQ7@HT d 7 Pjz1y Q7HPll,I9 d p?` Pjz1y`Q7H3ƅ d p6r PPkz1yQ7IPӵ d @ @Pkz1y࿣Q7@ILL>7 d < Plz1yQ7IԻ d H= Pplz1y`Q7Ir! d 0@| Plz1yQ7JP3/ d <L @P0mz1yQ7@JLLz d 0? Pmz1y £Q7Jll~ d 85 Pmz1y£Q7J z d 9PPnz1y£Q7K ' d x6@Pnz1y`ãQ7@K ' d x6Poz1yģQ7KW d h6 Ppoz1yţQ7K,, d H;=& Poz1yǣQ7LPc d 7I@P0pz1y ɣQ7@LPas d x6 Ppz1y`ʣQ7LTS d = Ppz1y`̣Q7LP  d d h:!PPqz1y`ͣQ7Mll d 85 @Pqz1yͣQ7@M,,pp d (;# Prz1yΣQ7MP~w d x6 Pprz1y`ϣQ7Mi d x6 Prz1yУQ7N d 9 @P0sz1y ѣQ7@Ne  d 9F Psz1y ӣQ7N/S d x6& Psz1y`ӣQ7NllN d 45DPPtz1yӣQ7O̡ d x6Ԭ@Ptz1y`ԣQ7@OHI d x6 Puz1yԣQ7O~  d x6 Ppuz1y գQ7Od( d x6 Puz1y`֣Q7Pz" d x6C@P0vz1y֣Q7@P d 9Pvz1y֣Q7P6 d x6 Pvz1y`أQ7PLL&e{ d <@PPwz1yأQ7QRIJ d 8. @Pwz1yأQ7@QTT!R d 3 Pxz1y ٣Q7Q d 7V Ppxz1y`٣Q7QPTT=I: d 3| Pxz1y٣Q7Rll]hcq d 45@P0yz1y٣Q7@R\\' d 3}Pyz1y ڣQ7Rll} d 45 ~Pyz1y`ڣQ7R\ d h6$~PPzz1yڣQ7S  d x6 @Pzz1yڣQ7@SllHGi d 85 P{z1yܣQ7Sll-% d 85@ Pp{z1y ݣQ7Sll3 d 85q P{z1y`ݣQ7Tll% d 85@P0|z1yݣQ7@Tll/: d 85 P|z1yݣQ7Tll5{ d 85 P|z1y ޣQ7Tiv d x6m PP}z1yޣQ7UE d 8@P}z1yQ7@U>Ĭ d x6/P~z1y Q7U[k d 7&Pp~z1y`Q7UPG d 80 P~z1yQ7V> d p6@P0z1yQ7@VDT d h6(Pz1yQ7VLL@ d 3!Pz1y Q7Vllr d 45PPz1y`Q7W% d 9!@Pz1yQ7@Wye d h6Pz1yQ7W<<}}_ d l2Ppz1y 0Q7Wp\\'V d x3PЁz1y 0Q7XLLg d 2 @P0z1y`PQ7@XLLU.k d 2] Pz1y`ॣPQ7XLL/ d 2֣ Pz1y``PQ7XLLΟ d 2 PPz1y`ଣPQ7YLLy(=% d 2 @ Pz1y``PQ7@YLLa d 2 Pz1y`PQ7Y= d 5 Ppz1y` PQ7YAM d 5k PЄz1y``PQ7ZLE"^ d /?~P0z1y``ڣPQ73ll d 4@ Pz1yQ7@ZTPX d /J Pz1y෣Q73llp6] d 40 PPz1yQ7Zlli d 4R Pz1yรQ7[  J: d :n @ Pz1y ģQ7@[  J: d :n Ppz1y`ţQ7[cQz d /0 PЇz1y ˣQ73PTQ d 5է P0z1yQ7[44D d 2RD Pz1y Q7\`TT` d T4s@ Pz1y ƣ Q7@\4@ d /PPz1y٣ Q73`TT*j d 3Z~ Pz1y Q7\4ô d /u~ Pz1y` Q73`LL d 2 Ppz1yPQ7]LLI d 4@ PЊz1y `ڣPQ7@]LLs- d 4i& P0z1y  PQ7]TT< d 3 Pz1y` Q7] d 8- Pz1yQ7^  d /_Pp3p௷ӘV`&Sz/ d /=p3?@%  Q< d /p3?_`&%`~ d /7pp3p:0p` E d /`Ѝp3p:0Ж) Vk d /Ri c0p3]rn`&zGq d /& cp3bjx&0 > d /`-p3p`\{ -i d /x`-Pp3p`\{`$*f9 d /`-p3p`\{`%+ d /ԇ`-p3p`\{`]@+Ca% d /Q`-pp3p`\{`(- d /P`-Аp3p`\{`b-?< d /s`-0p3p]\{` @,; d /`-p3p]\{@ ,I d /D`-p3p]\{`!@*d d /`-Pp3p]\{`"*=+ d /3`-p3p]\{`'+W d /p3`-p3p]\{ ,Za0v d /8`-pp3p]\{@!,- d /`-Гp3p]\{``@,ܨ d /`-0p3p]\{`a,Qh d /q7p30p¸p0   d /9Fm tp3x~z@{t d /Pp3͖@p_x d /Antp3x@p@h 7 d /Bntp3p`h`x4 Mo d /lJqppp3`0t@ ڮ d /R8q/Жp3p`z0x@  d /@z0p3xx@Y  pQ d /S=൭p3-p҃l VW. d /qp3p0pfz( d /]Pp3pyx~ʖ`& "< d /^r|p3q@xϖӳ Z d /|[p3p@R0p WCM d /=pp3p@Rpܗ;ů1 d /CЙp3͖p d /80p3;tιp4Q! d /sRp3 ?0B g?b d /8Bp3sQe6 d /Dw ${ Bd " u   m7C6 d /A ${ Bd 0H 0H " u I I 9[46 d /а${ Bd 0J 0J " u PK PK mI6 d /2$i` , '!'!r@i @(!@(!o6 d /${ Bd \ \ " u ^ ^ 6 d /${ Bd K K " u N N $6 d /S${ Bd G G " u H H 6 d /w`${ Bd ) ) " u 04 04 ; 6 d /y`${ Bd B B " u C C 6 d / r${ Bd P P " u ` ` ,B6 d /  $ps 1!1!pe 2!2! e P2!P2!6 d / UMUMJ SMSMx VM VM_`Z6 d / `M`MK pMpM˝MM6 d /l·`7 N Nu NNy6 d /@l` PPt`  @@8Lo6 d /F& ``:/`e1` PPW6 d /ze@,% } } ~' } } @~ @~ M?/6 d /Y$@,% | | ~' | | 0} 0} 6 d / A,% x x ~' x x @y @y H6 d /!`A,% w w ~' w w @x @x !ߍ6 d /XA,% { { ~' { { P| P| i6 d /lA,% { { ~' z z P{ P{ ff~ NffM3!6 d /c`6%Q@f@f~'`Sff2@;ffG6 d /"h >% ii/ @i@iB4@ ii6 d / %`>`i`iwU 0i0i+D6 d /$)8w ``x 00F jNJ6 d /`%9FPP 'sV6 d /%9F r6 d /8@9ye De e u6 d /`:` `o`oT` o oym ooX6 d /P`D%@ ppt ppF& ppf6 d /dY! 0n0n"z.nn| nn6 d /= u@I0n0nm nnE6 d /   N@ uuSuu F uu96 d /j65h uuü $ CsCs 0u0udj6 d / 75h  u u=`) `Ns`Ns p up u6 d / 85h uu2 `s`s uuM6 d / 95h uu`# hshs PuPu6~6 d />:5h 0t0t `vs`vs tt6 d /Q;5h P"uP"u2 ysys "u"u|B6 d /f\<5h $u$u# }s }s 0%u0%u6 d / =5h P'uP'u& ss 'u'uҼ86 d / >5h *u*u= ^ s s +u+uf!F6 d /( ?5h 0-u0-u=) ss -u-unow6 d /8@5h p6up6uX 3 ЏsЏs 6u6uYq6 d /A A5h 8u8uΎ 4 0s0s P9uP9uO.6 d /y B5h pVupVuܬ` ss VuVuM)ٟ6 d / C5h ttܬ` tt PtPt76 d /C5h uup tt 0u0uy%6 d / D5h  u up  tt p up ugBb6 d /H D5h LuLu`3 1t1t LuLu6 d /% E5h Ou Ou3 `6t`6t OuOu 6 d / F5h auau ' tt bu bu~6 d /|F5h peupeu=) PtPt eueufC6 d / G5h ququ3 ptpt ququy6 d /G5h uuuu4 tt vuvun6 d /W Hh vvw vv v vq^Y6 d /X!Hh 0v0v` PvPv vvN6 d / Ih vvw  0&v0&v @v@v9nb6 d /J Jh 0v0v@ 0v0v vvIT6 d /!Jh vv` 3v3v @v@v;6 d /! Kh vvk 6v6v PvPv8T6 d /kLh vv^ :v:v `v`vǯ6 d / Mh @v@vJB  :v:v vvmsr6 d /Mh vv l @Z6 d /@ b:b:V/ b: b: `b:`b:_o6 d /@*F& :/`e1` a.6 d /*~' @2@2 0808.2 88#k6 d /M`o*~' II jj.2 JJM6 d /԰o*~' CC `j`j.2 `D`DFW6 d /H *~' OO pPpP.2 @P@PQ?36 d /@*~' XX ZZ.2 ZZ?ܬF6 d / *~' 0T0T TT.2 TT,6 d /M*~'  ``.2 6 d /o *~' `` .2 ˧6 d /o` *~'  .2 PP -6 d /p *~' @@ .2 E_6 d / *~'  @@.2 96 d / *~'   .2 6 d /ߨ` *~'  00.2 ,6 d /`*~'  PP.2  C6 d /g *~'  .2 ppuwwz6 d /F.`ϥ*~'  pp.2 6 d /b*~'  @k@k.2 pp-ns6 d /o*~'  .2 D56 d /'ϥ*~'  pp.2 `6 d /M *~'   @ @ .2   ,]6 d /N*~'  .2 a6 d /!N*~'    # #.2 ""DžTb6 d /E@*~' ++ 11.2 `1`1ڭ'6 d /[. *~' pp .2 }l6 d /p. *~' AA pBpB.2 @B@By6 d /.` *~' PFPF FF.2 FF6 d /. *~' JJ `K`K.2 0K0K 6 d / *~' `O`O OO.2 OOHz6 d /*~' SS V V.2 UUo^6 d / *~' p=p= >>.2 ==#k6 d /> \e MM7e MM PMPM˨;6 d /eTN>%` pp/`;` *q6 d /]NjF LF  pp.%W6 d /P@d !N>NQ  *K6 d /u ]@O P݄P݄( j Hh6 d /  ®F& PxPx:/`exx1` @x@xF6 d / .`9 @V@V` UUz VV;6 d /` .9 U U TTz pUpU{@6 d /m) ` ʼnʼns ȉȉ%@i 0ʉ0ʉ'r#6 d /L Į;5  55. = 6 6 p6p6F\6 d /Į;<`> ::? @:@:^}@ ::y%56 d /0-@7 ||/x | |` P|P|6 d /b@ Nhs` wwps @w@w2 wwZRc6 d /Dm Ʈ NF& ww:/`e w w1` wwVg|6 d /iwps &&t@i && ' 'ľͲ6 d /we < </4`;`;x ::^g6 d / @we `R`R/4pQpQx PP 6 d /p঳Y= P}P}  z6 d /j ȮY= F} F}B}B}  PC}PC})\6 d /S@ W,@z | |& || ||v6 d /RbWps ` e ``6 d /ˮF& `1}`1}:/`e1}1}1` P2}P2}3Յk6 d /x`1t }}@dj}j} }}w6 d /@Բt }}/{ }}F& }}Ϧ6 d /ML vp XhXh1 YhYhT@a 0Zh0Zh۸n6 d /U- vhvh@i J97Ce6 d /No@ pmhpmh  @nhnh6 d /DZ+,(ihhY` pgpgKe6 d /#`ϩ£a 0g0g,(G6 d /T`0 `y `y WoH6 d /\d ծ %f -W -WG1d -W-W1A.W.W+n6 d / ֮`=@ PNVPNV* OVOV2 MVMVLP6 d / ʠ ;W;W`y .W.W`y 6 d /Tn֮!1a LL35 `L`L0 LLh[6 d / ' pLpL  * }6 d /ղ '  K K@` KK@ ТKТK+6 d /'  '/` @:L@:L0 ;L;L  X Xi@X@X0XXz6 d /4ҩ`7} XX1`XXApXpXU6 d /y+<`7X} XX } X X8RXXEpj6 d / `7i` Y Y, PYPYr@i YYW6 d /8`7i` YY, ЎYЎYr@i Y Y6 d /m4`7} XX1` X XAXX-*Q6 d /;} eZeZ1`0eZ0eZ@AeZeZO:=6 d /,* ,ps aa 0a0aHa6 d /Z) 1e 3a3a1 4a4a `4a`4aT96 d /vj> 1,( `a`a | @a@aW[@ a a6 d /7 ,D% dd^- ddXse ddءH6 d /Xt @`!H`B````j ``yC` ``qEh6 d /+``, gg4 PgPg7@i ggP`6 d /ݩN*ffj@*ffC*pfpf H6 d /G,F dd ddpdpd6 d /ki K,@ U dd@ dd̝@d@d36 d /G,r *e*e}o P%eP%e 'e'e|#P6 d /Q,)6 d d>+dd+jq6 d /N@@`nucuc/ vcvc` 9pvcpvc ^6 d /: @<L& d dpdpdD6 d / 1``z ````ː6 d /1F& ``:/`eP`P`1` `` 6 d /pb 1-U `` .e ``e @`@` ,6 d /൳=ps +cc^C6 d /^ T0r HcHc> GcGcV @Hc@Hc٤6 d /M )Br ecec> ecec dcdc>A6 d /`Hr P8P8{= @8@8 Х8Х8f 6 d /+. p9p9% 9 9~' 9 9tD6 d /Z~@i 7O7OB7O7O"`9O`9OMQ:f6 d /~@i ]O]OB_O_O"@^O@^O<')6 d /o@F& PIPI:/`eII1` @I@IZc6 d /Ɯ @ r S S% lSS'` SS<6 d /ٜ@ r %S %S% ^#S#S'@ SS\6 d /( Zu`3 [ [ 3[[ 3Я[Я[.776 d /| F& PmSPmS:/`emSmS1` @nS@nSW6 d /  F& kSkS:/`e`lS`lS1` lSlS6 d / qF& `I`I:/`eII1` PIPI@6 d /qI I IIIPIPIUڃ6 d /M F& PDTPDT:/`eDTDT1` @ET@ETW9 6 d / uS uSrSrS6 rSrS.6 d /J r SSv SS/` SSf6 d /v@u2r 0Q0Qv PP/ PPPPK6 d /:2r 0Q0Qv .Q.Q/` ,Q,QF>j6 d /f@v2r `Q`Qv` psQpsQ/` rQrQUK6 d /v2r QQv @Q@Q/ QQI6 d /J-2r 0Q0Q/ ЎQЎQ 2Q ДQДQ[6 d /2r QQv QQ/ @Q@QY#6 d /H2r QQv pQpQ/ `Q`Qe#d6 d /];2r QQv QQ/ @Q@Qz6 d /9 _2r QQv QQ/ `P`PR٠P6 d /3;2r PPv PP/ PPPPA:6 d /P 2wb 0NQ0NQs LQLQWe NQNQɔ6 d /p@ L QQ|`# QQe RRO6 d /@@O L RR y RR{{26 d /[ `3r IIv II/` IIЍ|V6 d /p3r IIv II/` IIR6 d /@3r J Jv` `I`I/` II[(6 d /rK A3r IIv` PIPI/` IIs6 d /bC/ UU UU pUpUIA~6 d /an9 0U0Ur@i @U@U+@ UU6 d /bj Zr@i PUPUn UUUUyf6 d /8 Br TUTUv @TU@TU/` QUQU56 d /?Br P[UP[Uv ZUZU/` XUXUC(u6 d /q cBr XUXUv WUWU/` VUVU@R6 d /p@F& 'J'J:/`e@(J@(J1` (J(Jm6 d /xd! LL-@i LL{@i  X6 d / F& @1@1:/`ePA1PA11` A1A1]6 d /8  ExNؠ6 d /Dõ 5.5.S" ! #x6 d /.Nps pe   e p!6 d /$ r@i KKR0 0L0L05KK@q6 d /$ r@i LLR0 0M0MPy5LLF'6 d /Vd2sPy5M6 d /Fh t G1 0 0 j 櫼6 d /&M,%ps pe  e pp6 d / DZ,%ps PPpe  e ``Edt6 d /t+N,%`  &  @@ Q6 d / ȱ,%ps pe  e  96 d /,%ps pppe  e @@{6 d / ,%|M weT6 d /,%F& @@:/`e1` 00A%6 d /)&k,%F& :/`eгг1` /}k6 d /` ,%z ` *` ``V}6 d /j(r@i x)x)05@v)@v) @y)@y)Inn6 d /)@(F& H'H':/`eJ'J'1` I'I'6 d /I(ps V*V* PW*PW*Ha W*W*T6 d /' h( l 6 d /T( %%s@i P%P%Py5@%@%q@6 d / V(r `X*`X*. 0%0%2 X*X*n.p6 d /W(ps p%p%pe Ц%Ц% e %%66 d /WHh(D ,','8*'*',','=6 d /i Y(d %%H г%г%dQ `%`%YU26 d /T (F& Pn*Pn*:/`en*n*1` @o*@o*6 d /( P'P' ''Ha @'@'66 d /( ' 'Ha @'@'wB@'@'GS36 d /x( ''Ha ''wB''86 d /cY(ps g)g)pe pg)pg) e @g)@g)j6 d /p(r@i z*z*05`z*`z*jtz*z*}6 d /i q(ps `*`*pe ** e **MO6 d /I˱`05`2$`2$oG 0$0$Ve 1$1$6 d /- ps LLpe NN e MMM6 d / ` \ \ p\p\s [[6E26 d /? ͱHrd 66Py5664o)g6 d /jz + 4; DKe6 d /, h} u !![6 d /D α h} u ``>6 d /б80` ++>VM.6 d /x "F& pQ,pQ,:/`eQ,Q,1` `R,`R,V6 d /h 7Hݣ6 d /, ѱF& ++:/`eP+P+1` ++΄6 d / y6Q]6 d /0i!  C#  + VDt6 d /T`y`6`6"5@ 6Ң#6 d /|`W(PP2++ ?6 d /#`.{e pvpv +uu8@u@u6 d /i kX 6 d /s /(//6//`w6 d /2t-| tق6 d /s |B4e 7  q6 d /2 6 d#y ^6 d /X*s@@p< 6 d /i*- 0 ))ly6 d / ױ,F& u u :/`e`u `u 1` u u /|p6 d /^ 0 ! p p  b` `  6 d /k, ,d  2 `s6 d /,  ps pe pp e z 6 d /`,13w38` LP6 d /ݱ ʠ `y 00`y :9.6 d /ޱ $8LL@P@P6 d /Z)ʳ` e P*$P*$1 *$*$ +$+$T96 d /vj ` ,( # # | ##W[@ ##agithub.com/MottainaiCI/mottainai-cli/vendor/github.com/MottainaiCI/mottainai-server/pkg/namespaceagithub.com/MottainaiCI/mottainai-cli/vendor/github.com/MottainaiCI/mottainai-server/routes/schemaagithub.com/MottainaiCI/mottainai-cli/vendor/google.golang.org/genproto/googleapis/api/annotationsa*[2]struct { c unsafe.Pointer; elem unsafe.Pointer; kind uint16; pc uintptr; releasetime uint64 }a*[3]struct { c unsafe.Pointer; elem unsafe.Pointer; kind uint16; pc uintptr; releasetime uint64 }a*[4]struct { c unsafe.Pointer; elem unsafe.Pointer; kind uint16; pc uintptr; releasetime uint64 }a*[5]struct { c unsafe.Pointer; elem unsafe.Pointer; kind uint16; pc uintptr; releasetime uint64 }a*[6]struct { c unsafe.Pointer; elem unsafe.Pointer; kind uint16; pc uintptr; releasetime uint64 }a*func(*dynamodb.DescribeGlobalTableInput) (*request.Request, *dynamodb.DescribeGlobalTableOutput)a*func(context.Context, *pubsub.ModifyPushConfigRequest, ...grpc.CallOption) (*empty.Empty, error)a*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.Delete, error)a*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.Insert, error)a*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.Update, error)a*func(context.Context, string, interface {}, ...*options.DistinctOptions) ([]interface {}, error)a*struct { F uintptr; count int; esize uintptr; eequal func(unsafe.Pointer, unsafe.Pointer) bool }a*struct { F uintptr; msgs *runtime._panic; gp *runtime.g; pc uintptr; sp uintptr; docrash *bool } AllowAliasUprotobuf:"varint,2,opt,name=allow_alias,json=allowAlias" json:"allow_alias,omitempty" OneofIndexUprotobuf:"varint,9,opt,name=oneof_index,json=oneofIndex" json:"oneof_index,omitempty" / d /`}3a`s cF@ F7d cF F9 dF F d /`zq4pp 'C8`&(ep/N0f`{04 3b3Ӗ2 ٍ d /0@DPF& "c":/`e"0c"1` "c"  J d /DPF& "a":/`e0"a"1` "0b"3Y d 0tn$@EPf|P4Җx& m/Pt`}P$4``&` yP/_U}`$4\p`pP/@Mv4M0c00 0 _UVG/l` `4Ƙ`dՖ d /9` 4hȖՖu/> W` 4M0c00 w0 7Դ/e.@~4}0~0H0 }/v.I`4P0˙0 0 +(/_ $40#00 jq@/O 7`4Nzb඲֫P/qM``d4,WԜqUB d /'W```d4[@ =`/ 34Ֆ_}0x0 rZP/`34Ֆ+`&LDx/,@94P0U06ә' x5 d /3-Y0'z@9#4 ~' ( pp(q d / @84P` pX '0 '@ d /k`@4Ė`&@! 1  /@Q@@4x hۆv; n_ d /{`04;"i@ߜTT„r  d 2 14Yq0  pX2Vb d /<` 14@+0}Ī/" 14—0v`&`&;/` 14Ֆ0}0$0 $ d / 14Gś@@1@0,$j+9 d 0l@` 14a`ܚ@(Ҥ@lv d / 14r0"1tȖ/d@` 14 09ݚ0/0 \=5ؖ/8 14; 000FaȰ01n@` 14 4`|%8To d /q@ 14 0.@r"(# d /$l` 14@ (LDU薖/ 14ޚ`.100  d /.` 147Y '&ś 'Z9 XXĺ d 2  14Yq0  p/6 /#@` 14}f%00 Pq d /g, 14Ȁ0W2(tr d /]``400rp@ ,?P/+$@A4`&x`&T`& "@/@`@A4w`&u`&`w0noNe d /$@h~.4br`&`&c ³5 d /6c0޴@l0@@ pFpF e 0F0F刎 d /[@4Rǘ0}@d(TTO d 3`@4޴T adA<-/࠮@4Rǘ0 0d XX|h} d 35`@4޴ ad d 6࡮@4޴З ad( // `@4\0L)00 VQؗ/q@ࢮ@4Q 0I 'd 씩 d /b @`@40ٯ`&N@Va_ d /(c࣮@4<}0}U_"(6(/r`@40ޖ dpx8/o@म@4 ɗ` @d Rc d /c@`@4&@&;x -s d //>८@4y0{G0,@ $該 d /@`@4d@w@x@0$}붤 d /cম@4ߖ@&@@@0 ~И/`@4tM;E;d'uؘ/U৮@4Yq0Ö;dB/:/`e"?Ж>1` P#? >T:Й/W/ .౮ 4h͖`& VӖ' 0 d /7`@46Ǜ0w4篚&/0 .ಮ43`&{00 ؅ d /5.`4`0h͖ҟi;( s d /"p`BF& 0 32:/`e 321` 32%C8] d /pap` 4otΥe`)0 H/I(മ74P0&};{; ) d /!```4i0;h͖`&(T/Lq@/൮@4028 P}hȚ/.@`4 ;PF; ,$: d 1ථ4Ճ(r@@$$Md1@f`4|XxÖ0('8$$Qu2 d 1H෮4>W聖@ @`P/u`%4}6>@͖4 mH/ฮ/40G;P;ND5 d /|+uQ D% @`:@`: .`P`a:`a: 6 d /`@Y@*F& e:/`e`f1` e/n` 4_ۖ`&0A`&ۅH/iຮN40%!`&G`&8h/t`N4m2Ɩ08Ɩ; SU p/Zu໮N4 ė`3}!;;~dx/@v`N4  3J2ז;  9hr/~༮N4ԗ0m0m; :/`N4]2 3$M2 ./e @཮N4]2 3$M2=M/8`N4Ɩ0  3A 3VgМ/@ྮN4m2Ɩ0ږ;$& d /` !4Z@WpU0$? d /3࿮ !4x#p0/.\ n®4/@TpӖ 6Ry ' >p d /h@`î4 ۢX`֖ۢڢF/?&î 40 'XÖ; v*4P/L``Į;4ٚGʧߖ P/Į;4Ηͧ&`!)M8/YL`Ůp4p'p;?y`W d /@Ů N4@Ȗ}v`& OY d /Dm`& NF& ww:/`e ww1` wwcm/d@Ʈ74Gʧߖ;xY; yl /@`Ǯw4q0s(0 #0 ;W/ll@ǬǮw4h00@a (( >a d X0j`ȮY4U Y 'I ( GP/ȮY4Ηͧ)&`!Y d /)൭`ɮe4,p@ypr`3o 3 d /#൭ɮe4,pyp`r`3؞/%O`ʮW4ZBdykʩU/OʮW4ZBdykʩ xV/@ڬ`ˮ4n 0{5Ɩv #" d /`NF& `1}!}:/`e1}0"}1` P2}@!} +Ȣ /`̮N4;c3`&X`& d /(@̮N4Xp`&A@ڧ l d 0 `ͮN4ɖI Ƙ Wڧ0 \h d /(@ ͮN4Xp`&A@ڧ $% d /r `ήN48ҟEKҟhҟ0 Ap0/%1"ήN4Ė`&I}`&j֖0YAH/B$`ϮO40# `&P`&*b譖/Rj$ϮO4Hy퉗y`& Ş d /,$`ЮO4{Ԗ`&) Ů d /hvЮ 4Ֆt`&S`& ¯ d 406@&`Ѯ`&4ɖB|Xr880 d 2N,'Ѯ`&4́$xP5X d /d@'`Ү`&4– 'wB͗٥ ,,'qc% d ~0'Ү`&4\ʗۖW0  d /ŵ)`{`Ӯ`+4חr 5@ ~*B d /$)oӮ4.:@v< ̠ p=q d 20H-`Ԯ+40(f~8ɱu d /w{Ԯ+4Ж@ӟ(+`&`&  d /\d3 %f -W`!WG1d -WP"W1A.W#Wx2X/ `ծ`4PsxŅqX/ ``֮`4tpxpP|p G d /Tn`f!1a L L35 `LL0 LL YP/f@3`׮!4R@w |/};׮4z [`T 3 B+2P/]#4`خ04``ܮ`74R `&N`&1`ަ !P/֭``ܮ`74pp $bs d /h+>``ݮ`748Ζig0,N0/ݮ`74Ֆ0Xv0|—0 !"8/3 `ޮ`74ϙ 30> 0٤ d /Aޮ`74-0Y;D*G d /4B`߮`74@Cxp,W $-"` d /RB߮`74@CB˜,W0 Iv d /C```74R `&|y;z`Ǣ ~w/^ G``740m0m 3 {P/```74XΖ҃rznS/8```740҃rzm d /_)`;49ז0}0(| d /@N;4HD}Ö 30 ul/`'4:v 0A`& Q"`D4.;p?p uDK  d /#D4`d@ȟp( iH裖/! ` 94p@ XYS;  d /o`@F& PI`xI:/`eIxI1` @I yI @ d /@`y4ޝq%tХ R. d /8^dy40b`*ӗu( j/<$` 4}~X– 3(_ۖ`30 wS+ d /|` F& PmS`JS:/`emSJS1` @nSKS i d /  F& kS\S:/`e`lS0\S1` lS\Ss/$` q4p`yf H d /`qF& `II:/`eII1` PI@Ik/`8/f#۬48ϖ`g 2V d /M``.F& PDTS:/`eDT@S1` @ETSPV d /4ҖҟFҟ `&0S8x/J``4pܸd| \Vc$$&D024}~ '(zV8,@S />n`240 X00s\0ɫ2405}$$N Фt0@`240PÖ0 RG褖/2405}~ е d /`24%ЖG  d /H24%dHQ}) d 4P`24ǟ0 t p0/J'@4 5vv8Uݢ(/Fo&@ܬ`@4s`H`MdyuN'50/g@ܬ@4pgp\{K kRS@/'ܬ`4xྷ%';/mh/(@74ޖ@ޖ@i(Ȗ`  >2H/bj``Z4Q`i);; d /{Qy4m0aHXC~K d /8`B4 ǟx?   d /?`B4p`Ƹp \pǟ<<[TN2W`)`[4ߖ r`dXp@hߨYn d /Yk=4[;I#K $$i  d 1]*`=40 Zt Z dJ@ ߮ d /p` d@F& 'J!J:/`e@(J`"J1` (J!J n d /` 9F& @1`0:/`ePA101` A10p d /04Iz̟M`& Œ' d /T`4h͖`& p81DP/4h͖`&`&`& 3v d /\l@R`q4vޖ`&׀Q Yg/pq4Hɖ`&Yؖ`& a>1 d /jl S`q4vޖ`&׀Q >#V d /xlTq4vޖ`&׀Q K4P/3+t` $4p 3p 3p&Z d /+ 4Җ`3hі 3Ӗ 3HY(/l@` 4w'u ޖ; M d / - 4bx`ϖ`& `& _)zذ/Fh@` 4.|`&DŽ`&v|Y[`/|f 4p@x*0s3 mK h/ef` 4Ws:;tӣx d /O ݙ  4q4 _O d /$m` ,%4cq`Ʒn`&ς0  - d /Bm ,%4cq`Ʒn`&ς0 J@ d /`j,%|M@ @  T d /`  ,%F& @:/`e01` 002 d /`` ,u`,%4΄Tɖ; :X/Jm0,%4ǖ(]3xŖ3bখ/8@1`,%4ۖ`W]3xŖ3 TPQ d 3\&@#!,u,%4֖  00O7 d /ަ,u`,%4a  00 O|  d /#((4Rsرp!08͖;8 d /(`(4 tgatJ/j`((48`2'00* /(`(4FZu@D 1X/ 7(4 `&Î`&:ߚ; /b@(`(4pB@dy_x/((4Fgu@DP? d /1(`(4zet &\l`+ V d /~;((4pkdyK9 s d /T ``^(F& Pn*/':/`en*p0'1` @o*/' d /((4)= 3pD`;  >m/(>(`(4p`&dyp3 ]C d /Zc@(40cq`Ʒn`&( $хP/)?(`(4\{  r왗z d /$@4ٟuxG;(  d /!+`4dp4 yAxu$| d / +4Rsvr2 *}4`/-``4q0w0u  pop/4{?070(; LZg/`` 4q0/0u &P/J!p 4{`&-`ܞ{[ d /mBp` 4xn`&[`&  X d /`|,4p0xp`&($O~د/d9#`4pіǵ2@F72D0(.q d 1'#4pіǵX `s@ @H z?4P/G`4} 4Fv`&zu`& Q7PP/4``sd|`30(¦b d 1Vq4#`4pіǵX `s@HCب/(I4q 4q 4d|\TK d 3(~#Ԗ` 49Rsv Rv=ਖ/lq` Ԗ 4pɖ;&{`& cS訖/nIԖ`!4s 3Jx;&{`&H. d /qJ!4~Ȗ`&;ۖ`& z d /x&F& pQ,+:/`eQ,+1` `R,0+ d /{"4~Ȗ`&;ۖ`& H0d d 0h``#4@b +;6Rɘ d /@N#4{@h '}3( 6 /1@N`$4䂖3I;@ P/wPO$4p`W:|r 4($| 1P`%4d|ȵsô@x3H !5P/XS%4ۆ` p 3_ߐб/˳ `&4"3 H? 0(@Ć d 1E W&4d|ȵb  t@HVD^ `'43ʖ3F P/'433Ry3 P/X`(4Q7Y `hMh/PsZ(4ܢ00~@ EDP/\`)4=3z&p|& [DP/0)4ۆ` (Ӗϖ 3 3P/*_`*4ɖ 4z`&x`&Y=/_*423 8$e, d 2w `+4CxA@;`ȉ`&h >=/D`+4p&g&* ʡ b/yP/,ja`,4xҖ<&3 3 P/'`,4` td|ô3 t}FP/c`-4xӖ336*3̖/i*-43Ry3xΪ̯Щ/`.47~0v0u  ੖/.4`3y`&z; dP/4f`/49422*`&/k`# /4p0p 'C8`& (QR d 0^`04  رxq`&H8  ֡P !\) d Ap04 0ח`ԡҟ $6~ d /R@|`1,4 '@ӟƖv) KP/z1 4P` ` &UH/#@ `2 4n`&|` D{ ܘgP/02 4—`&tؖ`&`& Mཌ/ mf`34`&Ӗ`&慖;92P/,@|3,4`0`&͖;\Y7譖/7@`404wq 3Tq 3 Ö`2h/404wq2Tq2ޖ2 P/`504wq 3Tq 3ޖ 3r3O d /bx504wwjʗ`&0خ/`6 4@. 5–`4M[+/$l@`6` 4+_b3|3 *Y d /@^`74Ӗ2 s3r3\ d /`z@N7@ 4Җ5;2\ X d 8=* [`8 4t ͵p@xm. d /P@[8 4Ӗ2 s3r3bgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/private/protocol/xml/xmlutilbgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/fsouza/go-dockerclient/internal/jsonmessageb*func(*dynamodb.AutoScalingSettingsUpdate) *dynamodb.GlobalTableGlobalSecondaryIndexSettingsUpdateb*func(*dynamodb.DescribeContinuousBackupsInput) (*dynamodb.DescribeContinuousBackupsOutput, error)b*func(*dynamodb.RestoreTableToPointInTimeInput) (*dynamodb.RestoreTableToPointInTimeOutput, error)b*func(*dynamodb.UpdateGlobalTableSettingsInput) (*dynamodb.UpdateGlobalTableSettingsOutput, error)b*func(context.Context, *dynamodb.GetItemInput, ...request.Option) (*dynamodb.GetItemOutput, error)b*func(context.Context, *dynamodb.PutItemInput, ...request.Option) (*dynamodb.PutItemOutput, error)b*func(context.Context, *pubsub.CreateSnapshotRequest, ...gax.CallOption) (*pubsub.Snapshot, error)b*func(context.Context, *pubsub.ModifyAckDeadlineRequest, ...grpc.CallOption) (*empty.Empty, error)b*func(context.Context, *pubsub.PublishRequest, ...gax.CallOption) (*pubsub.PublishResponse, error)b*func(context.Context, *pubsub.UpdateSnapshotRequest, ...gax.CallOption) (*pubsub.Snapshot, error)b*func(context.Context, interface {}, ...*options.ChangeStreamOptions) (*mongo.ChangeStream, error)b*func(context.Context, interface {}, ...*options.InsertOneOptions) (*mongo.InsertOneResult, error)b*struct { F uintptr; c *pubsub.PublisherClient; req *pubsub.GetTopicRequest; resp **pubsub.Topic }b*struct { F uintptr; streamingPull pubsub.streamingPullFunc; ctx context.Context; subName string } ActiveAnonVjson:"active_anon,omitempty" yaml:"active_anon,omitempty" toml:"active_anon,omitempty" ActiveFileVjson:"active_file,omitempty" yaml:"active_file,omitempty" toml:"active_file,omitempty" BlkioStatsVjson:"blkio_stats,omitempty" yaml:"blkio_stats,omitempty" toml:"blkio_stats,omitempty" IsOfficialVjson:"is_official,omitempty" yaml:"is_official,omitempty" toml:"is_official,omitempty" MappedFileVjson:"mapped_file,omitempty" yaml:"mapped_file,omitempty" toml:"mapped_file,omitempty" OnlineCPUsVjson:"online_cpus,omitempty" yaml:"online_cpus,omitempty" toml:"online_cpus,omitempty" TotalCacheVjson:"total_cache,omitempty" yaml:"total_cache,omitempty" toml:"total_cache,omitempty" TotalUsageVjson:"total_usage,omitempty" yaml:"total_usage,omitempty" toml:"total_usage,omitempty"c*func(context.Context, *pubsub.CreateSnapshotRequest, ...grpc.CallOption) (*pubsub.Snapshot, error)c*func(context.Context, *pubsub.DeleteSubscriptionRequest, ...grpc.CallOption) (*empty.Empty, error)c*func(context.Context, *pubsub.PublishRequest, ...grpc.CallOption) (*pubsub.PublishResponse, error)c*func(context.Context, *pubsub.UpdateSnapshotRequest, ...grpc.CallOption) (*pubsub.Snapshot, error)c*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.Distinct, error)c*func(context.Context, description.SelectedServer, wiremessage.WireMessage) *command.CountDocumentsc*struct { F uintptr; s *reflect.sliceHeader; size uintptr; typ *reflect.rtype; tmp unsafe.Pointer } ArgsEscapedVjson:"ArgsEscaped,omitempty" yaml:"ArgsEscaped,omitempty" toml:"ArgsEscaped,omitempty" AttachStdinVjson:"AttachStdin,omitempty" yaml:"AttachStdin,omitempty" toml:"AttachStdin,omitempty" BindOptionsVjson:"BindOptions,omitempty" yaml:"BindOptions,omitempty" toml:"BindOptions,omitempty" BlkioWeightVjson:"BlkioWeight,omitempty" yaml:"BlkioWeight,omitempty" toml:"BlkioWeight,omitempty" ContainerIDVjson:"ContainerID,omitempty" yaml:"ContainerID,omitempty" toml:"ContainerID,omitempty" DescriptionVjson:"Description,omitempty" yaml:"Description,omitempty" toml:"Description,omitempty" DescriptionVjson:"description,omitempty" yaml:"description,omitempty" toml:"description,omitempty" DestinationVjson:"Destination,omitempty" yaml:"Destination,omitempty" toml:"Destination,omitempty" GraphDriverVjson:"GraphDriver,omitempty" yaml:"GraphDriver,omitempty" toml:"GraphDriver,omitempty" HealthcheckVjson:"Healthcheck,omitempty" yaml:"Healthcheck,omitempty" toml:"Healthcheck,omitempty" IPPrefixLenVjson:"IPPrefixLen,omitempty" yaml:"IPPrefixLen,omitempty" toml:"IPPrefixLen,omitempty" IPv6GatewayVjson:"IPv6Gateway,omitempty" yaml:"IPv6Gateway,omitempty" toml:"IPv6Gateway,omitempty" MessageIdXprotobuf:"bytes,3,opt,name=message_id,json=messageId,proto3" json:"message_id,omitempty" NetworkModeVjson:"NetworkMode,omitempty" yaml:"NetworkMode,omitempty" toml:"NetworkMode,omitempty" OomScoreAdjVjson:"OomScoreAdj,omitempty" yaml:"OomScoreAdj,omitempty" toml:"OomScoreAdj,omitempty" PageTokenXprotobuf:"bytes,3,opt,name=page_token,json=pageToken,proto3" json:"page_token,omitempty" PortMappingVjson:"PortMapping,omitempty" yaml:"PortMapping,omitempty" toml:"PortMapping,omitempty" PrivatePortVjson:"PrivatePort,omitempty" yaml:"PrivatePort,omitempty" toml:"PrivatePort,omitempty" PropagationVjson:"Propagation,omitempty" yaml:"Propagation,omitempty" toml:"Propagation,omitempty" RepoDigestsVjson:"RepoDigests,omitempty" yaml:"RepoDigests,omitempty" toml:"RepoDigests,omitempty" SecurityOptVjson:"SecurityOpt,omitempty" yaml:"SecurityOpt,omitempty" toml:"SecurityOpt,omitempty" StartPeriodVjson:"StartPeriod,omitempty" yaml:"StartPeriod,omitempty" toml:"StartPeriod,omitempty" StopTimeoutVjson:"StopTimeout,omitempty" yaml:"StopTimeout,omitempty" toml:"StopTimeout,omitempty" SysInitPathVjson:"SysInitPath,omitempty" yaml:"SysInitPath,omitempty" toml:"SysInitPath,omitempty" UnevictableVjson:"unevictable,omitempty" yaml:"unevictable,omitempty" toml:"unevictable,omitempty" VirtualSizeVjson:"VirtualSize,omitempty" yaml:"VirtualSize,omitempty" toml:"VirtualSize,omitempty" VolumesFromVjson:"VolumesFrom,omitempty" yaml:"VolumesFrom,omitempty" toml:"VolumesFrom,omitempty"dgithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/utils/merkletrie/internal/framed*func(context.Context, *sqs.AddPermissionInput, ...request.Option) (*sqs.AddPermissionOutput, error)d*func(context.Context, *sqs.DeleteMessageInput, ...request.Option) (*sqs.DeleteMessageOutput, error)d*func(context.Context, *sqs.ListQueueTagsInput, ...request.Option) (*sqs.ListQueueTagsOutput, error)d*struct { F uintptr; buf *bytes.Buffer; cmd *cobra.Command; localNonPersistentFlags *pflag.FlagSet }d*struct { F uintptr; haves map[plumbing.Hash]bool; toVisit *int; remoteRefs map[plumbing.Hash]bool }d*struct { F uintptr; input *dynamodb.DescribeTableInput; c *dynamodb.DynamoDB; ctx context.Context }Commit\json:"commitbytes,omitempty" yaml:"commitbytes,omitempty" toml:"privateworkingset,omitempty"DelayedTasksPollPeriodLyaml:"delayed_tasks_poll_period" envconfig:"REDIS_DELAYED_TASKS_POLL_PERIOD" JavaPackageWprotobuf:"bytes,1,opt,name=java_package,json=javaPackage" json:"java_package,omitempty" MessageTypeWprotobuf:"bytes,4,rep,name=message_type,json=messageType" json:"message_type,omitempty" StringValueWprotobuf:"bytes,7,opt,name=string_value,json=stringValue" json:"string_value,omitempty"Tags^locationName:"Tag" locationNameKey:"Key" locationNameValue:"Value" type:"map" flattened:"true"egithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/protocol/packp/sidebande*func(*sqs.ListDeadLetterSourceQueuesInput) (*request.Request, *sqs.ListDeadLetterSourceQueuesOutput)e*struct { F uintptr; c *pubsub.PublisherClient; req *pubsub.UpdateTopicRequest; resp **pubsub.Topic }e*struct { lock runtime.mutex; next int32; m map[int32]unsafe.Pointer; minv map[unsafe.Pointer]int32 }Entries\locationNameList:"SendMessageBatchRequestEntry" type:"list" flattened:"true" required:"true" IsExtensionXprotobuf:"varint,2,req,name=is_extension,json=isExtension" json:"is_extension,omitempty" RubyPackageXprotobuf:"bytes,45,opt,name=ruby_package,json=rubyPackage" json:"ruby_package,omitempty" SwiftPrefixXprotobuf:"bytes,39,opt,name=swift_prefix,json=swiftPrefix" json:"swift_prefix,omitempty"ܖ/I`.Y`(hp`dp`05GBr菖/~#1Y$(v0l ps *!$B d /@[tZ$88 0 @1 t/x2Zb(௷~0ps pp-z d /@l[8"g `7 Z` u  *ǒ d /@[(ޖ0~^-h 8'8J3 d / 0000;;0))) ȹxx'- d /0\@8I- ps v@i ^ %BL/[<Y]@(vܖ`/ޖg05q@qx//t`L](w`26e ppp | d /Ia^A(vܖ`@05 lF mF D? d /b^A(ߖ@@Py5lFmF 2H/_b_.(0q( 0~1 b1CH/c@9_@({gXʖ`3r@i ~HHl5 d /Ȃ`8@ |`  8w  d /`8|` ;  8w l5 d /Ȃ .a 8 |@`  8w C/ޥka(ȖV 0(7 11 S| d /kb( M)7 @101 :/fb(. $RǨr pkc  d /c*(cq`Ʒ, @kp /'qj{c+(`0g0ps 06`5]/z*md;(vv0(ps p"MMv3 d /P` !yN>N Q0 0 ~"/@oe@O(v0&ps ۄ d /te6(3}hs `vvPl@/@uf6(I}ǖ' vvt d /^`vf6(lp 3Dp 3hs vPvݭmIp/Hvg (MШ ps P؉W d / wg (Vȧ՗ps ىYeͺ d /#wh (tHX 'M ؤ/mwh (ɖ'ups pz  d /yi (Vȧ՗qps 0T DP/q;@~i/(Hږ0. 6ps @|@|{ ]`/3`j N(Hږ0. 6ps `wTw ah/ j N(:v0. 6ps w'w d /_k7(Vڧ՗ps L Cגx/c>k7( ז'Gʧba @N" ;sT/@l7( ז'Gʧba pO`" z d /`lW(0%Ips @~b1k/ mW(0Vps  ~v/Rnm( 0Vps z0@ S8/8n(.`0ps @}P}J d /ˈ#n8x4F& > @i T`/o`&(ɖ'( @2hp,hI8~ d /h*oo8 `Dz| { e \Z p/`p`7(ߖ@ r 9Py50Yp.Z ff6(/p ,(I}`@ܖ0ps @a;a ep/ceq(p0p0 0g gCq_ d /,#`q,(P@Hږ@` / |r,(;~z' @e`e&# d /Ÿar8:`? > Ȃ` pCM d /fws'8pr@ . ,? zb  d /\ls18O  T  6  OТ/t(0y'ps VI"IQDR d /{t8  .` u x "/  ۬u (ߖ@yPy5`bSpkS /vu2(L?p`r 0QQ/"Ȥ/5-@v2(L?p`r QpQRख/fv2(L?p`r `QQW~/`w2(L?p`r Q@Q*\ d /]@@w@78r@i x@i 4B   AB ?/* x(vܖ`05JpJI֭/k` x(ߖ@Py5JJK d /$, y=(0~KqK TJ+J7: d /. y!((uÖps pLPL/ d /*|z,8 8w 1 't Py5Д[ d /0z b(Xɖ$p30 3JJ C d /K&,u{,%(0,ڟ3e Td d /*3({(8r@i 05bN1 _1` ® d /8(|(8İ4 r@ ;4 & 0@ Zw/`|((I}Pܖ0ps Pd*% ^৖/(}((p@dyœPy5p*i&\+M d /̫(}((ppd w*pW(WN d /IԖ~8Be  R h}`,9c/v ~(0ups U, d /m@@@P8^- K .2 :@T "Ӊ/ (}ҡٖ3 @Y d /V*  (r`Ʒx0~w^$ V$f*func(*dynamodb.DescribeGlobalTableSettingsInput) (*dynamodb.DescribeGlobalTableSettingsOutput, error)f*func(*tls.Config, *tls.clientHelloMsg, *x509.Certificate) ([]uint8, *tls.clientKeyExchangeMsg, error)f*func([]*dynamodb.ReplicaGlobalSecondaryIndexSettingsDescription) *dynamodb.ReplicaSettingsDescriptionf*func(context.Context, *sqs.ReceiveMessageInput, ...request.Option) (*sqs.ReceiveMessageOutput, error)f*func(context.Context, []interface {}, ...*options.InsertManyOptions) (*mongo.InsertManyResult, error)f*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.KillCursors, error)f*func(string, string, string, map[string]*parse.Tree, ...map[string]interface {}) (*parse.Tree, error)f*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.PullRequest; resp **pubsub.PullResponse }f*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.SeekRequest; resp **pubsub.SeekResponse }f*struct { F uintptr; fn **runtime.funcval; argp unsafe.Pointer; siz int32; gp *runtime.g; pc uintptr }f*struct { F uintptr; ws *http.http2priorityWriteScheduler; wr *http.http2FrameWriteRequest; ok *bool } DoubleValueYprotobuf:"fixed64,6,opt,name=double_value,json=doubleValue" json:"double_value,omitempty" IsAutomatedYjson:"is_automated,omitempty" yaml:"is_automated,omitempty" toml:"is_automated,omitempty" MemoryStatsYjson:"memory_stats,omitempty" yaml:"memory_stats,omitempty" toml:"memory_stats,omitempty" PercpuUsageYjson:"percpu_usage,omitempty" yaml:"percpu_usage,omitempty" toml:"percpu_usage,omitempty" TotalPgpginYjson:"total_pgpgin,omitempty" yaml:"total_pgpgin,omitempty" toml:"total_pgpgin,omitempty"ggithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/protocol/packp/capabilityggithub.com/MottainaiCI/mottainai-cli/vendor/gopkg.in/src-d/go-git.v4/plumbing/transport/internal/commong*func(*dynamodb.RestoreTableFromBackupInput) (*request.Request, *dynamodb.RestoreTableFromBackupOutput)g*func(context.Context, *pubsub.GetSubscriptionRequest, ...gax.CallOption) (*pubsub.Subscription, error)g*func(context.Context, *pubsub.ListTopicSubscriptionsRequest, ...gax.CallOption) *pubsub.StringIteratorg*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.Subscription; resp **pubsub.Subscription } AttachStderrYjson:"AttachStderr,omitempty" yaml:"AttachStderr,omitempty" toml:"AttachStderr,omitempty" AttachStdoutYjson:"AttachStdout,omitempty" yaml:"AttachStdout,omitempty" toml:"AttachStdout,omitempty" CapabilitiesYjson:"Capabilities,omitempty" yaml:"Capabilities,omitempty" toml:"Capabilities,omitempty" CgroupParentYjson:"CgroupParent,omitempty" yaml:"CgroupParent,omitempty" toml:"CgroupParent,omitempty" DriverConfigYjson:"DriverConfig,omitempty" yaml:"DriverConfig,omitempty" toml:"DriverConfig,omitempty"Entries^locationNameList:"DeleteMessageBatchRequestEntry" type:"list" flattened:"true" required:"true" ExpireTime[protobuf:"bytes,3,opt,name=expire_time,json=expireTime,proto3" json:"expire_time,omitempty" ExposedPortsYjson:"ExposedPorts,omitempty" yaml:"ExposedPorts,omitempty" toml:"ExposedPorts,omitempty" HostnamePathYjson:"HostnamePath,omitempty" yaml:"HostnamePath,omitempty" toml:"HostnamePath,omitempty" KernelMemoryYjson:"KernelMemory,omitempty" yaml:"KernelMemory,omitempty" toml:"KernelMemory,omitempty" MessageIds[protobuf:"bytes,1,rep,name=message_ids,json=messageIds,proto3" json:"message_ids,omitempty" MethodName[protobuf:"bytes,2,opt,name=method_name,json=methodName,proto3" json:"method_name,omitempty" PortBindingsYjson:"PortBindings,omitempty" yaml:"PortBindings,omitempty" toml:"PortBindings,omitempty" PushConfig[protobuf:"bytes,2,opt,name=push_config,json=pushConfig,proto3" json:"push_config,omitempty" PushConfig[protobuf:"bytes,4,opt,name=push_config,json=pushConfig,proto3" json:"push_config,omitempty" RestartCountYjson:"RestartCount,omitempty" yaml:"RestartCount,omitempty" toml:"RestartCount,omitempty" SecurityOptsYjson:"SecurityOpts,omitempty" yaml:"SecurityOpts,omitempty" toml:"SecurityOpts,omitempty" Successful[locationNameList:"SendMessageBatchResultEntry" type:"list" flattened:"true" required:"true" UpdateMask[protobuf:"bytes,2,opt,name=update_mask,json=updateMask,proto3" json:"update_mask,omitempty" VolumeDriverYjson:"VolumeDriver,omitempty" yaml:"VolumeDriver,omitempty" toml:"VolumeDriver,omitempty"hgithub.com/MottainaiCI/mottainai-cli/vendor/github.com/aws/aws-sdk-go/service/dynamodb/dynamodbattributeh*func(*dynamodb.AutoScalingSettingsDescription) *dynamodb.ReplicaGlobalSecondaryIndexSettingsDescriptionh*func(context.Context, *dynamodb.DeleteItemInput, ...request.Option) (*dynamodb.DeleteItemOutput, error)h*func(context.Context, *dynamodb.ListTablesInput, ...request.Option) (*dynamodb.ListTablesOutput, error)h*func(context.Context, *dynamodb.UpdateItemInput, ...request.Option) (*dynamodb.UpdateItemOutput, error)h*func(context.Context, *pubsub.GetSubscriptionRequest, ...grpc.CallOption) (*pubsub.Subscription, error)h*func(context.Context, *pubsub.ListSubscriptionsRequest, ...gax.CallOption) *pubsub.SubscriptionIteratorh*func(context.Context, []mongo.WriteModel, ...*options.BulkWriteOptions) (*mongo.BulkWriteResult, error)h*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.CreateIndexes, error)h*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.FindAndModify, error)h*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.ListDatabases, error)h*struct { F uintptr; cmd *vagrantutil.command; out chan *vagrantutil.CommandOutput; wg *sync.WaitGroup }h*struct { F uintptr; t *transport.http2Client; firstTry *bool; ch *chan struct {}; s *transport.Stream }h*struct { ityp *reflect.rtype; typ *reflect.rtype; hash uint32; _ [4]uint8; fun [100000]unsafe.Pointer } DefaultValueZprotobuf:"bytes,7,opt,name=default_value,json=defaultValue" json:"default_value,omitempty" ReservedNameZprotobuf:"bytes,5,rep,name=reserved_name,json=reservedName" json:"reserved_name,omitempty" StatusCode\protobuf:"varint,2,opt,name=status_code,json=statusCode,proto3" json:"status_code,omitempty"Typebprotobuf:"varint,1,opt,name=type,proto3,enum=grpc.binarylog.v1.Address_Type" json:"type,omitempty"i*func(*dynamodb.UpdateContinuousBackupsInput) (*request.Request, *dynamodb.UpdateContinuousBackupsOutput)i*func(*sqs.ChangeMessageVisibilityBatchInput) (*request.Request, *sqs.ChangeMessageVisibilityBatchOutput)i*func([]*dynamodb.GlobalTableGlobalSecondaryIndexSettingsUpdate) *dynamodb.UpdateGlobalTableSettingsInputi*func(context.Context, *pubsub.ListTopicsRequest, ...grpc.CallOption) (*pubsub.ListTopicsResponse, error)i*func(context.Context, func(context.Context, string) ([]net.IPAddr, error), string) ([]net.IPAddr, error)i*func(context.Context, interface {}, ...*options.ListDatabasesOptions) (mongo.ListDatabasesResult, error)i*struct { sync.Mutex; m map[chan<- os.Signal]*signal.handler; ref [65]int64; stopping []signal.stopping } Description\json:"Documentation,omitempty" yaml:"Documentation,omitempty" toml:"Documentation,omitempty" PhpNamespace[protobuf:"bytes,41,opt,name=php_namespace,json=phpNamespace" json:"php_namespace,omitempty" ReservedName[protobuf:"bytes,10,rep,name=reserved_name,json=reservedName" json:"reserved_name,omitempty" Successful]locationNameList:"DeleteMessageBatchResultEntry" type:"list" flattened:"true" required:"true"C d /Nt $pyX& 2!`R1 3! Ru"5/`\5bә0h `(us (usiY0/7\ 5bә0h 2u@s 3usfy+0/ ]5bә0h Rupbt Su btKX/r8] 5bә0h ]ut 0^ut]9/5@^bә0h vv vv<Ɉȕ/ ^ bә0h vv pvvS~/P_bә0h v)v v)vp /q!`_ bә0h pv,v Йv0,v5E8/_bә0h v0Fv PvEv6ptH/= ` bә0h vOv pvNv `/J`bә0h `vjv vjvD h/t` bә0h Pvnv vmv;p/@abә0h `vpqv v qvW[9 d /c @u@ FF e FF=V d /!  w 'r`r@i LpL05pLL& d /)i` ,`&y@ 0e4e#`C e`4e_< d /Ji,(`&y@ e`5e#`C `e4e(}9 d /~c(ݬ nNn9 UU+@ UU~ d /oߖ@r@i `J JPy5JPJ& d /@ vܖ`r@i 05c d /a`(' 3 h*`'Ha i*'D&39 d /ө( (r`r@i &&05&&fi d / (()= 3 q*p'Ha Pr*P'~9 d /H( (s`~ ''Ha ' 'R d /Qp3Nz-Ҋ@t 6q d 0tp3?@p %0 dSQ d /RGp3HΖ?3`&_`& K d 0>p3pHΖ@?@ ( T d )0:p3p:0`Ж@ b{*8   d /`-p3\{`!xp] ( ^T d /[`-p3\{`"xp] (  a d /:`-p3\{`$xp` ( 3 d /`-p3\{`%xp` (.| d /8p30p¸&{`& q( 3s d /p3͖@p_x@(   d /p3͖p_x@( ?x̢ d /p3͖`p_x@( . d /p3͖9p_x@( bgpF d 0@n-p3` ̖'{Ȝ r 9(& d /^zop3p?;&3) ?)(<֘ d /p3d|r) d(& d /^z@p .p3p?;&3`* ?`*(<֘ d / .p3d|rè * d(ɳS d /+_ppp30Ӗ4 ʖ(00;7$ d "14s|p3q@ϖӳ 䂖S($$;x d 0|p3ry& (s@$$7 d 0$t|p3p@y& (@i d /?p3ZFp@Rjt@ e d /Fp3p@R/ rp .sE d 0pp3p@WV (K00(3I d F0 +p3p&{ '0x 3@H,,|7 d *1+]v(p3 hr`@rH\{ Pf/' d /&(p3p`m1`?9 m d /B@x(p3a\{9:@ Fxs d /p3p3d|`@| 4 $v d 0Ԗp3pҖ@tι({0.X^A d /T%p3A5;O;p@3Y d /tp33ɖ3Xp@  D: d /p3{3{3{3x  d d /Rp3d|ô{ 4z33 |* d /N`p 4s 42s3`3 |* d /N`p 4s 42s3`3 |* d /N` cp 4s 42s3`3 |* d /N``}p 4s 42s3`3 |* d /N``p 4s 42s3`3 |* d /N`~p 4s 42s3`3 |* d /N`@9p 4s 42s3`3 |* d /N`p 4s 42s3`3 |* d /N`p 4s 42s3`3 |* d /N`{p 4s 42s3`3 |* d /N`p 4s 42s3`3 |* d /N`¯p 4s 42s3`3 |* d /N`൭¯p 4s 42s3`3 |* d /N`ڬïp 4s 42s3`3 |* d /N`oïp 4s 42s3`3 |* d /N``įp 4s 42s3`3 |* d /N``qįp 4s 42s3`3 |* d /N`|ůp 4s 42s3`3 |* d /N`ůp 4s 42s3`3 |* d /N`Ưp 4s 42s3`3 |* d /N`Ưp 4s 42s3`3 |* d /N`@ǯp 4s 42s3`3 |* d /N`pǯp 4s 42s3`3 |* d /N`,uȯp 4s 42s3`3 |* d /N`(ȯp 4s 42s3`3 |* d /N`ɯp 4s 42s3`3 |* d /N`ɯp 4s 42s3`3  /&|ʯ0\p`p d /˯s͟j j(Җ`"0%|YG̯d`d|` 3p` y A;V/̯;z`;x; `3L譖/8ͯۆ` " H H> HN8 H Ŷ/xͯۆ` WB;  3 asW0 ί@P~LK `10B.2 1B0ί@P~LK p20E.2 3E꯰'0ng ϯ@P~LK 3 J.2 4pJj*func(context.Context, *dynamodb.CreateTableInput, ...request.Option) (*dynamodb.CreateTableOutput, error)j*func(context.Context, *dynamodb.DeleteTableInput, ...request.Option) (*dynamodb.DeleteTableOutput, error)j*func(context.Context, *dynamodb.ListBackupsInput, ...request.Option) (*dynamodb.ListBackupsOutput, error)j*func(context.Context, *dynamodb.TagResourceInput, ...request.Option) (*dynamodb.TagResourceOutput, error)j*func(context.Context, *dynamodb.UpdateTableInput, ...request.Option) (*dynamodb.UpdateTableOutput, error)j*func(context.Context, *pubsub.UpdateSubscriptionRequest, ...gax.CallOption) (*pubsub.Subscription, error)j*func(context.Context, *sqs.RemovePermissionInput, ...request.Option) (*sqs.RemovePermissionOutput, error)j*func(context.Context, *sqs.SendMessageBatchInput, ...request.Option) (*sqs.SendMessageBatchOutput, error)j*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) ([]result.EndSessions, []error)j*func(context.Context, interface {}, interface {}, ...*options.UpdateOptions) (*mongo.UpdateResult, error)j*struct { F uintptr; cs *grpc.clientStream; hdr []uint8; payload []uint8; op func(*grpc.csAttempt) error } InactiveAnon\json:"inactive_anon,omitempty" yaml:"inactive_anon,omitempty" toml:"inactive_anon,omitempty" InactiveFile\json:"inactive_file,omitempty" yaml:"inactive_file,omitempty" toml:"inactive_file,omitempty" StorageStats\json:"storage_stats,omitempty" yaml:"storage_stats,omitempty" toml:"storage_stats,omitempty" TotalPgfault\json:"total_pgfault,omitempty" yaml:"total_pgfault,omitempty" toml:"total_pgfault,omitempty" TotalPgpgout\json:"total_pgpgout,omitempty" yaml:"total_pgpgout,omitempty" toml:"total_pgpgout,omitempty"k*func(context.Context, *dynamodb.ScanInput, func(*dynamodb.ScanOutput, bool) bool, ...request.Option) errork*func(context.Context, *pubsub.UpdateSubscriptionRequest, ...grpc.CallOption) (*pubsub.Subscription, error)k*func(context.Context, interface {}, interface {}, ...*options.FindOneAndUpdateOptions) *mongo.SingleResultk*func(context.Context, interface {}, interface {}, ...*options.ReplaceOptions) (*mongo.UpdateResult, error)k*struct { F uintptr; c *pubsub.PublisherClient; req *pubsub.PublishRequest; resp **pubsub.PublishResponse }k*struct { F uintptr; reqBodyClosed *bool; req **http.Request; resp **http.Response; reqs *[]*http.Request }k*struct { F uintptr; s *filesystem.ObjectStorage; t plumbing.ObjectType; seen map[plumbing.Hash]struct {} }k*struct { F uintptr; typ reflect.Type; unmarshal proto.unmarshaler; field0 proto.field; ityp reflect.Type } DockerVersion\json:"DockerVersion,omitempty" yaml:"DockerVersion,omitempty" toml:"DockerVersion,omitempty" FailingStreak\json:"FailingStreak,omitempty" yaml:"FailingStreak,omitempty" toml:"FailingStreak,omitempty" IdentityToken\json:"IdentityToken,omitempty" yaml:"IdentityToken,omitempty" toml:"IdentityToken,omitempty" OrderingKey^protobuf:"bytes,5,opt,name=ordering_key,json=orderingKey,proto3" json:"ordering_key,omitempty" ProcessConfig\json:"ProcessConfig,omitempty" yaml:"ProcessConfig,omitempty" toml:"ProcessConfig,omitempty" PublishTime^protobuf:"bytes,4,opt,name=publish_time,json=publishTime,proto3" json:"publish_time,omitempty" RestartPolicy\json:"RestartPolicy,omitempty" yaml:"RestartPolicy,omitempty" toml:"RestartPolicy,omitempty" TempfsOptions\json:"TempfsOptions,omitempty" yaml:"TempfsOptions,omitempty" toml:"TempfsOptions,omitempty" VolumeOptions\json:"VolumeOptions,omitempty" yaml:"VolumeOptions,omitempty" toml:"VolumeOptions,omitempty"l*func(*dynamodb.AutoScalingTargetTrackingScalingPolicyConfigurationUpdate) *dynamodb.AutoScalingPolicyUpdatel*func(context.Context, *dynamodb.BatchGetItemInput, ...request.Option) (*dynamodb.BatchGetItemOutput, error)l*func(context.Context, *dynamodb.CreateBackupInput, ...request.Option) (*dynamodb.CreateBackupOutput, error)l*func(context.Context, *dynamodb.DeleteBackupInput, ...request.Option) (*dynamodb.DeleteBackupOutput, error)l*func(context.Context, description.SelectedServer, wiremessage.ReadWriter) (result.TransactionResult, error)l*func(context.Context, interface {}, interface {}, ...*options.FindOneAndReplaceOptions) *mongo.SingleResultl*func(func(int, string) (string, error), func() int, func() interface {}) (*iterator.PageInfo, func() error)l*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.CreateSnapshotRequest; resp **pubsub.Snapshot }l*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.UpdateSnapshotRequest; resp **pubsub.Snapshot }l*struct { F uintptr; emailAddresses *[]string; dnsNames *[]string; uris *[]*url.URL; ipAddresses *[]net.IP } MaxMessages_protobuf:"varint,3,opt,name=max_messages,json=maxMessages,proto3" json:"max_messages,omitempty"Networksbjson:"NetworkSettings,omitempty" yaml:"NetworkSettings,omitempty" toml:"NetworkSettings,omitempty" QueueUrlsalocationName:"queueUrls" locationNameList:"QueueUrl" type:"list" flattened:"true" required:"true" ReservedRange]protobuf:"bytes,4,rep,name=reserved_range,json=reservedRange" json:"reserved_range,omitempty" ReservedRange]protobuf:"bytes,9,rep,name=reserved_range,json=reservedRange" json:"reserved_range,omitempty"Typefprotobuf:"varint,5,opt,name=type,enum=google.protobuf.FieldDescriptorProto_Type" json:"type,omitempty"m*func(*dynamodb.DescribeContinuousBackupsInput) (*request.Request, *dynamodb.DescribeContinuousBackupsOutput)m*func(*dynamodb.RestoreTableToPointInTimeInput) (*request.Request, *dynamodb.RestoreTableToPointInTimeOutput)m*func(*dynamodb.UpdateGlobalTableSettingsInput) (*request.Request, *dynamodb.UpdateGlobalTableSettingsOutput)m*func(context.Context, *dynamodb.QueryInput, func(*dynamodb.QueryOutput, bool) bool, ...request.Option) error TotalRssHuge_json:"total_rss_huge,omitempty" yaml:"total_rss_huge,omitempty" toml:"total_rss_huge,omitempty" xŲ d !0@q@dyxp`&(u@0T:d d /m"`q@xz`&H\  R3 <g*vh/@C0f0@p@p`3?2 dy((+ d /N0f`0@2@і2Pf2ѩ2 rW d /$ PfP@хӖ`&Ж`& L;(9 d @D-Pf`P@rz`&`Ζ@e3 3 P$/0@Lpfp@@@͆6ɖ'lY d /VZ~`ps  pe ` ` e @ mu d /@Fe Zf 00 &  1 ` $ȩ d /j@T`+``@p\`&r@|0$=4 d /``+`@p\`&r@|0$P d /w``+``@p\`&r@|0$)  d /jL`+`@pxz( `&@$/j`+``@hi`&`& #  @U d /4_@WS@D%=:t`(@= ;`4v?@\M`ز/l@pt`p$@p p  us`&z`3hy d / X$@qqFm0(2" d ~2h`$@R0pۖK͗0`IT貖/^b@pp (us`&z`3Zz4 d / `t`$@D{tؙ;ž=o 䁑 d /x\t$@ Fqt 8w 1 't Py5Bl d / `$ps 1! pe 2! e P2! xle| d x<t_b@*wݎ`p p͍3, + d &0r8a`b@`&:`' ~38hX d 3>ybb@GX 0 ``&ŵ`&8/2h+`@ʖ`&(|`&`&;Ζ)X/\^ 8@W`&A`&Ֆ`&utS" d / j`@s`̖`&h͖ҟ((I d /`@x@p@}/`&`٭  d /0@k`@s`̖`&h͖ҟp͖`&(/Pl@rv@ W(/o-q`@`&`ਫs;0 ; 0I*s,@0Ȗ0ɖH 00f/ d /?!tu`%@05i 8 xFC@i Hy  d /sO` `-`@҃ ݘ˜ f  ק d /@K`-``@ Ζ=7`65@ F(ZX# d /K`-`@ Ζ@7`65@ F@($ d /4 "`-``@҃~̜ f  { d /'@L`-`@ Ζ>7`65@ F(O d / L`-``@ Ζ@>7`65@ F( m0&!@Hv@ 0v0'0 f00 Š\Б0H``c@ F0r00 Y4000(Q d X1X`5@3ݖ@ŗ@@0ږ@H Dy d /k~`@—060pF@ Ɩ;8T؅ d /@~`s`#@ p Zu :H`e D $;& d 0Bo`Y`@9@k' 9p;d |0)k: d / @@@I- ps v@i h 'B DD_3mn`9@˖;@pرHz8Ix JHp0 9@"0ʘ00 00N d /N|`@Rsvሖ@ ˖ \`&( d /r#L@;f;f;G;TT[< d X3#M`@.0`[  ϴWW`l($8S d V10@@ɗ@# @00Θ0@U#6/CPM`@@Ȗ&J&0!' ,$K d 0Q`@ '#T;8@,M$: d /bAl` `t` ` j` P0 d //@gM e _;];e p_;];e _;];xe 0`;`^;-/"@` 1@320G0 s/γ 1@0w0u0  s0 d /P@` 1@#`w01" &Ֆ0(,$&} d |0@ 1@P›@hśě`30~@/O` 1@{ښɴě ɴ IC=(/ 1@0w0u0  s0 1 d 90` 1@@+08C48/u 1@ޚ`  .10 ̘7 d /r` `@00|@ ;8,  d /D$gf@s0-@,ι(a;0 oW`/^`@@CL '­ '}0 n00 -g/=@@V)`3)`3n0 ,`30LF d /@` @@Ŭभ/1`3HA`3Xg" ah )04@ @@y@ʙ0$0 DK0,$M d 0@` @@g 'ؖ@(@ IcrЗ!01  @@Ҡ@Ș0ey d0 x"0^[@` @@Yq0 @ey d0 [-"0 @@0 @Oy d0$$2W d 0` @@(Ɩ@ @ey(d840um0c @@*(`&P0X d 0""` @@ 0)00/0 lY"0 "] d /@ @@0@Nݖ;(N";*UX/W`@@G0ZÖ;DK ( < d (0v"@@y0{G0@ ,@8$ Rñ d (0@`@@y0{G0@ ,08$ t d (0@@y00@ {08Ș/[`@@0G;Ö;d# /I>@@쀖0w0Ö; d(\T* d 3`@@޴T ad`3`XT d 3@@޴ ad`3<88/@`@@|`Ș0Z\; d(? d /|@9@@'a;:" S; d /`@B ܷr`Ζ@c> d /@|`  8w E` @ =' d /@`@`̖)e;b`&Ζ`Y{I/ @y`&+;; pL+m d /`@`̖)r`3`0 S; d /` . @B ޷rΖ๪ c> d /@ .` @|@`  8w E  =' d / . @`̖ *e;b`&ΖY{Iؙ/`  .` @y`&+;; pL+m d / . @`̖ *rè`3`0 ol d /6``e@&6Ǜ0w4篚&0! d /6`e@{@&6Ǜ0w4篚&0u d /``e@~@'6Ǜ0w4篚&086 d /n.@r@i !`g%@i s@i ` U1 ɒ虖/6^`@ypvyB xy0Y d /*` ``:@`&a6 Ζ6 f d /om@%e `11\e 1 17e 1P1 1@1f d /on.e 2 2\e p20 27e 2` 2 02P 2|O d /b@op` @둘 ^ b"(Ɩ@ 5 d /}`a7@P0ě0E}; *(d? d /hd !```@i0a`&8f`&x  ,  d *0P``@3\@ Ζ@ӟ8M1;P, ^ d *0````@3\@ Ζ@ӟ8M1;P- d /Ic``@`0@[@ -(c;0h+s/d ! ` N@0Ŗ@\`&(($oa0eN@pɖy( .8Lm;HXԵ d /X/X}`#N@PT2\T02;!2¶ɉ d /:@#N@)`P0%0ٖ0(e|e d /Z `$N@Yw@Ɩv!xʖ p0 "/ܞ@$N@m20;ږ;< d /6l@`%N@0N` " 8 =[ ;e Ѓ` /@x%N@F22;!2Hږ $$x^ d f2`F q`& !@رq50_68@d@($z d 01@ q& !@`ʖϖ0Ж(Hʖ0@(m d /`#n`'@ 'pҖ(̖ '@(N< d /a@#n'@p@xҖ(̖ '@8/@\@ n`(@/@Tz0`&Җ& ͘^Nh/A(@C 'D—0hT ' 00.aK/ `) @Gʧߖ ז'ϗ'  d /m ;) @dyx0J{IV{0 WFHȝ0m@x`* @  'H 'Q ' c'0 d /x, ;* @(r@I r %@i Y! / iI 6O d /`+;@Ηͧ)&`!$ d /i@+;@Ηͧ)&`!$H N/`,;@Gʧrɴ'' ß d /M@,;@@JjͧHA`!ʙ` G d /`-;@Z ʧٚGʧߖhH d /0`@-@7@Ky*ژ;/`@b6/ L`.7@;q`@dy` d /G@.w@Pt`&hJ`&4L;Υ d / `/Y@@JjͧʙHA`!( @0 d '0/W@–ϪޏB lu8Dq d / ڬ`0@qe r@i e Y! y=A($t:1E0@0ٖ;80@(( d F06m'`1`&@– 'wB; & Ү(>p/C`{1`+@&`0 ۗ0Ċ0(80a d 0H-@*`2@{`(Ȗu0@6X((tm d 0`oo2@tdMsח p( d / 8 o`3@`(8 3]((u &E5 d 0o.3+@4ϩ8ޖΩ .`0f~8(T d /@{`4+@6}@7(i`&@Q7;Hۻ|0/؟2`4`@P|pwDE0/t `5`@tpxpP|plpv$0/յ `5`@tpxpP|plpr d /X2`6!@0ߖ`֪L8 M, d /26!@X֖fR@L6 d /;`7@r4x^y; x 3(Q/n 7 '@W;0 3&}` 9ȟ0('``8 '@hq000 PÖ00"e d /kM6 w8 '@;b`;Q,U d /|7``9`7@r@i /@i 05|E Py5@Z d /p@8`9`7@0d K> d d m2 @<1 \1j:``:`7@y0l0pݮ pݮPћ /e=`:`7@Ж0`і 3XΖ0Ζ 3(~9(/O@=`;`7@(F 3ܖ>0> 0 @ d /!>;`7@F 30Y; mY`/@@`<`7@|0n 30΋ 3($`7 d /y+``<`7@낖 ` rx00(o d X1;``=`7@UbT0aH.| 5 d /Q@E=`7@ 3 3Hɖ 3Yؖ 3$ d 0Q@H`>`7@0P0Hږ0 Ι0(4K d 0vj > 1@Җ ? 38t  3@A 3HJ( d 0G@ `? 1@B`3 $(2ؗ0$$\ d V0X_e?@twZ w dy80,xh2Xt`q`@`!@ 'x 'Rsv 8@0H d /U@@@Bw2u222 o5 d /@@^`A@@ƖvT֥! jw`  o9- d /t|@AN@L06Ǜ0w4篚&(w d / `BN@&=6Ǜ0w4篚&04 d /SBN@K@6Ǜ0w4篚&0 | d /I`Cx@06Ǜ0w4篚&( Z d /,Cx@@֬06Ǜ0w4篚&( ФW d /`Dx@m06Ǜ0w4篚&(/ d /Dx@@z`6Ǜ0w4篚&  > d /``Ex@06Ǜ0w4篚&( eV d /p`R=@`@^D; \];" Ӫ d "0 R=@pRsvdy0w* d /8``S=@Ж& r@BzmҡB/uS`@|0.я00!'($~ d 0^``T0@r(r@Ÿ$t@(p@0pb d /xT0@ZLY:`@ d /z`U@pΖ  ~8@`Ȣ/azU@Ŗ  'w0s(0(0M>آ/^{`V@Ŗ  '0 )2o/|V@ҙ00a\0 rʙ`&0#3 d /Q`W8@=;x;N;; A*`/WD@}~Ֆ 5(Ֆ;8Ö;: /a`XD@0~Ɩ(@0Ju;8$${p d H1XD@X0$Ɵ}@f(#884\d0`YD@/0!8Ֆ 5`s3/YD@~;0;R`}@f  d /.@`ZD@r`dp60Ӗ  F` (5 0` Z@0ܖ0Ŗ 5 D{F0$$\ d 0 `[@0C@ÖƟ(D{F@, d /8N@<[@@p \pك0yt 'HCNM d /@@Hrd I~I(e 0II I}Iye IpI($\h0o @<\@@p`Ip 5p 5@Ka d / ۬`] @y`fӖ`&`&4`&$3<0/E]q@/0`&Ȗ`&}~ ) d /+۬`^@p`dy&  z` 8?O/W^2@'/0 `:@V` ؗ;( d /9`_2@%ҖɟҖ`($$ d 0`_@@;`i0ɖǟ&ǟ 0Öd8 ͦM d /[```3@`:ǟp \(&{`&0fc d /`3@p`X^ʷ` >``@ `\+=fP/g`ɬ`a`y@҃];0.`(bi\X`/ݬa@B`m.` $$ d 1 `bZ@n ]` t/(r8 d /`v"bB@|  D@3xh͖  a d /q`cB@$@V? 2;(yr d /l* ʬc z@90˖+˟͖;0,8N d /@ʬ`dz@` }.d ue / | ( d /xqd!@F`ݢL;p@yB;8d`tN#Q d ;.!!`e@K ̖ y-;NХ/=U@e@"8;9;(`&E d /|`f,@ 8w 1 't Hx Py5&ॖ/6!+f@`i> lh@!,,| d 2v@+`g@Rsv{ d;jy @7 d /gq@`0Ζ0`ä  ä( f9R/d@t`h$@p`&p`&p3t3` d /Nfh @ x— MS8/p`i @p# 'z ' xΖ '0P/,!@i@{j{Lf ' \`'02v d /`",u`j,%@w#;;}`IOB/0j,%@ޖ0n2#2ߖ26d/` ,u`k,%@br@ȸ90; w 0( O3 d X1)& ,uk,%@ɖٟ)ڟ䉖ٟ0|ڟHۨO6Ȧ/,u`l,%@  w;;M;44_ d N0,@,ul,%@ر04X``qqN d /1,u`m,%@& ϓ Qe c`dR N3l d /` m(@X`@z4vj y( = d /l@(`n(@b{`%`?p;+; ;,/(n(@`%㧗g;;!/j(`o(@pB@b{dy$ i3 d "06c(o(@ {;0!r08 EDR#0(`p(@p@Qpgp ' dy0  d /p(r@i z*Z'05`z*@Z'jtz*Z'7v d /i``q(ps `*{)pe *{) e *{)K@z8/=@q@W}ܖ;$;y,,pr d .1v +`r@Rsvr2$':8#^ d /Bpr @ue / / 1 ' MPX d /@ ue e =0 0  F03x(0P s @q0v0v0 u0$$g d 0@B`t @u0u@ÖP(wݞ@${zد/m`" pt @v`&3< 3Җر,(oE 1>0$#`u@pіǵs`@@Җ`Hz3P V$ d /PEu@ V~t`t`8̖3{d d /jhF`v@` +R+y`+4|`+ & d / 2Ԗv@h˖ 30i 38ZC d /l@`w@qVv 3\u 3ҟ/`w@ô,ô)ô@]0E /rM`x@zoX˖3Pʖ 3 X d /xOx@33x`z3$Ϊh/,P`y@Җ33z2+*2u d /׫@Ry@p`hp`&p 4p 49/i`z@Ӗ@Ӗ@Nؗ`3: ' <~譖/Uz@Җo33<3 7 d /V`{@0&΄&&̖&!f d /P{@3̖3֗3՝3S,! d /s``|@p 3ʖ 3&{ 3y 3>譖/s^|@3t: 33`3g d /ά_`}@ <&<&& 3" (/sb}@6 d /#$-` I ݑ   î6 d /z$-`-!-!I.!.!ݑ/!/! /!/!c+s6 d /,`6Б*| 0?0? VV@g PWPWFa 6 d /6k(0 Ԫ pp* 00>X@ @ ^6 d /kD% ~'  00y ߿)6 d /_`@,% v v }7e pw pw ~' s s w w !}6 d /k %Py @1 @1 8  3 3 t  3 3  02 02 Fs6 d / `/` #i#iJ P#iP#it Ԛ6 d /`/ hhJ hht Q6 d /'`/ `$i`$iJ 0$i0$it q6 d /  `/ hhJ hht e6 d /vr ^^7e ^ ^,e ^^x ^ ^J6 d /q`d%  &@@ 5{ x @ @ 6 d /S @: PqPq?` qq< q q"O Ut6 d / @ @p@pO/nppw pp8x pp>6 d /γu@InnY! nnV pnpn@ nn #/6 d /`δ / /s/s ttq^6 d / |5h uum =s=s* p>sp>s pupudg6 d /775h P uP up 0Ps0Ps u u~@i POsPOs]6 d /385h uu gsgs uu~@i `fs`fsy] 6 d /[ 95h 0u0uy ksks uu~@i isisw;g6 d /7 :5h uup 0us0us 0 u0 u~@i PtsPts6)6 d / ;5h !u!uK xsxs p!up!u~@i PwsPws ^o6 d /7 <5h #u#u {s{s #u#u~@i zszsv6 d /m =5h &u&uK` PsPs p&up&u~@i ~s~sI'6 d / >5h +u+u9A `s`s P,uP,u~@i s s㖮6 d / ?5h p.up.u9A ss .u.u~@i ssz6 d / }5h P1uP1u9A s s_Bd ss 1u1us76 d / @5h 05u05uK` ss 5u5u~@i `s`s66 d /ȝ A5h 7u7uK ss 8u8u~@i ssJ6 d /3#~5h )u)u? 0s0s] ss *u *uyR6 d /> 5h ;u;u% ssܬ PsPs Pu >u@\ ssu  0s0s >u>u_^n 6 d /L@5h AuAu{`_ 0s0s ss Bu BuWG6 d /*5h DuDu  ss j psps DuDu[6 d / 5h FuFu ss^e s s GuGu6 d / B5h _u_uR } ss p_up_u~@i ss区6 d /R85h ttͽ~ @Qt@QtT QtQt tt#6 d /_|5h tt pctpctց ctct tt$^6 d /ŝE5h TuTu ) itit UuUu~@i @ht@ht>6 d /o5h 0Wu0Wu] @ot@ot-_ otot WuWu^6 d / @5h [u[u] {t{t, |t |t \u\uD 6 d /Q `5h juju9A tt_Bd @t@t 0ku0ku=6 d /5h @t@t( tt@/ PtPt tt6 d /`5: xu xu?` pxupxu< xuxuH ܒ 6 d / Al` t` `` j` PP|w6 d /U h vvf vvg PvPv vv%m6 d /Jh vv g "v"v`h P"vP"v vvt6 d /xIh `v`v +v+v vv~@i *v*vmd6 d /7 Kh v v 5v5v vv~@i 4v4vL6 d /aQ Lh @v@v 8v8v vv~@i 7v7v5z6 d / Nh vv `Ev`Ev @v@v~@i DvDv9~96 d /[ h pvpv`g TvTv i TvTv гvгv16 d / ϴdps u;u;pn v; v;W v;v;D w;w;/F6 d //M e _;_;e p_;p_;e _;_;xe 0`;0`;~6 d /D$e EE EE@i EE~ E EI6 d /$., @i z1z1z {1{1; w1w1;@i z1z16 d /@ ( 6 ??O@i ??hs5 0?0?h p/Ep/Ep6 d / O i` z@ z@ ~@ ~@D@@y@@p6 d / O i`<<<<D<<yД<Д<ңs6 d / `e-B PfPf 3` ff 0f0fPu ee 6 d /@ ``e-@B ff 3` ff pfpfPu eeZi 6 d /Z`e-B ЕfЕf 3` 0f0f ffPu eee!6 d /O{ `e-C ff 3` pfpf ffPu pepe6G6 d / `e-C ff 3` ff pfpfPu 0e0ef 6 d / `e-@D PfPf 3` ff 0f0fPu eeA6 d /,V@%q` 1 1Ä` 11xe 1 1 11}'u6 d /o @%e `1`1\e 117e 1 1 11A6 d /,W.q 22Ä @2@2xe 0202 22}'u6 d /o.e 22\e p2p27e 22 0202%%|6 d /b  7 0:0: @:@:vg@:@:gP:P: 6 d /M+q ;:& XX@ Y Y YYy YY{^6 d / &v ..`# ..H . . P.P.I6 d /̨` *}7e , ,~' (( ++.2 ++P6 d /)+ 66/0 6 6 66 66nz6 d /8+6e 66/ 66܄ P6P6  66/6 d /vN" 8 ;e Ѓ` 6 d / N" @@8 pp;e ppЃ` <Q6 d /^ N" 8 @@;e Ѓ` xH6 d /!@[N" 8 ;e Ѓ` Sk6 d /RN" 8 ;e 00Ѓ` PPဿ6 d / N" 8 ;e @@Ѓ` ``G+ PP7 ^}? 6 d /i+;<= >  8 ^} @ 00cS6 d / ,;.; @`+ @@0 T /6 d /M,;` 77 > 77`? 0808+`@ 88˯ 6 d / -;0{` ;;5  P<P<.`= << ==H6 d /Ů N CwCw/  0Ew0Ew` EwEw&6 d /? W4 PP~@i QQO@i D`@i 0R0Rw~6 d /z8p`C@@Ѳ@{ pp/ V`CY N6 d /8`p`CѲ@{ /  V`C  oZ6 d /Y @t }}/{ }}F& `}`}< }}z6 d /hvЮ Hrd 0Xh0Xhd WhWhE UhUh)H oI6 d /@˩`+6 d /=lP;bP;b:b:b͘ 4 п6 d / \@Hrd II(e 0I0I IIye II;h6 d /`r@XJ] @O@O@OOLOO20O0O46 d /ns@i &T&T05@%T@%T` 0&T0&TN1 _P3TP3TƸ6 d /+ ^Hrd QQ%@i QQ91e QQM Q Q6 d /5-u2r Q Qv >Q>Q/ =Q=Q>Q>QOv6 d / 2r QQv QQ/ QQFPQPQ6 d /@2Xse 0LQ0LQ}. JQJQ/ KQKQ/0 KQKQ.&y6 d /405@Q@Q5QQJNd h QQ6 d /t @7 80]T0]T`8\T\T1``T``TS]T]T2I!6 d /{Qy D[D[/ C[C[cA!][][ C[C[>$V6 d / mХ=D%@ @-J@-J8` p.Jp.J9` .J.J.J.J6 d /@@- &J&Js` p&Jp&JF& @'J@'J $J$J6 d /nt`I!E  + l`3` ̔Q6 d / i 0577m`EP:P:N1 _09091 ;;9<:P6 d /+&&5:U6 d /Zlw,D% ))- **2 ++6 d /Ư  V/ /u  ]֖0ps y/4 b4;}௷X1௷ps ` d /h 4@Ӗ'Lyh p/Ep?4,D{ d 0`4ٖVdܖV(HP7 101,,̟B1ϛ l4Ȗ 0ʗ`Hʗ`P7 11,,0D[l4ٖV[ܖV(H@P7 011 É/ud@/@4|0іιz; 09[дZ 9К/we/4d|`&{`&p|0 @3`&3s/,al] 40E@?@ps OpNJ[ d /@vo4.0F;v@N@N_ d /ǀx 4I}`&0Ips ؉T vН/,y 4Ė`&I}`&0ps ։P 1d d /)0/hs |PX{F |R{ |O{6 | Y{nd d /~/4:v@0Ö2. 6 ps |[{a\/}>74 ז'ϗ'^ԗƮ!ba S"y"/ڬ4 0V 0 ps xp>FQ d / 4F@`9 H 3 iS/}}y d /iN4I}`&j֖0Ips |p|   d /h3`7qf @&Z`X@d &ZX.2 0'ZpXď 6'ZX-/V ,4W 3I;ߖ3 ^e a|a @y d /h,). +d cF& `+dpc:/`e+dc1` P,d c  d /ڱ@`,). -dpdF& .dd:/`e.dd1` /dpd | d /aD.@i 0]p\w ]\ G 0]\ A]P\ 7.b d /E@DF& ]]:/`e ] ]1` ]]n`^t d / #@@X4ߖ@,`&x Py5O0Oq/n@48p fl\@ N1 _P3TGTӧ/ 240d`&`& QNQ<X/Φ b4xp3p3 q30 3PJ`J B&% d /:5(bә0yh 0t vs tusq灖/@V`;5(bә0Jm@h !uws p!uvs)v蓖/Q`;5(bә0ah P"uys "uysm/7V`<5(bә0{@h #upzs #uzsN4/f\<5(bә0*8 h $u|s 0%up|sB /m @W`=5(bә0Jm@h &u}s p&u`}s2e/ `=5(bә0Ih P'u@s 'us z d /`>5(bә02h *uЁs +uPs~/ W>5(bә0ᴦ@h +us P,upsU /( ``?5(bә0dh 0-uPs -usK(/ @X?5(bә0ᴦ@h p.u@s .uЅsG}@/@Y`@5(bә0Jm@h 05u s 5usڒbH/8@5(bә0{ah p6us 6u sfP/ȝY`A5(bә0Jm@h 7us 8usDX/A `A5(bә0M@h 8us P9us d /y`B5(bә0bh pVus Vu0s:]/ @^B5(bә0Oh _us p_ust61 d /``C5(bә0!h t`t Ptt!gh/C5(bә0A@h ut 0u0t.Ȕ/``D5(bә0A@h  ut p u`t/H D5(bә0ah Lu0t LuP0tCÓ/% ``E5(bә0ah Ou 6t Ou5tc%H/ŝ_E5(bә0t@h Tuht Uugt6L-h/ `F5(bә0Ih aut bu0t.x/|`F5(bә0dh peut eutuQ/`G5(bә0ah qu0t qutDo2/`G5(bә0-h uuдt vu`t/W `H(bә0@h v`v vvL Е/X!`H(bә0U@h 0vv vv{J/ `I(bә0@h v%v @v%vO/x@dI(bә0L@h `v*v v *vg d /J``J(bә0` `h 0v/v vP/v/!J(bә0U@h vP3v @v2v|G[/`t@P@/(`Yye $:p:Py5%::J: /էt`Q(:v0ɖ'r ld~' @mpe7 d /- uQ/(A`&u`&e 5@k5 p5`j5 jH/G {`R6(q0hs Pvv vv& d /`{R6(p`3p`3v vv 0vоv {,=X/Q{`S6(0b0hs vv 0vv ?2H0Vj~S/(:v0ɖ0hs` ||{ p|p}{C8 d 7`T(iݖN`9pse p-}.}P`- -}/}/ d /T(vv&pv& +}@$} p+}$}T2@/ $`U ,(Yq Aw 3 papay@i aPaס d /M@R|U,H 8`# ӿ  i`6 [+ d /@`e`V`Hڅ`/Z 0`@G nj`1 z># d /;N@<V@H}. v @ | 1 .2  @\~ d /M$@ ۬`W H]r` £ r _l3^g&l d /KRW3H $0 6 @i `y `H x d /f@0,u`X,%Hr@i 2 B21 ,|1 ,1 jEQ}p/)X((YqQw 3 D*%y@i E*%[G.H d /  (`Y(()= 3p 3 Pu*'Ha u*'[&{^ d /c(Y((Җ ' '$R$٣H/*`Z@(ߖ@vܖ`059P:Py5::0(Y d 0tZp3%c $28Җ@H8= d 0?)P[p3B  ɖ*p` b{084 d 0+ c[p3p`PSs@˜ ]r(pڢ0$$R d 1P\p3st})()0p8$$R d 1 .\p3st})è()è0p8(([ d 2v,uP]p3k @a  [t@s8B@2:@H,, d 1(]p30˖@pʖ AP < d +0(ԖP^p3p=x ʖȜ !c `e 8h! d /^p3ppɇ3ㄖô s(y d /3P_p3r? 4{&r s3( j d /_p3pKϖ3pphΖ;p@ hq d /(P`p3K@rs3`t3 V($  d /h`(pɖ@˖`ye D& d /@9`a(6` r@i H`H2@i HHdp/a(vܖ`Ֆr@i *`*05** \ /ӣ`^`b(PΖ0ʖ0ps ##3 v*func(*dynamodb.AutoScalingTargetTrackingScalingPolicyConfigurationDescription) *dynamodb.AutoScalingPolicyDescriptionv*func(context.Context, *dynamodb.CreateGlobalTableInput, ...request.Option) (*dynamodb.CreateGlobalTableOutput, error)v*func(context.Context, *dynamodb.DescribeEndpointsInput, ...request.Option) (*dynamodb.DescribeEndpointsOutput, error)v*func(context.Context, *dynamodb.UpdateGlobalTableInput, ...request.Option) (*dynamodb.UpdateGlobalTableOutput, error)w*func(context.Context, *dynamodb.ListTablesInput, func(*dynamodb.ListTablesOutput, bool) bool, ...request.Option) errorw*func(context.Context, *pubsub.ListSubscriptionsRequest, ...grpc.CallOption) (*pubsub.ListSubscriptionsResponse, error)w*struct { F uintptr; s config.RefSpec; remoteRefs storer.ReferenceStorer; matched *bool; refs memory.ReferenceStorage }MemorySwappinessejson:"MemorySwappiness,omitempty" yaml:"MemorySwappiness,omitempty" toml:"MemorySwappiness,omitempty"NetworkingConfigejson:"NetworkingConfig,omitempty" yaml:"NetworkingConfig,omitempty" toml:"NetworkingConfig,omitempty"ObjcClassPrefixfprotobuf:"bytes,36,opt,name=objc_class_prefix,json=objcClassPrefix" json:"objc_class_prefix,omitempty"x*func(context.Context, *dynamodb.DescribeTimeToLiveInput, ...request.Option) (*dynamodb.DescribeTimeToLiveOutput, error)x*func(context.Context, *dynamodb.ListTagsOfResourceInput, ...request.Option) (*dynamodb.ListTagsOfResourceOutput, error)x*func(context.Context, *dynamodb.TransactWriteItemsInput, ...request.Option) (*dynamodb.TransactWriteItemsOutput, error)x*func(context.Context, *sqs.ChangeMessageVisibilityInput, ...request.Option) (*sqs.ChangeMessageVisibilityOutput, error)x*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.ListSnapshotsRequest; resp **pubsub.ListSnapshotsResponse }x*struct { F uintptr; input *dynamodb.ListTablesInput; c *dynamodb.DynamoDB; ctx context.Context; opts []request.Option }TrailingCommentsfprotobuf:"bytes,4,opt,name=trailing_comments,json=trailingComments" json:"trailing_comments,omitempty"y*func(context.Context, *pubsub.ListTopicSnapshotsRequest, ...grpc.CallOption) (*pubsub.ListTopicSnapshotsResponse, error)IOTimeRecursivehjson:"io_time_recursive,omitempty" yaml:"io_time_recursive,omitempty" toml:"io_time_recursive,omitempty"TotalActiveAnonhjson:"total_active_anon,omitempty" yaml:"total_active_anon,omitempty" toml:"total_active_anon,omitempty"TotalActiveFilehjson:"total_active_file,omitempty" yaml:"total_active_file,omitempty" toml:"total_active_file,omitempty"TotalMappedFilehjson:"total_mapped_file,omitempty" yaml:"total_mapped_file,omitempty" toml:"total_mapped_file,omitempty"UsageInUsermodehjson:"usage_in_usermode,omitempty" yaml:"usage_in_usermode,omitempty" toml:"usage_in_usermode,omitempty"tlޥj d 4EPfmPLʖkax d 5%`@L`&R;=; PȖd$*  d /-/fLd|.&ۆv@())@ZO d /`Lt`3`&0Җ)g  Ζ;($$ d /֩@gLd|.&ۆv())@$*  d /-/ i .` Ld|.&ۆv() *@$$ d /֩i . Ld|.&ۆv@() *@  d / ```eLy6Ǜ0w4篚&( "006Ǜ0(w4(篚&@$. d /} ` ୱxLk@006Ǜ0(w4(篚&@$% d / ` `xL3@006Ǜ0(w4(篚&@$= d /` றxLܔ@>006Ǜ0(w4(篚&@ ۶n d /` `xL@֬06Ǜ0w4篚&0$^F}l d /d` ௱xLm0j@=6Ǜ0(w4(篚&@ x d /u'` `xL!006Ǜ0 w4 篚&84 d /O` ఱxLu076Ǜ0w4篚&0 : d /p G!`xL@֬0ب6Ǜ0 w4 篚&8 IOk d /rJ` ౱xL iƐ6Ǜ0w4篚&( ЬL d /` `xL@֬@!Ɛ6Ǜ0w4篚&( tQ d /J` ಱxLm`(Ɛ6Ǜ0w4篚&(S譖/(Z|`,L ɴ˗8 l' d /j@[|ೱ,Lrq@ ݘ[_0 ( ;˼f d #0X^`,L˗`&0Ӊ0IB(8 ώ d 0_|റ,L4`&(yMyWB(u`8(a/|`,L`zBBЖB Rsv0;B@r d /qb൱LuH F;@;ď' p# d /y` `YL 3،6Ǜ0 w4 篚&8$q d /j` නYLy0n6Ǜ0(w4(篚&@$$St,1:@`@<L!`30]`3`3 ؘ 0 _84,$b d 0 `෱1Lr*ڗ5 '0Rsv@@P$$w8|0! ``1L0pݨr ' { '0r@$$DG@|0: ั1L0pݨr ' { '0r@$$w?1 d 0ַo`=L)= 3D`;pp(@3&/@๱=LRsvxΖ 3| 3 _ 3 X˖ 3(88$ d 0Q,`1LՖ;E0H XpÖ`$ R+:0 ັ1LՖ;d0K`jO`j(|—08;࢖/n@{`Lܖ;Ö;h '! '^ '( L d 80 e໱L  0B1ş  0 f8# d /ƭ!`@QP @E99Py5E99 F99s\ d /^(༱DLJu;Ԗ@JG@Jǟf080gk d ^0``DL#Qɗ;PK 5HRQX$$ gȣ1 ཱL0/0w0 Ֆ00D{F@ # ! d /Ɯ@p`@ Lh`7`s6 Pʖ(zv0 N; d /ٜ`@pྱ@ Lh`7`s6 Pʖ(zv0VB d /(`ZL@ @d;0;2;4Ѐx d 0p ࿱qL 3@F`– ϗ( ˜0H/`L;`0p`u);(0'`/L. \_ۖ 'ٖ ' T(<Ș 'P, d /`LҖҟFҟҟ0 `&Hʖ`&P00  d b0ث!2L@ʟ}~p`@p` Pp X0( d l0D@f`±2L0`0/5 +˟H$$ {| d z1rI±@L;`iH` "g(#8 mK d 500o!@ܬ`ñ@LpXϖ`& dy(`M8S689 d /Hc (ݬñnNn9 UUr@i UU+@ PUPU ^  d /!`ıLy`ӥ. @ c;8XL# d 8<"ıL`̖ z;-;  Ʈإ/zm`űLpI`$~0A`&(<ė00,$a# d p1q3űLtwp|'dy(^`&8xʖi@( 1G7 d 60l@!$u`Ʊ$%LRsv0ꄖ`& z@(x8($[< d 0@fƱL0Pؖ࠲ '( 0@bS/`DZ,%Lu00iݖ0 N;0ɗ;2 n d /&`DZ,%LĖ`&dv`&0v Ö`O8((.k 62`ȱ,%Lq0v0/ޖ`j |`j0u@@@&z0n,uȱ,%L)2 w r@ RsرHl_x oQ d /'8`ɱ(L' 3R 30@;(Q3*  d / (ɱ(Lep`&p`& `&(. '0$$iq d 1qH<(`ʱ(LS00d[0 900`?@= d /<(ʱ(L0XS0j|`2`? B@(E/@>(`˱(L\{  r@Z;왗@fz 6P/I` ˱`Lp4p`3dyx(j+;,84*{a61p`̱ L{``0P`T6;h;j(TgTX0#1p̱ L`0 '/ s (|`P( d /?``ͱLXp`& $q`&8, '@($xo;1!-ͱОLw0u0s(0 00`0@$/b d /D+`αL90xp`&(00@`&@( * =0XhDαL00. 7~ 90Ė`&HVQY譖/@qF`ϱLp`3m3ҖE b e Uc;/rGϱLr3ҖE3S`&ӈ 9 iШ/h`бLX  +822 6 3p 3,$' d 0`ԖбLRy`&xҟr(.@9 d /,+`ѱpF& P1+P1+:/`e0+0+1` 1+1+8j*/i@MѱL 4Jx'Ɔ@4m; ;"譖/1R`ұLrJx 4ɇ3ㄖôs /8G@RұL2x 3p&yˡ X5譖/s`ӱL(p` XҖ 4<3<3h͖ 3 |P/@ӱL͖xɖô 3p` y`ʡ r`/`ԱLۆ` ppj6k˖k `30 q譖/fs[ԱL 3a 3ۆ` ? g,x/)]`ձLp@s 42s3 ' xA/٭`ձLr*rɇ3ㄖô s(D/t`ֱLƆ`Y3r 3p`&{  BW/dֱLb .822 6 3p 3  d /``ױ,M tF& u | :/`e`u 0` 1` u } ,<ة/Ϯ[ױLp +fs`&@?r`&Hz;P8Ӗ;R$5 d 0`رLӖ0o8`&0N(ҖV0'/0|ر,Lpvt 3m 3<& &(p/譖/T|`ٱ,L 3a 3ۆ3 4? 4 cf{/@|ٱ,Lpvt 3m 3<& &(` d /P6`ڱ L֖3|R3Ö3ǖ3Ė 3&lgO d /ڱ LFv 3.2Ö2 xw 3v 3o-/@`۱ L֖2n2 3|੡[% 30*p/` ۱ L֖2v2v 3ז 3D{ ((b d Z0^,`ܱL~` رΥx@a`"H$U  d /m#,ܱL~>u@~(p˖`&@($H1`ݱ,Lٖ0ɖ0t0 Y000@tBs@/ ݱ Lz 1 3@ϖHx `z`&$$Vf d V0xb!`ޱ L~z`5 Җ`&8ٗ@ KGqdp/`!ޱ L@. 5–`4w 3ٖ2<4xz# d "2p`߱ LՖß`28d`2@H` o d /c`8^߱L0@Җ@,`&(:`&0p`&8bt d /~&` [` L@];U; \6z*func(context.Context, *dynamodb.DescribeGlobalTableInput, ...request.Option) (*dynamodb.DescribeGlobalTableOutput, error)z*struct { F uintptr; input *dynamodb.BatchGetItemInput; c *dynamodb.DynamoDB; ctx context.Context; opts []request.Option }CcEnableArenasjprotobuf:"varint,31,opt,name=cc_enable_arenas,json=ccEnableArenas,def=0" json:"cc_enable_arenas,omitempty"PublicDependencyhprotobuf:"varint,10,rep,name=public_dependency,json=publicDependency" json:"public_dependency,omitempty"SectorsRecursivehjson:"sectors_recursive,omitempty" yaml:"sectors_recursive,omitempty" toml:"sectors_recursive,omitempty"TotalUnevictablehjson:"total_unevictable,omitempty" yaml:"total_unevictable,omitempty" toml:"total_unevictable,omitempty"{*func(context.Context, *dynamodb.BatchGetItemInput, func(*dynamodb.BatchGetItemOutput, bool) bool, ...request.Option) error{*struct { F uintptr; req *pubsub.ListTopicsRequest; ctx context.Context; c *pubsub.PublisherClient; opts []gax.CallOption }BlkioWeightDevicehjson:"BlkioWeightDevice,omitempty" yaml:"BlkioWeightDevice,omitempty" toml:"BlkioWeightDevice,omitempty"CPURealtimePeriodhjson:"CpuRealtimePeriod,omitempty" yaml:"CpuRealtimePeriod,omitempty" toml:"CpuRealtimePeriod,omitempty"CgroupPermissionshjson:"CgroupPermissions,omitempty" yaml:"CgroupPermissions,omitempty" toml:"CgroupPermissions,omitempty"ClientStreamingjprotobuf:"varint,5,opt,name=client_streaming,json=clientStreaming,def=0" json:"client_streaming,omitempty"DeviceCgroupRuleshjson:"DeviceCgroupRules,omitempty" yaml:"DeviceCgroupRules,omitempty" toml:"DeviceCgroupRules,omitempty"GlobalIPv6Addresshjson:"GlobalIPv6Address,omitempty" yaml:"GlobalIPv6Address,omitempty" toml:"GlobalIPv6Address,omitempty"MaximumRetryCounthjson:"MaximumRetryCount,omitempty" yaml:"MaximumRetryCount,omitempty" toml:"MaximumRetryCount,omitempty"MemoryReservationhjson:"MemoryReservation,omitempty" yaml:"MemoryReservation,omitempty" toml:"MemoryReservation,omitempty"NegativeIntValueiprotobuf:"varint,5,opt,name=negative_int_value,json=negativeIntValue" json:"negative_int_value,omitempty"PositiveIntValueiprotobuf:"varint,4,opt,name=positive_int_value,json=positiveIntValue" json:"positive_int_value,omitempty"PrivateWorkingSethjson:"privateworkingset,omitempty" yaml:"privateworkingset,omitempty" toml:"privateworkingset,omitempty"RemovalInProgresshjson:"RemovalInProgress,omitempty" yaml:"RemovalInProgress,omitempty" toml:"RemovalInProgress,omitempty"ServerStreamingjprotobuf:"varint,6,opt,name=server_streaming,json=serverStreaming,def=0" json:"server_streaming,omitempty"|*struct { F uintptr; host string; req *http.Request; path string; trailers string; contentLength int64; addGzipHeader bool }|*struct { F uintptr; mode int; memory uint32; time uint32; lanes uint32; segments uint32; B []argon2.block; threads uint32 }|*struct { Session []uint8; Type uint8; User string; Service string; Method string; Sign bool; Algo []uint8; PubKey []uint8 }IOQueueRecursivekjson:"io_queue_recursive,omitempty" yaml:"io_queue_recursive,omitempty" toml:"io_queue_recursive,omitempty"} d /z@H@$-`-!` I.!@ ݑ/!  /! ^/' d /`@@Pȳ@ @ s`O` \`?+ ">F@ 5x/zd`d`@`@,r`-Ӗ08`&`& @Rp`oHX/ nu @0_ۖ`&A`&Ֆ`& 0MLZ|n8/i n@N@I}`&ܖ0iݖ;;ps MM d /Z N@q`&Bz`&ʅ`& `ڊ,( d 0q@6@0ȖhŖ@($ 9@ps zx,(W.3 d 0<r6@0ȖhŖ@($ 9@ps zx,+ d /P"൭@e@'@0(\8] 3PiS܅݅ 8O0L7@+@4ϩ8ޖΩ `;0_)8e &hPh d /@I@;PD% H/ V/u 8@i 1 X u  d /sO@XȬxP$s1t,<@-Z>.)@.8.\/3  d / XȬ@xPl@i d@f P  0 ` U1B <` H @  d /EJ@ePÄ@ s P 1 w Py5 te 2/ta@D@0`&Z0'0( p]`]  d /j b@,p3Tp3xp3Lp30 3J0J d /@ b@dp3 21 ,|1 ,1 Py5$O d /` 6@  N ` 'J @ )$h誖/@@0_ۖ`&A`&Ֆ`& EE  d /g@@P@!`ZvZ tA`&K 1`? (|58/m@@@@P@d|`2&{Zp|0`& 7q~*func(context.Context, *sqs.ListDeadLetterSourceQueuesInput, ...request.Option) (*sqs.ListDeadLetterSourceQueuesOutput, error)*struct { F uintptr; req *pubsub.ListSnapshotsRequest; ctx context.Context; c *pubsub.SubscriberClient; opts []gax.CallOption }*struct { F uintptr; serverRandom []uint8; clientRandom []uint8; version uint16; suite *tls.cipherSuite; masterSecret []uint8 }BlkioDeviceReadBpskjson:"BlkioDeviceReadBps,omitempty" yaml:"BlkioDeviceReadBps,omitempty" toml:"BlkioDeviceReadBps,omitempty"CPURealtimeRuntimekjson:"CpuRealtimeRuntime,omitempty" yaml:"CpuRealtimeRuntime,omitempty" toml:"CpuRealtimeRuntime,omitempty"MessageAttributesllocationName:"MessageAttribute" locationNameKey:"Name" locationNameValue:"Value" type:"map" flattened:"true"ReceivedMessagesmprotobuf:"bytes,1,rep,name=received_messages,json=receivedMessages,proto3" json:"received_messages,omitempty"*func(context.Context, *dynamodb.RestoreTableFromBackupInput, ...request.Option) (*dynamodb.RestoreTableFromBackupOutput, error)*struct { F uintptr; c *pubsub.SubscriberClient; req *pubsub.ListSubscriptionsRequest; resp **pubsub.ListSubscriptionsResponse }ExpirationPolicynprotobuf:"bytes,11,opt,name=expiration_policy,json=expirationPolicy,proto3" json:"expiration_policy,omitempty"O6 d / o@Ba bFbF)~  H nv6 d /0`5005zJzJ85}J}J@i `J`Jw {J{J` @yJ@yJkH6 d /=FPr@i 0J0Js@i pJpJ8w JJPy5JJ@i pJpJ8=6 d /< -U %@i @ @ y   ]r6 d /( -U @ @ %@i y p p $6 d /*a ЖЖ8w 1 't Py500j(i6 d /m$ PPPP8w PP1 PP't @Q@QPy5PPM* 6 d /pw@$8 DD0pFpF EE@1EE PEPEOֵv6 d / $8 GG0`I`I GG@1 H H GG@v6 d /Dk ps@i P"P"s " "Pyr  m ""` `#`# /6 d /aࢫ"g PUNPUN`7 VNVNZ` UNUN UNUNu UNUNc6 d /i`"g NN`7 NNZ` `^N`^N PNPNu ^N^Nz6 d /b "g NN`7 оNоNZ` cNcN NNu pfNpfNxW6 d / s^) |@ L 0 %7d56 d /`O` J7J70pK7K7t L7L7s@i W7W7 ( J7 J7B6 d /x İ`_i`_i zz PaiPai `i`i_ a6 d /SZ {Z ٌ  * T @ 6 d /%3r ŌŌF @@sŒŒ7ŒŒ0CČČ"6 d / N@| PqPq: q q:6@q@q?` pqpq< ПqПqG6 d /mn 9 07j07j  8j8j%` 4j4j8e 7j7je 08j08j6 d /|еI- nnps PnPn nnv@i nn pnpn:6 d /\`vI- nnps PnPn nnv@i nn pnpnBlc6 d /R7w5h `t`t` rr` 0r0r tt~@i 0r0r-6 d /\y5h tt ` s sB # P sP s tt~@i ss:`6 d /@$5h PtPtü# ss 1 ss-0`1 ss tty6 d / z5h PtPtP| `'s`'s9 's's tt~@i @$s@$si}H6 d /,$5h ptpt ] (s(s- )s )sC` p)sp)s tt:`6 d /E\ &5h tt`] -s-s, .s.s `.s`.s `t`t+6 d / #&5h ttּ` `1s`1s` 1s1s` 2s 2s @t@t8:ƕ6 d /d`{5h 0t0t8 \ @4s@4s` 4s4s tt~@i `3s`3s^}6 d /|5h pupup` PAsPAsK` AsAs uu~@i ?s?sZ6 d /@}5h uu9A LsLsR`c `Ms`Ms uu~@i `Ks`Ks:|6 d /`'5h pupu@ rsrs`% ssss, * PssPss uu6 d /5h tt` `s`s@` ss ptpt~@i ssȮ6 d /5h 0Cu0Cu 0s0sB ss CuCu~@i ssWd6 d / 5h EuEu` ss<` @s@s FuFu~@i ss& {6 d /*5h tty` pspsa ss0, @s@s 0t0tZ6 d / +5h uuR/ `s`sq / ss/ ss uuC6 d /`5h tt<`j ss 0s0s tt~@i ss\`^6 d /|5h ptpt` psps` ss tt~@i psps-D6 d /?+5h @Hu@Hu@ tt% PtPt,`* tt HuHu6 d /3?5h cucu' )t)t`( )t)t cucu~@i 't'td 6 d /h @5h 0Ku0Ku P/tP/tB /t/t KuKu~@i -t-tbpĴ6 d /p-5h 0t0txA  p7tp7t#A  7t7t  p8tp8t tt '*6 d /G-5h 0u0uz@ ~ 9t9td` :t :t#A` :t:t uu~6 d /5h uu P\tP\tn \t\t uu~@i ZtZtH`6 d / 5h `Qu`Qu< PatPat^ f atat QuQu~@i 0^t0^tٕ6 d /4`5h ruru` ftftz@~ 0gt0gt @su@su~@i 0et0etxN6 d /|5h pUupUu9 mtmt`f @nt@nt UuUu~@i jtjtk`6 d /5h \u\u< ~t~tWA k PtPt ]u]u~@i P}tP}tKʛ6 d /q 5h ``u``u + ptptK tt `u`u~@i PtPtz=56 d / 5h mumuy tt}`. tt PnuPnu~@i ttk6 d /5h cucu9A БtБt`e PtPt pdupdu~@i ttq }J6 d /@.5h pluplu@ tt& ЦtЦt,* t t lulu=6 d /|5h @tu@tuK` tt4 tt tutu~@i ptptO6 d / @h @v@v@g vv  vv vv~@i v v&Ib6 d /`h ЎvЎv@` vv  v v @v@v~@i vv`-6 d /N( h `v`v@ h v v v v vv~@i vv*6 d / `h vvw $v$vn %v%v vv~@i `#v`#v{6 d /GQh vv` (v(vn` )v)v `v`v~@i p'vp'v6 d /m(h 0v0vk .v.v .v.v vv~@i -v-vV?6 d /@h vv  1v1v  `2v`2v vv~@i 1v1vjK6 d /h vv,` MvMv` @Nv@Nv PvPv~@i LvLvMsx6 d /h vv@h SvSv PSvPSv vv~@i 0Pv0Pv˲H6 d /(h 0v0v@` iviv jvjv vv~@i hvhvW)6 d /3`h v v  lvlv^ pmvpmv vv~@i kvkv ?6 d /h vv` PpvPpvWAl pvpv vv~@i 0ov0ov4\C6 d /.D% 0f10f1r@i e1e1 h1h1ve @e1@e1W j1j136 d /~nM9 v vs@ vvt{ vv! vv vvg|~6 d / a2 ??@@pV@pV@u AA1 V@V@` N@A@Ag|~6 d / a2 ;;@g<g<u ==1 @g<@g<` `O==)6 d /`@з . c0S<0S<v F<F< B<B<6S<S<@O<O<Y6 d /` Nr r`6 ۇ@ [ 7@ 00%;4u6 d /. ܧ2@;3@;3 4:3:3@>3@>3@3@3I3I33ؖ6 d //@c`# R3R3T3T3ԾpU3pU3_T3T31:]6 d / %0 PZPZ4 pZpZi ZZC@i ZZL@i `Z`Z%:6 d /ZN 7 P݊P݊ ފފ. ފ ފ ފފ}H6 d /N qqYK2X Z6 d / p6% vv^e v vX{ vv vvPu vvv6 d / r 44` 0404%@i 44Y! 0101/ 11+*h6 d /  ) .9 WW WW< `W`W WWz PXPX%6 d / ;.: Ҭ` @@B @ * J PPRB2G6 d /)@/hs ||F || ||WD S0V{0V{6 ||@>jD6 d /u<WN{~{~O Tu~u~%@i p~p~` ~~7~~6 d / W ""O  %@i '' ''O''ƤIe6 d /6 d /*  ,P@} PaPa aaH lP `Da`Da!a y6 d /۲ ,P@} aa aaH lP `a`a!a g ye6 d /|ݲ ,P@} aa aaH lP aa!a aT6 d /N#@޲ 1+@ @`@` @ ``ZE ``&0`0`"T~6 d /S C[Kj%I6 d /0C,,[,,Kj x ,,3 6 d /&C,,[,,Kj x ,,g6 d /Jj,z $e $e @i eeU8ee pepePePeSO6 d /`1O @`@` ``T  0`0`6 P`P` ``+k@6 d /!  1O ```` P`P`T  ``6 0`0` ``6 d /: 1O ```` P`P`T  ``6 0`0` ``^T6 d /K@1O ```` p`p`T  ` `6 `` ``fS86 d /=x0b0b bb)bb>+` b b 6 d /$#= (  bb0b0bL bb-@P l+m6 d / x$= K<@ e b bN8 6 d /Lx =h :b:b`9b`9b͘9b9b0 :b :b) p:bp:b.6 d / # (`(`^- P)`P)`%  )`)`F& 0*`0*`~'# *`*`LS6 d /@J jIjI 0kI0kI.` kIkIu lIlIx PlIPlI,l6 d /B@}. ``p|` @@ ` ď`@@)6 d />@ II8w II1 PIPI' IIPy5 I IE6 d / y O O O OO4`@O@O2 O O`O O O'6 d /] yOH OOOO@O@OhOOPOPO'6 d /~ 4y p+Op+OC` *O*Oz ! +O+Oս  `-O`-O` ,O,O/6 d /pqD%` @I@I`s`@I@IZ. I I`II IIK6 d /f r@i 0T0T}. АTАTPy5TT`TTPTPT6 d / OU QQ `Y Q QQQs@i @Q@QKu @Q@QX6 d /2 PPO PPY! PPv PP.2 PP"6 d /@ ;2O` HQHQuc 0HQ0HQ pHQpHQ x@ 0IQ0IQ IQIQShh6 d / 2 2Q2QO` 4Q4Q @ 2R2RO` 9R 9RJ07R07R u 4R4Rru 5R5R[6 d /&>@ R R2e R R~@i `R`R3@i 43@i &l96 d /_@ RRRRO` lRlR~@i LRLR3@i PRPR43@i pMRpMR95C6 d / e ppe ppIe Ś  i 6 d //`Lt G1 j   8P P  q=6 d /h` `!`!'kP!P!a u !!@ u !!k!!6 d /^&r@i !!05!!m`E0!0!N1 _p!p!1 !!A06 d /m ,%-`tXt<``  @ s6 d / ,%F& :/`epp1` t 9 LG)6 d /p#`(^ ''` С'С'׻`ep'p'Py` ''P  ''ٵ6 d /j(2 `E)`E)*0D)0D) ((  E)E)x6 d / (P ?*?* @*@*H lP p'%p'%!a 6 d /Ҵ(P^Y*Y* Z*Z* 0[*0[* [*[* &'&'6 d /(P ** @*@*H lP **!a p}6 d /` (L %%@ @ {  i}6 d /1 (P @*@* **H lP * *!a F6 d /ɱ(F& %%05%%Py5%%Ѓd 0%0%6 d /1 (İ4 >'>' r@ P>'P>';4 0>'0>'& A'A'0@ ?'?'^6 d /i{( D ;&;&Ne  F&F&a5=&=& `L&`L&6 d / ( / P%P%F& %%:/`eЧ%Ч%X %%1` % % H6 d / @շ(1 &&D &&e J &&&&s6 d /(5( ((2e 0(0('ce ((#` 0(0(0(0(w٢6 d /v r2 0|!0|!u |!|!/@ {!{!; {!{! p|!p|!*~6 d /oD% ( % ``O % !  ~' ( .?6 d /`6@ N 'J )$d[6 d /0`Be p+p+ p+p+ R ++h}`,++9c++t>6 d /lq Be ++ p+p+ R + +h}`,@+@+9c`+`+C6 d /qBe ++ ++ R ++h}`,p+p+9cP+P+ 6 d /qdzv`kN,N,< O,O, @O,@O, pO,pO,5vs6 d /l wzv`k@:+@:+< P8+P8+ 8+8+ <+<+#;]6 d / `s y @@/ $D+Pc6 d /aj AA FF HH} `?`?u\ ::6 d /Ӵ  e  N ;56 d / Ա pp " "5##6j  m6 d /3@,F& 0v 0v :/`ev v <` w w 1 w w 1` w w YC6 d /+ॲ,F& `x `x :/`ex x < Py Py 1 y y 1` z z {6 d /H,F& z z :/`e{ { < { { 1 | | 1` `| `|   6 d /`V/ ]]w ]]z @]@] ]] ]]C]36 d /4@aV/ HEHEw HEHEz HEHE IE IE PIEPIEC]36 d /4aV/ &?&?w &?&?z '?'? @'?@'? p'?p'?%v6 d /, ,% '@ PPr  +""Dp"p"L46 d /0ر,V/ ''w &&z )) '' P(P( U6 d /A@P^- ppK p+p+ .2 ++:@T @@JN6 d /g:@P^- K ..  .2 ..:@T pp6 d / L@P^-  K @@ .2 @A@A:@T ;l6 d /l'@P^- @@K ,, .2 :@T z6 d /m<@P^- K P-P- .2 --:@T  8p6 d /ͯ@P^- K `1`1 11.2 11:@T @2@2 n6 d /}'@@P^- ``K -- .2 ЫЫ:@T 00 6 d /`ί@P^- 00K p2p2 22.2 33:@T P3P3; 6 d /4B@P^- K // .2 0 0:@T пп^fX6 d /\o@P^- K 44 .2 44:@T #U<6 d /\g=@P^- PPK (( pp.2 @)@):@T  k z6 d /ro>@P^- PPK )) @@.2 )):@T  v66 d /ngί@P^- ``K 33 33.2 44:@T `4`406 d /g@P^- ppK 11 .2 :@T @@rQ6 d /'@P^- PPK p0p0 .2 00:@T  aT6 d /N# ` +@ ## @ `#`#ZE`8 ##&##"4\dh6 d /$[[0#0#Kj x ##T~6 d /S`\ [Kj%I6 d /0\ v#v#[x#x#Kj x {#{#3 6 d /& ] @|#@|#[##Kj x ##*func(context.Context, *pubsub.ListTopicSubscriptionsRequest, ...grpc.CallOption) (*pubsub.ListTopicSubscriptionsResponse, error) AttributesulocationName:"Attribute" locationNameKey:"Name" locationNameValue:"Value" type:"map" flattened:"true" required:"true"IOMergedRecursivenjson:"io_merged_recursive,omitempty" yaml:"io_merged_recursive,omitempty" toml:"io_merged_recursive,omitempty"PayloadTruncatedoprotobuf:"varint,10,opt,name=payload_truncated,json=payloadTruncated,proto3" json:"payload_truncated,omitempty"TotalInactiveAnonnjson:"total_inactive_anon,omitempty" yaml:"total_inactive_anon,omitempty" toml:"total_inactive_anon,omitempty"TotalInactiveFilenjson:"total_inactive_file,omitempty" yaml:"total_inactive_file,omitempty" toml:"total_inactive_file,omitempty"UsageInKernelmodenjson:"usage_in_kernelmode,omitempty" yaml:"usage_in_kernelmode,omitempty" toml:"usage_in_kernelmode,omitempty"a/}Vv 4&ȖQ @jjY! j j tY/6X@@w@94`0~z0Ly ps p׊xī@ ׊wr0/R7`w54bә0uR@w@h `tr tpr]wR8/$\@Rx54bә0%@` h ts ts `@/ R y54bә0@Nh Pts ts$1~H/\y54bә0@h ts t0s  d /@`z54bә0l @h Pt#s t#s1uP/K@S{54bә08@D h Pt /s t.sM d /d{54bә0k&@h 0t3s t2sr/ S@|54bә0@Klh u=s pu0=s!/`|54bә0|@Jm@h pu0?s u>sϲ d /}54bә0ᴦ@`:h uKs uJsk d / X ~54bә03@h P1us 1u@sj'`/3#@Z~54bә0w1@|h )us *ups d />Z`54bә0bh ;us P d /@[54bә03@h @u0s Aus7 d /{[54bә0F  h t@s tsҪx/@@54bә0uR@^@h ts pt s d /@\54bә0zJ@h >us >us > d /L\54bә0@D@h Aus BuPs[/ 54bә0I@ҟh 0Cups CusMs d /*@]54bә09@Uh Dus Dus>k/`54bә0aܚ@7@h Eu0s Fus d / ]54bә0aܚ@U@h Fu@s GusNX d /`54bә0uUE@h ts tsƒ/|@54bә00h pt s tsv:/3?@54bә0ٚ@*ښh cu@'t cu&tWY/h 54bә0{@@h 0Ku0-t Ku,tB /R8^ 54bә0ң8F@h tPt tPtrsq(/54bә0W@Z@h uZt uZt d /``54bә07@ @h `Qu]t QuP]t\ 8/_|@_54bә0V@@h t ct tbtt@/454bә0uR@Kh rudt @supdt$O* d /|@54bә0 @7h pUujt Uujt0 d /o@`54bә02 ƛh 0Wuot Wunt  d / `54bә02h [up{t \uzt d /@ 54bә07@YUh \u|t ]up|t" `/q 54bә0Ņ@Jm@h ``ut `ut"KSp/ `54bә0l@h mut Pnu tD d / 54bә0ᴦ@h cuPt pduЍt^} d /Q @a54bә03@h ju`t 0kutjv,/|`@54bә0Jm@ئh @tu t tut"@ ?/a54bә0~`h @tt tPt&q d / 4bә0 L@h @vP v v vP d /U @c 4bә0@,h vv vPvx d /`4bә0` `f@h Ўvv @v@v d /N(@`4bә0dL@h `vPv vvHER d /Jc4bә0@^@h v!v vP!voؕ/ 4bә0@L(@h v#v v"v"蕖/GQ@4bә0L@L(@h v 'v `v&v` d /m( 4bә0P@UL@h 0v@-v v,vΪ/4bә0f@u@h v0v v@0v.U@/` 4bә0-X@L@h vPLv PvKv[;  d /4bә0 WL@h vOv vPOv% d /[@f`4bә0@\@h pv@Tv гvSv d /(4bә0Hs`L@h 0vPhv vgv d /3@4bә0L@P/`h vkv vkv ( d /@4bә0L@܏Uh vnv vPnv @/>m.4.vW 00~@s 2 2 p2 2t d /@p``4I6,Ӗ'+~` Ppo pPp`o ch/ p` `4~z090_ۖ`& ps SpPo 0Tpo. d /4@/@4XĖ*p˖38 P t{ ;[Z ;[Z\Ż/`r@/`@4K# Pd|`p|0e @[@[ p@[@Zޖ=h/4 `{`+4pBpѪ |{ ThIhyj 0UhIh95 d /k@0՝XlD-` \\e \\z` \\ \\L譖/|@@4-`3y '0z ^e pRGR иRFR ƪ d /  ,%F& :/`ep1` t 9 /H@((4u O w+(i`  *p}*, *}*t:5 d /`0@d D% ( x!x!% P{!P{!% ! z!z!~' ( y!y!彯m d 0бp3L@@Mư@W@@  }(p 0wk d 0 |Pp3r œF @(9sf0 d 0(p3r@ œF@  @(9s`t0,c d 0(p3߅0\{ 90 >00U '@0S;P$$XFM d 0|0p3xr s3(`t308x;8p@$$_ d 0iФp3s3`t3rȉ`& XЖ@(p@  d /3`B,F& 0v a :/`ev a <` w S 1 w b 1` w pb R d /+`&,F& `x ` :/`ex ` < Py R 1 y Pa 1` z a Z֝ d /H0,F& z 0c :/`e{ `c < { `S 1 | pd 1` `| c @4ȁ d ^1f@zPX@Ֆ@c0֖0H Ֆ`&XI@`;xy d /Ӗ/ d J0@ϲ XF '  'H ' u '0Q '@ԗP) d /% ; в XV 9 ]8 (rv  2 G 6`U n mT0&@в;XEGʧ(d ɴϗ' \`Ƨ0 /M`ѲYX -y`$?`$ 3@ϖv Θ`&0XP d ;U@൭ҲeX/`0:@#@0rHy((1 d &1SҲWXq0)–ϪZB kI(dy@<<e j d 2 @Z@ӲWX–Ϫ ז ZB8k @dyh,,t d J0ӲNXF '  'H ' u '0Q '@ԗPN d /`Բ(͗:It }@}/{ }}F& }} bLL d /`- ղ+Xȁ`VȗU1`&7`& `&(Ƙ`&08,H:  d T1` wղ 'X`Ŗ`3|`Uw:v X@ 00X@ P@8cd d `1+C`ֲ`7X@pLpj0,WH}~`Uh *h/.4Eײ`7X0 3 3Hɖ 3 Yؖ 3(g!00( /<6 d $0lZIײ;X'@604  3(;0Z @84,(F d 2@L@ز;XI0–0  0p80@P@8ͫ/F d 0(Lز;XI0Fw(@0Xh P d /{^ |ٲ ,(&Ɨ p[P@} aa aa!a a d /a_ | ڲ ,(&Ɨ P@} apa 0aa!a  P d /{Oڲ ,X' 30@XI; ;"Q3$#(./``۲ ,(&Ɨ }1P@} aa Pa@a!a _/`ܲ ,(&Ɨ `@P@} aa aa!a :=E d /m` |ܲ ,(&Ɨ pP@} a`a @aa!a  R d /  3P< 3XLߘ;`p@hxx44} d 41w` ߲CX`&`&Ryy8J@Hz8͠`, JP/\R߲,XŖ 'Ȗ 'Xp ' vB0BB@`&P$t| d /` `NX @Z006Ǜ0(w4(篚&@, хx d &0@l` NXA&@< 6Ǜ08w48篚&P$ d /I` xX0֬0˴" 6Ǜ0(w4(篚&@$K( d /'` @xX(80˭&wK06Ǜ0(w4(篚&@$# d /p` xX(80˭&wK06Ǜ0(w4(篚&@$El9 d /t` xXm0˭&wK06Ǜ0(w4(篚&@$Dv1x d /! ` xXm0˭&wK06Ǜ0(w4(篚&@$%$oU d /` xX(80˭&wK06Ǜ0(w4(篚&@(C d /` `xX@֬0`@&(6Ǜ00w40篚&H B d /p` xX@֬09;&6Ǜ0 w4 篚&8$) d //F!xX0;"ר6Ǜ0(w4(篚&@ 붃g d / ` @xX0$˴" 6Ǜ0 w4 篚&8(q) d /#,` Xϛ&706(6Ǜ00w40篚&H,(hB d 1SGa|,Xr:_x~_ B 3(,`(0N/@^ ,X @yQ ϗ(((2!&0Jj |,XRsvB;@oب ]v0@ < d /\` `YX]N60 36Ǜ0 w4 篚&8((2 d 0:`@<X ;Pؖ ;0E0 y05#`j@88nj0zi1XȖEޖ0 ' '( '8ۚH4,w$(1l@1X}0y& |X ǖ '@$0P.`,$I2H27@m=X~0Hږ00 –^0ɀ0@ `&PFW d /n =Xr@i @s  x x K> Py`" "((ҥ] d >1 =Xx`&[`& ҃(dy8@ H w1U`-0@=X r@BzRsvBԘ; ͆A(dy0((ߦ d &1`=XJٗx z舖< (dy@($42k1XՖ;`&d0K`j O`j0|—0@44 d 0`1XՖ;'}ٖ`&0`&8$@44y d 0t@1XՖ;'}ٖ`&0`&8%@( d /Ju@<Xϛ&706(6Ǜ00w40篚&H d /Hj`e `Xr@i V/@i / 05m`EN1 _ @i Py5(( @ d |2` Xe}@_!(t` 0 8 @*w@EH$u'k d /<* @@XX/`&`&Tb`&*`&X^0 zF0, m@00f۬`XD{@@i 8ϖ@0;@:  'H((lH d Z1J-2XҖ@H#0Xm;(0p`8pH( P× d @09'P@Xۖe~`;`i > (ۖ 0&ǟ80,LO d \1`Q@ܬ@@X`O >@1pgHe;XԠ;ZO;\44*k d p0p`@ܬ@XpXϖ`& (dyP`88r d x0@ܬ@Xs`H}0n @Hdy`((pX d 14U Xp p`p`z`& : (#@,(|81 x``BX#0m0 #0 ~00n`&@/0HY*Mh/D`=X:;;Ĝ;ؗ;M;(; 0$+t d 1` ƭvXr`d+ 90(+˟@͖;X 3 d /oX:v0v`&tQ;~;hq`& ؖҟ(0C/t@$X&Hz`ա ֡4 e4  $$W d n2j ((XFgRsv; (rݢ8@@&t d /@o((( p[P *@I* P*I*!a ^[ d /p( (( P )A* p) B*!a 2 d /@7(X' 30@XI; ;"Q3$#(sX@/B`.(`(( }1P )N* )`O*!a 7%`/@((( PP *R* @* S*!a ŭR d /K{` ((( pP )S* )T*!a >v d /#H/(@(( pP 0*^* *p_*!a V/1 ((( xM 3P @* U* *U*!a = | d 0W((XpHRsvʖ   yԥ( 0inЧ/ ( (XZX҃;;c@];  d /`((X)= 3S0j|`2p`? Sf(T 30((R/ d 14@0(`(Xx S8#0)#0R(ߟ0ࠥH,$ d v1,`"+X̖`,ҖR" `&(t00s>ҟ@ /&)@LXq37~^?0}0 A`&0`Ö38/0i@Xh<hd|,33 އ3( )ź(/r@Xۆ` s;6z8̖ 6`&Xg`3`X d /fiQX 3< 3 33<3<27CL/6W Xr3p33s3s3 dy3(g/2@bXۆ` p9;;+5 3 3 /2`X@іll0li3h o8 3( 0 d /e6  X֖3ܕ3.2Ė&Ö 3\Ֆ 3;=j/  X!j44.( d 0-6|@ ,X`0t( '@* 'P\@` [ZP/!@  Xr2?2Pl2d2 ח2֗2D  d 3=#@!` ` X  zPۗ;Xg`&`xh H@l( d 1N#` ` X    3P< 3XLߘ;`p@hxx*func(context.Context, *dynamodb.DescribeContinuousBackupsInput, ...request.Option) (*dynamodb.DescribeContinuousBackupsOutput, error)*func(context.Context, *dynamodb.RestoreTableToPointInTimeInput, ...request.Option) (*dynamodb.RestoreTableToPointInTimeOutput, error)*func(context.Context, *dynamodb.UpdateGlobalTableSettingsInput, ...request.Option) (*dynamodb.UpdateGlobalTableSettingsOutput, error)*struct { algo x509.SignatureAlgorithm; name string; oid asn1.ObjectIdentifier; pubKeyAlgo x509.PublicKeyAlgorithm; hash crypto.Hash }CcGenericServicessprotobuf:"varint,16,opt,name=cc_generic_services,json=ccGenericServices,def=0" json:"cc_generic_services,omitempty"JavaMultipleFilessprotobuf:"varint,10,opt,name=java_multiple_files,json=javaMultipleFiles,def=0" json:"java_multiple_files,omitempty"PyGenericServicessprotobuf:"varint,18,opt,name=py_generic_services,json=pyGenericServices,def=0" json:"py_generic_services,omitempty"UninterpretedOptionqprotobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"*struct { F uintptr; kt reflect.Type; vt reflect.Type; unmarshalKey proto.unmarshaler; unmarshalVal proto.unmarshaler; t reflect.Type }*struct { F uintptr; req *pubsub.ListTopicSubscriptionsRequest; ctx context.Context; c *pubsub.PublisherClient; opts []gax.CallOption }BlkioDeviceWriteIOpsqjson:"BlkioDeviceWriteIOps,omitempty" yaml:"BlkioDeviceWriteIOps,omitempty" toml:"BlkioDeviceWriteIOps,omitempty"LinkLocalIPv6Addressqjson:"LinkLocalIPv6Address,omitempty" yaml:"LinkLocalIPv6Address,omitempty" toml:"LinkLocalIPv6Address,omitempty"SecondaryIPAddressesqjson:"SecondaryIPAddresses,omitempty" yaml:"SecondaryIPAddresses,omitempty" toml:"SecondaryIPAddresses,omitempty"*[]struct { algo x509.SignatureAlgorithm; name string; oid asn1.ObjectIdentifier; pubKeyAlgo x509.PublicKeyAlgorithm; hash crypto.Hash }AdditionalBindingstprotobuf:"bytes,11,rep,name=additional_bindings,json=additionalBindings,proto3" json:"additional_bindings,omitempty"*struct { F uintptr; c *pubsub.PublisherClient; req *pubsub.ListTopicSubscriptionsRequest; resp **pubsub.ListTopicSubscriptionsResponse }IOServicedRecursivetjson:"io_serviced_recursive,omitempty" yaml:"io_serviced_recursive,omitempty" toml:"io_serviced_recursive,omitempty"ReadCountNormalizedtjson:"read_count_normalized,omitempty" yaml:"read_count_normalized,omitempty" toml:"read_count_normalized,omitempty"Fw d / 5`bL ?`0`R `& \`&( 6PZ d /S @N@I`&: Pq@q?` qpq< qq"O q[A< d /@b5: xu@yu?` pxut< xuyuI 00)` d 0 [l@L )ԖVw M@ʗ`Pʗ`X7 11(e9 d /8q{+ꄖ6e 55/ 55܄ 55  0505,(R d 1>`7L ז'ߖ'Z &;@^ԗƮIba pS",(7m>Y d 1. 7L ז'ߖ'Z &;@^ԗƮIba S",$g`0n`,L|y(ږ;80@Ŗ;PD *dc$.A d /_J` e`LS0@Q-`& `&(חğ0P M990(L~ d 1 ((Lٗ0ҙ00 0UHPy@ 8*@'*[16]struct { algo x509.SignatureAlgorithm; name string; oid asn1.ObjectIdentifier; pubKeyAlgo x509.PublicKeyAlgorithm; hash crypto.Hash }*func(context.Context, *dynamodb.DescribeGlobalTableSettingsInput, ...request.Option) (*dynamodb.DescribeGlobalTableSettingsOutput, error)*struct { Families []string; Buckets []trace.bucket; Counts [][]int; Family string; Bucket int; EventLogs trace.eventLogs; Expanded bool }*struct { sync.Mutex; byName map[string][]string; byAddr map[string][]string; expire time.Time; path string; mtime time.Time; size int64 }AckDeadlineSecondsvprotobuf:"varint,3,opt,name=ack_deadline_seconds,json=ackDeadlineSeconds,proto3" json:"ack_deadline_seconds,omitempty"AckDeadlineSecondsvprotobuf:"varint,5,opt,name=ack_deadline_seconds,json=ackDeadlineSeconds,proto3" json:"ack_deadline_seconds,omitempty"PhpGenericServicesvprotobuf:"varint,42,opt,name=php_generic_services,json=phpGenericServices,def=0" json:"php_generic_services,omitempty"PhpMetadataNamespaceuprotobuf:"bytes,44,opt,name=php_metadata_namespace,json=phpMetadataNamespace" json:"php_metadata_namespace,omitempty"*struct { F uintptr; whyNoGNU *string; format *tar.Format; whyNoUSTAR *string; whyNoPAX *string; paxHdrs *map[string]string; h *tar.Header }IOWaitTimeRecursivewjson:"io_wait_time_recursive,omitempty" yaml:"io_wait_time_recursive,omitempty" toml:"io_wait_time_recursive,omitempty"ServiceAccountEmailxprotobuf:"bytes,1,opt,name=service_account_email,json=serviceAccountEmail,proto3" json:"service_account_email,omitempty"WriteCountNormalizedwjson:"write_count_normalized,omitempty" yaml:"write_count_normalized,omitempty" toml:"write_count_normalized,omitempty"HQYH/` @# S@H ^ ֡ &c;= j @K h Pk J - l d /*[`f#`@p`'Y'#`&D{ҟ*'c 3j0$j.2n @4jp$j 9h/$5@bә0eY`E@h Pt0s ts d /, %5@bә02H < h pt(s t (s  d /r7%5@bә0l  @@A@h t@*s t)s  d /E\`&5@bә02Y  h t-s `t-s u/ # '5@bә06{ĜĜ Ĝh t1s @t0s ZX d /'5@bә0uALh puprs uqs [8Zh/X @(5@bә0ٚ*ښ@pߚh `ous ou@s OYp/rf(5@bә0l@8x7h fus @gups _RѺ/{@)5@bә0R@ҟA@h ?u0s 0@us:f d /28 *5@bә0l@I@(` h us 0ups8 d / *5@bә0@ě@~` h t0s 0ts @O/ `+5@bә02'  `@h us us ݘ d /?,5@bә0uALh @Hut Hu@t mؔ/,5@bә0l@ ~h Phu t hut 8(/p@-5@bә0`ě@u@x5@h 0t 7t t6t ]'/G -5@bә0ǧ@u@h 0up9t u8t 2ፚ d /.5@bә0uALh plu@t lut  / ` /@bә0@L(@X h `v v Јvv p~//@bә0L@L(@䀥h vv Pv v$(/>@m`0@%@. vV 00~;@ 11y 11 q d /xm@|1 @I}&0ٖ@00ps pN` ppO>m d /x1@H&hT&&hۖ9t }h} }g}:o d /w@2+C )hPgL )h0g?P*hgy*hPgؾ p+hgsB| d /l8`2 `7`0d r@i }DK> | d d m2 2@i 44ƃ d j1 `3`7@!W1 3x ݮ@` }0Z` Z8RZ Zf> d /ߝI 4 ;`D% `iH/ V/u 8@i 1 X= u ᏎC d /H@<4 @`- - }. v @ | 1 .2  . d /UN@!@be pI`ILe АIIe 0I I8ue IIw II `II?W d /$!9Hrd II1e I`Iye IIe I I @IIg II  d B0б6p3L@@Mư@k W@@( }0p 8((z d 2o07p3@| 0s( 008t`H(T3 d /kr@d7p3/`&J 3p 3`Ζ 3 ; 3((p0 3H`X". d 3$#p8|C@@i@0׳@HD!@`s@x1k@@D<T d t19Z.3m0 P00Hږ0@;P|Xܖp00p/;$9x+Ŭ`3b,`3x`3(`3 S`30E`3@r`3P@:]/TP:‡  I 8舖PҖ 3h 3p͖;x +/g@;@P@!`ZvZ t';K .=.2 . >a) d /1.@5@;@P@!`ZvZ t|@K 0*;.2 *@<m d /m@@<@P@!`ZvZ txĖ@K P-P@.2 -@Nx/v@<@P@!`ZvZ txĖ0K ,@L.2 `,L=b d /&gw@=@P@!`ZvZ t@Ɩ@K P(5.2 (@6#Ʌ d /\g@ >@P@!`ZvZ t K (I.2 @)Io\ d /ro@@>@P@!`ZvZ txĖ@K )P;.2 );*struct { F uintptr; fr *http2.Framer; invalid *error; sawRegular *bool; hdec *hpack.Decoder; remainSize *uint32; mh *http2.MetaHeadersFrame }*struct { F uintptr; primaries net.addrList; fallbacks net.addrList; sd *net.sysDialer; results chan net.dialResult; returned chan struct {} }JavaGenericServicesyprotobuf:"varint,17,opt,name=java_generic_services,json=javaGenericServices,def=0" json:"java_generic_services,omitempty"RetainAckedMessagesyprotobuf:"varint,7,opt,name=retain_acked_messages,json=retainAckedMessages,proto3" json:"retain_acked_messages,omitempty"*struct { note runtime.note; mask [3]uint32; wanted [3]uint32; ignored [3]uint32; recv [3]uint32; state uint32; delivering uint32; inuse bool }LinkLocalIPv6PrefixLenwjson:"LinkLocalIPv6PrefixLen,omitempty" yaml:"LinkLocalIPv6PrefixLen,omitempty" toml:"LinkLocalIPv6PrefixLen,omitempty"SecondaryIPv6Addresseswjson:"SecondaryIPv6Addresses,omitempty" yaml:"SecondaryIPv6Addresses,omitempty" toml:"SecondaryIPv6Addresses,omitempty"JavaStringCheckUtf8{protobuf:"varint,27,opt,name=java_string_check_utf8,json=javaStringCheckUtf8,def=0" json:"java_string_check_utf8,omitempty"6 d /~vaue fFfF `fF`fF/ fFfF/ @gF@gF1 gFgF' hFhF_x2_6 d /bF@r@i ""|@ @"@"050"0"8w P"P" X""KX p"p"j6 d / ٳ -U %@i е е @ @ y P P ж ж t6 d /  -U %@i y 0 0 /6 d /LD%00=:t`(  @= ;`4v?@@@_ 6 d /h $A`V`Vj< ``%f UU1A0U0U1 ||~@i ZZ2]g6 d /$'d +!+!Py5 D t <. t AC6 d /. b\ ppY9 u  )^ ppF 3'DO6 d /O""g @N@N6[N[N`7 pNpNZ` [N[N NNu ]N]NP(6 d /"Hrd MMF& PMPM8w MMPy5`M`M8  MM `M`M$`6 d / "g NN6^N^N`7 NNZ` 0_N0_N NNu @aN@aN}HG6 d /""g NN6aNaN`7 0N0NZ` bNbN pNpNu cNcN(6 d // y l@i ii0 iiU1B 0i0i~3ii)@i@ip PiPi_n6 d /f@`# `9`9p 99Zu 99:H99`e 99D 99A6 d /` }. oop|` ssď upppp `pp.`q`qf6 d /m: `:r@i popo` oo `o`oe oo050o0oN1 _oou#6 d /@@I- jjps jj pjpjv@i jj^ 0j0j jjJE]6 d / D% PpPp%@=pp%` PpPp҄e p pNpp)ppr6 d /+2ڳ5h tt{ s sB` ss~` ssV= @s@s `t`tL6 d /r7%5h t tP|` +s+s9 ,s,sv ,s,s tt~@i *s*s 6 d /\`ܳ5h 3u3upv` 0s0sw` ssL0` ssS` PsPs P4uP4uoP6 d /ݳ5h uu8`\ ss ss | ssn ss PuPu`6 d /f ޳5h tty` ЭsЭs a PsPs0 , ss}- ss ptptqS6 d /X (5h `ou`ou`' вsвs ( ss`5 `s`s ouou~@i ssiCH6 d /rf(5h fufuy  ssQ! ss `s`s @gu@gu~@i @s@sߤ6 d /{@)5h ?u?uݸ` ssB pspsp` ss 0@u0@u~@i ssYc76 d /28)5h u uy ss`a ss0`, `s`s 0u0u~@i s s6 d /`,5h PhuPhuy tt " @t@tݗ tt huhu~@i ptpt}6 d /p 5h uutB`0 *t*t} `+t`+tB` +t+t@` @,t@,t uu]%`6 d /@h vv vvw p vp v@ v v#=  p vp v `v`vj6 d / .h `v`vw` vvn` vv. vv ЈvЈv~@i pvpv,]6 d //h vv PvPvn vv. PvPv PvPv~@i vvM6 d /!h vv evev `fv`fv fvfv, `gv`gv vv76 d /|@AXse ::>._ @:@:$@o P:P:ăT:: G::52_ ::{?׋6 d /!@w HH& `H`HT HHT `H`H HHqX6 d /JM9 PvPvt{ vv `v`v vv PvPv p vv)6 d /`o. cE@E@v 4@ 4@ p0@p0@6@F@@F@@?@?@y@ E@ E@/!6 d /Py50B0B8 6 BBBB Z pBpB BB/!6 d /  Py5c>c>8 6 pg>pg>b>b> Z h> h> П>П>6 d /0! Uੌੌ}. O/ @@U1O``O3],6 d /٦ษ``Uoopopow`U o opopo`U o o``Uoo `r6 d /6 N0N` " 8 =[ ;e Ѓ` 00,6 d /ؚN0N` PP" 8 P P =[ ;e 00Ѓ` ` ` @ׅ6 d /K`N0N` " 8 =[ pp;e Ѓ` 56 d /˲N0N` " 8 @@=[ 00;e Ѓ` 6 d /x]9`V0{0{9V01{01{X`V1{1{nV2{2{Y\ 3{ 3{D϶6 d / 0@3މމ@4߉߉^L``h;H/ M=ɬ6 d /%  0{ `\`\. : ]]` [[` \\ @]@]z ]]6 d / 0{ YY.`: @Z@Z YY PYPY ZZz ZZvdg6 d /&в;` . {` {) @@= -^8 rA6 d /rqe `u`ur@i RRe SSY! uuy=vvAvv t6 d /T ӵx40}0}F& }}> 0}0} }}Bu @X}@X} @i }},PG6 d / 8 3  xh xh  @whwhe whwh !  ,p6 d /̩! 6h6hyZ5h5h˝ԝ 6 d /յ 5`=@ @QV@QV` `TV`TV* pSVpSV RVRVv RVRV2 pPVpPVU㈡6 d /f!@` LL>`uLL eLL@[5k6 d /&e '| KK|r| `K`K}.f `K`K& KK * KKR KKf@rR6 d /$+``7ps YY2 `Y`Y/ YY& YY pYpY YYI 6 d /Tng`7d YY05pWpW `Y`Y2 YY^) WWЃ @W@W= '6 d / ۮ`7V/ YY YY,(LYLYjNYNY,MYMYG@ 0NY0NYvA6 d /`'u [tZtZA PvZPvZ0t0Z0Zz qZZ ZZ{Z{ZP6 d /* l ,d 0ia0iaP@} aa `a`aH lP aa!a <9o$6 d / ۲ ,P@} aate fafa PaPaH lP aa!a  6 d /?ѳ ,P@} aa^e aa aaH lP PaPa!a l6 d / /PY?PY?w6 d /j+ CICI =I=I.` ;I;Iu p;Ip;Ix BIBIЃP?IP?IV6 d /p, 1D% ll% ll& @m@m `l`l 0l0l@ mm+l6 d /,W}. ppp|` ` ` ` ď`00 !  6 d /o\@}. II/ ЄIЄI IINU pIpI @I@I.2@ II糝6 d /UN 5@be pIpILe АIАIe 0I0I8ue IIw II `I`IWx 6 d /$59Hrd II1e I Iye IIe II @I@Ig II/6 d /^`y% ! 0O0OT  P1OP1Oh 1O1Oh+$6 d /@@XO OOPy5OO>`O`O O O0OO 0O0OLZ6 d /fr@i TT}. `T`TP T T05TTLTT`pTpT_6 d /&:2r PPs PPv PP <PP PP`7 pPpPŪ6 d /rf2F& QQ:/`e`Q`Qv QQ <`Q`Q QQ1` `Q`QD6 d /o=@ (R(RO` 'R'Rps@i p&Rp&Ru ,R,R Gu *R*RP*RP*RJ6 d /X@@` pw0 y00x '@ 'Pt"`D<^}  d T0 ("@9@d]3 'رYwA;X,p{`@hfip  d /J M9 Pvvt{ vv `vv vv PvPv p vv(hr d 0=d!`edXyH''6Ǜ0(; `)w40篚&H({6> d 0 @!`edҟ˭@4y (6Ǜ00w40篚&H(M d 0!`g! `edP''6Ǜ0(; `)w40篚&H((1d d 0 r@/@d;'+  w(T @$f d /i!@/`@d͖-}ҟ;  3(x20PX 382@0$Mj d 0@/@d((@(a@@;Xp˖3Z -xn/  N4: p@;r`6 [ 7@ 0p b\xؚ0!@dr-Fŗ;;S;0!=ܖ' 00߬GU`/o࠳/4K#Qd| /p|0"& 5k5e 55 `5@l5 q)dh/-/d`00]; ؖ;0o08ܖH͘` J4^ d /&kG | ,4&Ɨ #p[(P@} aPa @aa!a |z d / I@` |` ,4&Ɨ R 3p[ P@} aa a0a!a P67/,* ,4' 3I}`@p–ps a :a 0aaHaD  d 3=#!  1d >z Pۗ;Xg`&`xh ;( :GJ0/Z)`@ 140ɖ04U; e 3ap`1 4a` `4a`tlO d P?+@௳dtx  p`&4$ d =dtp`P͖ *`&`&dy(C d 0 ! xd07n0΋` l̴"(6Ǜ00w40篚&H$$ d $19G`J|,dr *l8u} B@(Rsv0J=ҥ@(e d 0e@!`Yd`0qk0w8`(6Ǜ00w40篚&H, 1J d (0`!Yd`P 3+0$+ 6Ǜ08w48篚&P$$4צ8 d 2 <@i1dYq '$0 ~̗('08Ȗ@$$Ds d 2k@1dYq '$0 ~̗('08Ȗ@00SR d j2֠!ള1dRsر 0d 8_+`@H`Hp\P]X((GL~7 d 1K1d0p@ݨٗ; @(p\0r '8rH`P/ =4}0T;dyps 5 d /o 0@d D% ( % O ``% ! ~' ( @@4(@G d 1[E³d00. wn0_ۖ3@ĖҟHhE;`R,/0 iL@ód{&;`t3s3r 9@(Ɔ0iDu/@Oóds3΄3/0˖3 D3(30M譖/1Qijd^2?2 22  3 3 3 Ȓ/j)@U ųd`t3s3p`W 4h{`0 %s3(q30/@ųdЖ` zWr 3Ӗ` W < 3( 30($ y d :1G*`Ƴdt Kp`&P '] ' p +0Jx'8{3Hja/ldz d 3.v Q ٖ 3n  3(Ö&0(zQ譖/Kdz d֖2#2&Gؖ230Ė3|1(:Jsت/7 @ȳ d#2`&Gؖ230Ė3|1D{`dz(($c8s d ,1 7|ȳ,dt3p`&P '] ' p +0Jx'8{3H4 d /z!"ɳ d~z `50z`&8h͖`&@;HmޱPwVS /_= ʳ dq@@`ݖ 3B 3@ǖ 3֖ 3cږ 3  :GJ/Z)!ʳ` 40ɖ04U; e P*$@#1 *$# +$#tlO d P?+@[`˳ dt ͵xp`&4$ d = [̳ dt ͵p`P͖ *`&`&dyMessageSetWireFormat}protobuf:"varint,1,opt,name=message_set_wire_format,json=messageSetWireFormat,def=0" json:"message_set_wire_format,omitempty"ModifyDeadlineAckIds}protobuf:"bytes,4,rep,name=modify_deadline_ack_ids,json=modifyDeadlineAckIds,proto3" json:"modify_deadline_ack_ids,omitempty"SequenceIdWithinCall~protobuf:"varint,3,opt,name=sequence_id_within_call,json=sequenceIdWithinCall,proto3" json:"sequence_id_within_call,omitempty"HierarchicalMemswLimit}json:"hierarchical_memsw_limit,omitempty" yaml:"hierarchical_memsw_limit,omitempty" toml:"hierarchical_memsw_limit,omitempty" Q В/@Olϳ(r0pu@InEjY! nEjV pnGj@ n Hj UE蒖/#@Plϳ(r0pd nNjY! nLjV pn`Mj"zfn@Lj8( d @1d;!@гBXx@V+)0)Hۗ;`ߗ`&hs2R2 d /ʪ г ;h`$ t$ t % & 4& @ ' 2@ O2`' \2 ( i2`( v2( ($P#y d 0W;snѳX`00@T>@Tۗ@T ϖ@(K0@ps x@xph/? ҳ ,(&Ɨ JP@} aa^e aa a`a!a ((̋X0\ҳ,X|y(ږ;81;:4U;<'@D 'ddJQ d /.`ӳ(˖33r} `0`e `p`<e ``M` b d /mԳ =hr@i r D psU s U @i x x  KK> PyNA,H/z/(Գ(( P P*P*^e * Q* 0*Q*!a JQ d /.@Z@ճ (˖33r@ ""e 0""<e ""M` *struct { F uintptr; fr *http.http2Framer; invalid *error; sawRegular *bool; hdec *hpack.Decoder; remainSize *uint32; mh *http.http2MetaHeadersFrame }LeadingDetachedComments}protobuf:"bytes,6,rep,name=leading_detached_comments,json=leadingDetachedComments" json:"leading_detached_comments,omitempty"*func() (func(proto.Message, *proto.Buffer) error, func(proto.Message, int, int, *proto.Buffer) (bool, error), func(proto.Message) int, []interface {})EnableMessageOrderingprotobuf:"varint,10,opt,name=enable_message_ordering,json=enableMessageOrdering,proto3" json:"enable_message_ordering,omitempty"IOServiceTimeRecursivejson:"io_service_time_recursive,omitempty" yaml:"io_service_time_recursive,omitempty" toml:"io_service_time_recursive,omitempty"HierarchicalMemoryLimitjson:"hierarchical_memory_limit,omitempty" yaml:"hierarchical_memory_limit,omitempty" toml:"hierarchical_memory_limit,omitempty" OptimizeForprotobuf:"varint,9,opt,name=optimize_for,json=optimizeFor,enum=google.protobuf.FileOptions_OptimizeMode,def=1" json:"optimize_for,omitempty" * d 30  ڳLdRsvB@ +ץ(dy0 y P xE1X/+2ڳ5Lbә0ÛUĜh ts `tps{|`/71`۳5Lbә0ÛUĜh ts tsZJE d /. 2ܳ5Lbә0l@I@(` L(h uCs u@CsKd8/\ ܳ5Lbә0kh{J\h 3us P4us9% d /@ݳ5Lbә0k@w ` (h us Pusyo" d /@3ݳ5Lbә0W`y:@Jm@h pSus Su@s}1 d /\4޳5Lbә0l@I@(` L(h  us p us   d /f ` ߳5Lbә0@ě@~` L(h ts pt s"X d /=|7߳5Lbә0@>e@D ͦ(h 0iu!t iu tX蔖/p `5Lbә0 gM@r@h u*t u *t/ 75Lbә08 S@@Mh Mu1t @Nu@1tZGF}P/:5Lbә0*ښF`pߚ`h ZuPpt `Zuotl d /X:@5Lbә0le@ @@A@7h Zuut [u0ut zs d 70-Q;Lbә0ͬUvU-X@0L@8h v0v vv|/Lbә0v8@@y@h vv `v@vİ9 d /# Ֆ | v v: `v`v:6vv?` v v< vvbcX/!Lbә0u@@ܚ@r@h vev v0evt;d d /` -`LƖ `@m'-`&Ж V/ ^^ P^^ m.h/~n M̖`9 v0vs@ vvt{ vv! vv v v!<蟖/$+@`7}2 `YZ/ YPZ& YZ pYZ YpZJNY d />@@}~y II8w II1 PI@I' IpwIPy5 II99 d /^&Lr@i @!@!05@!@!m`E!!N1 _0!0!1 !!C d 0Pp ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40l1 d 0 @P ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40J[ d 0kP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40lj" d 0PP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40>k d 0] P ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40u d 0d@P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40)pY: d 0լP0 ʖ`&̖3(p3 i2 ͖ 3J ʤ  h3(8̖ 40N d 0rDP ʖ`&̖3(p3 i2 ͖ 3J ʤ  h3(8̖ 40Z^ d 0 Pp ʖ`&̖3(p3 i2 ͖ 3J@ ʤ@  h3(8̖ 401[ d 0P ʖ`&̖3(p3 i2 ͖ 3J ʤ  h3(8̖ 40(ށ d 0 @P ʖ`&̖3(p3 i2 ͖ 3J@ ʤ@  h3(8̖ 40d d 0 PP ʖ`&̖3(p3 i2 ͖ 3J ʤ  h3(8̖ 40Iۢ d 0P ʖ`&̖3(p3 i2 ͖ 3J ʤ  h3(8̖ 40 d 0& P ʖ`&̖3(p3 i2 ͖ 3J ʤ  h3(8̖ 40*& d 0` @P0 ʖ`&̖3(p3 i2 ͖ 3J ʤ  h3(8̖ 40 d 0 lP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40jr d 0Pp ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 409h d 0& P ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40DI d 0 P ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40,' d 0 @PP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40q d 0E' P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 400C d 0: P ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40  d 0& P0 ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40TC d 0nk@P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40^jm d 0 Pp ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40G d 0yP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40ޞ7w d 0P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 405Y d 0@PP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40j d 0DP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 408 d 0 P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40݅ d 0 P0 ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40)u d 0~ P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40& d 0P Pp ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40? ( d 0 P ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40y d 0QP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40ɕ d 0 PP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40 d 0@P ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40 d 0P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40ʖ@ d 0 P0 ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40zw* d 0 P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40K$U d 0 Pp ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40 d 0!"@P ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40{y d 0AlP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40{y d 0AlPP ʖ`&̖3(p3 i2 ͖ 3Jʤ h3(8̖ 40Cs d 0يP ʖ`&̖3(p3 i2 ͖ 3J!ʤ! h3(8̖ 40k d 03@P ʖ`&̖3(p3 i2 ͖ 3J"ʤ" h3(8̖ 40-Ϣ d 0P0 ʖ`&̖3(p3 i2 ͖ 3J#ʤ# h3(8̖ 40uk d 0~P ʖ`&̖3(p3 i2 ͖ 3J@#ʤ@# h3(8̖ 40q d 0Pp ʖ`&̖3(p3 i2 ͖ 3J#ʤ# h3(8̖ 40<)5 d 0P ʖ`&̖3(p3 i2 ͖ 3J$ʤ$ h3(8̖ 40lH d 0 @P ʖ`&̖3(p3 i2 ͖ 3J$ʤ$ h3(8̖ 406Ґ d 0ЭPP ʖ`&̖3(p3 i2 ͖ 3J$ʤ$ h3(8̖ 408 2 d 0W P ʖ`&̖3(p3 i2 ͖ 3J%ʤ% h3(8̖ 40?ڂL d 0blP  ʖ`&̖3(p3 i2 ͖ 3J%ʤ% h3(8̖ 40u"7 d 0' @P0  ʖ`&̖3(p3 i2 ͖ 3J%ʤ% h3(8̖ 40$ d 0 P  ʖ`&̖3(p3 i2 ͖ 3J&ʤ& h3(8̖ 40" d 0@"Pp  ʖ`&̖3(p3 i2 ͖ 3J@&ʤ@& h3(8̖ 40ku d 0P  ʖ`&̖3(p3 i2 ͖ 3J&ʤ& h3(8̖ 40w d 0]@P  ʖ`&̖3(p3 i2 ͖ 3J@'ʤ@' h3(8̖ 40| d 0PP  ʖ`&̖3(p3 i2 ͖ 3J)ʤ) h3(8̖ 40\ d 0 P  ʖ`&̖3(p3 i2 ͖ 3J*ʤ* h3(8̖ 40e d 0 P ʖ`&̖3(p3 i2 ͖ 3J+ʤ+ h3(8̖ 40S% d 0>P0 ʖ`&̖3(p3 i2 ͖ 3J@+ʤ@+ h3(8̖ 40 ̉2 d 0aP ʖ`&̖3(p3 i2 ͖ 3J+ʤ+ h3(8̖ 400* d 0 Pp ʖ`&̖3(p3 i2 ͖ 3J+ʤ+ h3(8̖ 40;pA[ d 0P ʖ`&̖3(p3 i2 ͖ 3J0ʤ0 h3(8̖ 40b  d 0P ʖ`&̖3(p3 i2 ͖ 3J0ʤ0 h3(8̖ 40!s d 0 @PP ʖ`&̖3(p3 i2 ͖ 3J1ʤ1 h3(8̖ 40{ d 0 P ʖ`&̖3(p3 i2 ͖ 3J2ʤ2 h3(8̖ 40١\ d 0P ʖ`&̖3(p3 i2 ͖ 3J@2ʤ@2 h3(8̖ 40@8 d 0 P0 ʖ`&̖3(p3 i2 ͖ 3J@3ʤ@3 h3(8̖ 40ć9 d 0P ʖ`&̖3(p3 i2 ͖ 3J4ʤ4 h3(8̖ 40Qd d 0oPp ʖ`&̖3(p3 i2 ͖ 3J@4ʤ@4 h3(8̖ 403 d 0 P ʖ`&̖3(p3 i2 ͖ 3J4ʤ4 h3(8̖ 40  d 0@P ʖ`&̖3(p3 i2 ͖ 3J@5ʤ@5 h3(8̖ 40 o d 0 PP ʖ`&̖3(p3 i2 ͖ 3J@6ʤ@6 h3(8̖ 40~ d 0ʻ P ʖ`&̖3(p3 i2 ͖ 3J6ʤ6 h3(8̖ 40Y(G d 0 P ʖ`&̖3(p3 i2 ͖ 3J7ʤ7 h3(8̖ 40'G d 0P0 ʖ`&̖3(p3 i2 ͖ 3J@7ʤ@7 h3(8̖ 40O_f d 0t @P ʖ`&̖3(p3 i2 ͖ 3J9ʤ9 h3(8̖ 40]_ d 0ʭPp ʖ`&̖3(p3 i2 ͖ 3J:ʤ: h3(8̖ 40P d 0P ʖ`&̖3(p3 i2 ͖ 3J@:ʤ@: h3(8̖ 40)} d 0O P ʖ`&̖3(p3 i2 ͖ 3J@;ʤ@; h3(8̖ 40Y  d 0D@PP ʖ`&̖3(p3 i2 ͖ 3J;ʤ; h3(8̖ 40B3' d 0?P ʖ`&̖3(p3 i2 ͖ 3J;ʤ; h3(8̖ 40uN d 0P ʖ`&̖3(p3 i2 ͖ 3J<ʤ< h3(8̖ 40K d 0lP0 ʖ`&̖3(p3 i2 ͖ 3J@=ʤ@= h3(8̖ 40,? d 0 @P ʖ`&̖3(p3 i2 ͖ 3J=ʤ= h3(8̖ 40ۆ d 0Pp ʖ`&̖3(p3 i2 ͖ 3J=ʤ= h3(8̖ 40) d 0D P  ʖ`&̖3(p3 i2 ͖ 3J>ʤ> h3(8̖ 40r2 d 0P  ʖ`&̖3(p3 i2 ͖ 3J>ʤ> h3(8̖ 40ۛn d 0* PP! ʖ`&̖3(p3 i2 ͖ 3J@?ʤ@? h3(8̖ 40/0% d 0J P! ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40ۛn d 0* @ P" ʖ`&̖3(p3 i2 ͖ 3J@ʤ@ h3(8̖ 40,5 d 0 P0# ʖ`&̖3(p3 i2 ͖ 3JAʤA h3(8̖ 40D_ d 0 P# ʖ`&̖3(p3 i2 ͖ 3JAʤA h3(8̖ 40p d 0!Pp$ ʖ`&̖3(p3 i2 ͖ 3JBʤB h3(8̖ 40bbk d 0 @!P% ʖ`&̖3(p3 i2 ͖ 3JBʤB h3(8̖ 40됣 d 0l!P% ʖ`&̖3(p3 i2 ͖ 3JCʤC h3(8̖ 40% d 0 !PP& ʖ`&̖3(p3 i2 ͖ 3J@Cʤ@C h3(8̖ 40ę d 0"P& ʖ`&̖3(p3 i2 ͖ 3JCʤC h3(8̖ 40j}k d 0l@"P' ʖ`&̖3(p3 i2 ͖ 3JDʤD h3(8̖ 40 d 0~"P0( ʖ`&̖3(p3 i2 ͖ 3JDʤD h3(8̖ 403( d 0""P( ʖ`&̖3(p3 i2 ͖ 3J@Eʤ@E h3(8̖ 40( d 0j #Pp) ʖ`&̖3(p3 i2 ͖ 3JEʤE h3(8̖ 40ߋ d 0 @#P* ʖ`&̖3(p3 i2 ͖ 3JEʤE h3(8̖ 40ʡ  d 0l#P* ʖ`&̖3(p3 i2 ͖ 3JGʤG h3(8̖ 40fL d 0a#PP+ ʖ`&̖3(p3 i2 ͖ 3J@Gʤ@G h3(8̖ 40} d 0 $P+ ʖ`&̖3(p3 i2 ͖ 3JHʤH h3(8̖ 40ɩo d 0@$P, ʖ`&̖3(p3 i2 ͖ 3JIʤI h3(8̖ 40[ d 0<$P0- ʖ`&̖3(p3 i2 ͖ 3J@Iʤ@I h3(8̖ 40, d 0A $P- ʖ`&̖3(p3 i2 ͖ 3JKʤK h3(8̖ 40/~r d 02EPp. ʖ`&̖3(p3 i2 ͖ 3J@Lʤ@L h3(8̖ 40I d 0%P/ ʖ`&̖3(p3 i2 ͖ 3JLʤL h3(8̖ 40!3 d 0 @%P/ ʖ`&̖3(p3 i2 ͖ 3JMʤM h3(8̖ 40k d 0h %PP0 ʖ`&̖3(p3 i2 ͖ 3JMʤM h3(8̖ 40 d 0 %P0 ʖ`&̖3(p3 i2 ͖ 3J@Nʤ@N h3(8̖ 40֟ d 0&P1 ʖ`&̖3(p3 i2 ͖ 3J@Pʤ@P h3(8̖ 40g~ d 0D@&P02 ʖ`&̖3(p3 i2 ͖ 3JPʤP h3(8̖ 40\L d 03&P2 ʖ`&̖3(p3 i2 ͖ 3JQʤQ h3(8̖ 405F d 0.l&Pp3 ʖ`&̖3(p3 i2 ͖ 3J@Rʤ@R h3(8̖ 40y׻ d 0_"'P4 ʖ`&̖3(p3 i2 ͖ 3J@Sʤ@S h3(8̖ 40e d 0@'P4 ʖ`&̖3(p3 i2 ͖ 3JTʤT h3(8̖ 40 d 0`'PP5 ʖ`&̖3(p3 i2 ͖ 3JUʤU h3(8̖ 40_S d 0D'P5 ʖ`&̖3(p3 i2 ͖ 3J@Uʤ@U h3(8̖ 40 _ d 0E(P6 ʖ`&̖3(p3 i2 ͖ 3JUʤU h3(8̖ 40mlh d 0@(P07 ʖ`&̖3(p3 i2 ͖ 3J@Vʤ@V h3(8̖ 40v d 0)P7 ʖ`&̖3(p3 i2 ͖ 3JVʤV h3(8̖ 40 d 0E(Pp8 ʖ`&̖3(p3 i2 ͖ 3J@Wʤ@W h3(8̖ 40_V d 0RE(P9 ʖ`&̖3(p3 i2 ͖ 3JWʤW h3(8̖ 40! d 0)P9 ʖ`&̖3(p3 i2 ͖ 3J@Xʤ@X h3(8̖ 40g[ d 0 @)PP: ʖ`&̖3(p3 i2 ͖ 3JXʤX h3(8̖ 40_m d 0 )P: ʖ`&̖3(p3 i2 ͖ 3JXʤX h3(8̖ 409 d 0̮)P; ʖ`&̖3(p3 i2 ͖ 3J@Yʤ@Y h3(8̖ 40g d 0 *P0< ʖ`&̖3(p3 i2 ͖ 3JYʤY h3(8̖ 40$ d 0VP< ʖ`&̖3(p3 i2 ͖ 3JYʤY h3(8̖ 40ۣ= d 0= @*Pp= ʖ`&̖3(p3 i2 ͖ 3J@Zʤ@Z h3(8̖ 40U d 09*P> ʖ`&̖3(p3 i2 ͖ 3JZʤZ h3(8̖ 40Bt d 0/ *P> ʖ`&̖3(p3 i2 ͖ 3JZʤZ h3(8̖ 40Ⲁ{ d 0q' +PP? ʖ`&̖3(p3 i2 ͖ 3J[ʤ[ h3(8̖ 403[[ d 0(@+P? ʖ`&̖3(p3 i2 ͖ 3J\ʤ\ h3(8̖ 400(X d 1@ p3p?;&3) )( 0"`38* H7`3P0(X d 1 .0A p3p?;&3`* `*( 0"`38* H7`3Pޫ譖/`@A@PL!`ZvZ tA`&Y@ȴ K p+J.2 +K  d /Z4@B@PL!`ZvZ t~Ö@(K -p>.2 @.>(/4`@ C@PL!`ZvZ t@ܖ0 0(K / G.2 0pGIOServiceBytesRecursivejson:"io_service_bytes_recursive,omitempty" yaml:"io_service_bytes_recursive,omitempty" toml:"io_service_bytes_recursive,omitempty"*struct { F uintptr; testHookPrePendingDial func(); dialc chan http.dialRes; t *http.Transport; cmKey http.connectMethodKey; testHookPostPendingDial func() }*struct { F uintptr; whyNoGNU *string; format *tar.Format; whyNoUSTAR *string; preferPAX *bool; whyNoPAX *string; paxHdrs *map[string]string; h *tar.Header }ModifyDeadlineSecondsprotobuf:"varint,3,rep,packed,name=modify_deadline_seconds,json=modifyDeadlineSeconds,proto3" json:"modify_deadline_seconds,omitempty"XTn d >b@@+@F@pPؖnpBh4gx 3 3xdy;4, d h1=P+FPpp@pΖ`&&0 f8dyH ` Xp;`XX d P3YG$pw@я06Θ@n(HΘ@enXZΘ@pDU@W}Ͼ d 6\@e HБp*w`&,W  pٖgsYX@qq,$Z d @Bh[`7 H Spdy>Ly`A p`(x`8n`&8z@  'XTP] d `4t!+`Ipz`&`& fs(`Vp9s;@L;40: d 82l@n+Jp`0`h` ((|;0h͖ҟ8d|Pi;`;b006Bd d 1@"#|J,pȖ`0B;]` D`(@0X @H@P$V. d 1ڟ"u@K%px Jx'Ӗ 9(y u@|m;;j;.;<89)1fm`FK`p F0>:0c00 000@9`&Pu}0Xt~0hD@a] d (2QGLvp0q›02@ D08jW0HX0XCW0h0x@<91 McpM0c00r0 400e0@;0PSئ0`490p ayp/aM3p`E`&צ`&6`&f;jo`& O`&(舩`&0xS`&8Sd{ d <`N@@NՖ-*h: q0q?` pqq< Пqq@<1O`VpЗ0|U0}0 00Jҗ0@O0P$ʗ0`+0p00De&2O0p U 0 0 Z;0›8ޜH PX d x85@P 1pYq0 p@z;@ 3 3D0 d 2P@p0\0r !08g0HW0XC\ 'h< 'xDD#3[ d 3Q@p0>@w '({ '8sO 'H0XM@ht"@@?  d 1Z R@pG0G0w0 E00Ԗ0@p@@P(З@hdp<<W$2 R@pG0E0P0 t͙`0 @@0G;PeyXdh@n7i/`S@p`3`3YƬ`3 `30`3@q`3PǬ`3`t`3p((TSB28pT@pt͙` @˙@ ,;0;2Bϙ;40U@8DK@0,ɉ d L0`9Tpԭ3D '2 ' '(L;80@ Pj`&X40Ym[ d 82p@ y@U )p`0`h` ((|;0h͖ҟ8d|Pi;`;b<0\} d 1-{`7!U`ep@0p%ഷ @%(嗯@@6Ǜ0Xw4X篚&p<0 d z2 :!V`epҟ2ҟ.@0:j@81ֳ@@6Ǜ0Xw4X篚&pȹ /,@m W@%@0_ۖ`&A`&Ֆ`& q` 11Ä` 11 1P1ȹ8/,@nW.@0_ۖ`&A`&Ֆ`& q 2 2Ä @2 2 2`2o d /d `X Npi`# s`# ps`# s`# .`# &W `# v`#  @ 7@ `# ,,in d 1L!/Yp͖0Җ &{`&Җ`& Ӗ`&( `&0xіҟ8 Ζ@Px~- d /C@/D@t :`: ::% !:: p!:@:~@i !::u P"::P p:88Dk d 0%#c@Zpv@PĖ HJɨ ;(ŖQ0Rs8` P hS[b d /@yZ )prءyڅv\/ 0G 8 nj`1 hKc d /!s[Npm2Ɩ0—0:;(8Ɩ;*I;,ږ;.tE)0R d /@ \Npm2Ɩ0;r;I;~;ږ; tE)(@@VA  d 81P@! q\ !pر{?0070@0P4`&`_6h@dpPʖ x  d /u`]@O@ DQ;R@ F;8 P݄( j0 gk d /x^9`V0{z9V01{zX`V1{@znV2{0zY\ 3{pzD,˖? d 0<`I^6pn) _)\@\( @HPRsرX,, lE d 0@ @_6p`0y`&i; ; ?;ҟ ͨ8z ͨH,,;1~d2e` ;_ p`b`0ͧ* $`!(# Ө0e Ө@9P$$o蝖1U`;pEٚGʧrɴ ɴ(@0~'8((f1* a;pZ ʧٚGʧrɴ' 6e0'8ߖHHHoϯ d ,4l @QaWpq@ 8)P–ϪXZB`k ̮hdyDD!LMe d 3@T`bWpqĖ0 0)H–ϪPZBXkI`dyx I d /RcW@I}&0ٖ@00ps p~` p~e `~XX d 84AUcWpqƖ 8)P–ϪXZB`k ͮhdy88lw.{ d 20` @dWpq0 ^$`!(Ηͧ0–Ϫ8ZB@kIHdy`LDH d 2$odp– 'vvBpvB B0$ΘB@ҟPf@5hP@v4d;' d 0ů Eoep4Ӗ ҥҖ`Vp (B0Rsر8$ d /& f 'p€`×`B :v(J0E%`&8`&@+A d 8-@]" wf 'pR`LI;PXXp{`ɢx'q&;rl\rf d $4\`g`7pՖm0h}xŘr0A0O@ y 鴁//Tn`h`7@P}`o?;d Y Y `YY2 YY<0Ax\j d x1W+`h`7pZzy  3^ D,` D(z` 8?@gX 3p@@ B d 0` `@i`7p҃I+ ۮ@vHؘX|`P`ohdypTLhw d 3Q`i`7pZzy`|y; "z` ,  4?xg Em/pn^`j`7@P}`o| 3*`&;d YY 0YY2 `YY0(: d 2fK k;pI0\p`p 0@͖E8S@P@h<<Y d R0cO ۬@s ppvʖ 3+  @6 3Xi/;`h͖`fhɖpQ< d 6&`!s2p}~Ԗ (G pA 00'n ǟp`ppG|ؤ5m` t2p}~0(ޖ 80A 0В \ޖp`((QpB2]@ u@7p(Ȗ@iޖ` @w \;08 ;@i/;B_H446 d 2NeR#uBpr`dxIb ASIQA`YH aCx+/H ,u`v,%pG;ϖ;;;v0PW`&z b( J;Y/` (w(p҃Rsv; ʡă`o v;(;*> '0 XG d /0-(w(@ %  3P ^(P *@* *@A*!a 40E d 1(@x(p)= 3ߗ`&p`?>@D`;0 08ٗ0HU0X0$8o d 2|sxpD;s3_$0`(J8΄0@&P?2&X$3 d / ypۆ` r ;7<;$;٫ ' @ (pU0j d /w-y,`tj ¨j Жb| @`w . @(j 0  .  5`/P!z pYq2%;hۖ4?; Y; ;ԏ;ǖ4 d /*y9p#3Е` #e Pe e *struct { F uintptr; s *pubsub.Subscription; gctx context.Context; po *pubsub.pullOptions; fc *pubsub.flowController; f func(context.Context, *pubsub.Message) }Hi6 d /qP@r@i p"p"s@i ""8w ""Py5@"@"6""au л"л" ""6 d /`"@Hrd OMOM- PNMPNMF& OMOM05MMMM` @OM@OM8w 0PM0PM1 NMNM6 d /@l6D%% ff0f0f ff% @g@gPw_ 0g0g"pgpgggJGY6 d / $H `# B4 6 +J,6 d /1@@ 0Jq0JqI- `Jq`Jqps JqJqs JqJq Kq Kqv@i `Kq`KqS@ KqKq[: 6 d / }@ %q%qI- !q!qps "q"qs #q#q !q!qv@i #q#qS@ @%q@%qt6 d /B @ִ5h ttN+ { P sP sP s s| 0 s0 s| s sB\ s s PtPtaGh6 d /7 ۳5h tt{ 0s0sB ss~ ssV= PsPs t t~@i PsPsl6 d /. ۳5h uuy IsIs ` IsIs0`+ IsIs} - 0Js0Js uu~@i CsCsG6 d /ݳ5h pSupSuS  psps` ss]` ssK` ss SuSu~@i ssd~6 d /\@޳5h  u uy psps` ss0+ @s@s}- ss p up u~@i PsPs`6 d /)ش5h u u`/ ss( ss9A s sH ssRc s s 0 u0 uI+6 d / ڴ5h uu] 0 ss] 0 psps ss psps ss @u@uM6 d / ڴ5h IuIu & tt tt!`q 0t0t tt| tt @Ju@Ju6 d /=|߳5h 0iu0iup  P%tP%t{ `d %t%t`" &t &t& p&tp&t iuiu~@i P!tP!t 6 d / 5h MuMutB0 3t3tB P4tP4tB 4t4t8} P5tP5t @Nu@Nu~@i 1t1t6 d /ʤ۴5h PuPu`& GtGt 0Ht0Ht!q HtHt` HtHt| 0It0It QuQu6 d /N @ܴ5h tt^ NtNtG c @Ot@Ot 0 OtOt1 OtOtΎ`4 0Pt0Pt PtPtY6 d /`5h ZuZu % tttt' @tt@ttՍ`/ tttt 5 tttt `Zu`Zu~@i ptpt+,6 d /X5h ZuZu yt yt9 ytytv zt ztf ztzt [u [u~@i utut96 d /-Qh vv`k vv?`k `v`v, vv 0v0v vv~@i pvpv-膖6 d /ݴh vvw  @\v@\v  \v\v  @]v@]v  ]v]v,  @^v@^v vv+6 d /k`:r` ^^% ^^ nЃ^Ѓ^j& 0^0^uq^^~' {^^@ P^P^E66 d /No@ ;E;E|` 0E>ETݴ6 d /ګ% 0@0@@` ` @` @ p#@p#@8w "@"@ #@ #@` ` @@4@@`;X6 d //`p|` PDEPDE; DEDE EEEE8w PEEPEE EEEEE` FEFE@ pFEpFEª6 d /ѱ@ܫ @vp>p> 2` `>`>x>>R>>p>p>Rj>j>q>q>E66 d /N q  0?0?|@` ?? ??8w 0?0? ??E ?? P ?P ?Tݴ6 d / ޫ % P3<P3<@ 4<4< 7<7<8w 6<6< @7<@7<`  3<3<42<2<56 d /2[D% 11E P1P1-E p1p1 X `1`1h Э1Э1&s 117 11&w6 d /`Y@/D@t : : : :% !:!: p!:p!:~@i !:!:u P":P":P l:6 d /`9::RAФ:Ф:Rp:p:6@:@:e ::` ::::!B6 d / Nr@i -- ))} --& , ,\ ** **Y p+p+x6 d /`^ !-e 1 ye =   PP Q 00W6 d /` & !V/ ``w@G ppw z  0 0 D RW6 d /-@ߵ ! -e ``1 ``s ye = ``   JGγ6 d /gдs 8{8{:& 8{8{y 8{8{ p9{p9{~@i 9{9{yw P:{P:{ :{:{Xx6 d /m`6yzz  zzz>R`z`z.. ( SA6 d /)mε6yzz  zzz>R`z`z.. ( D6 d /<``^6y@5z@5z  z/z/z>R:z:z.9z9z.P4zP4z ( !w6 d /6@rG )z)zp`z!z!zyz0%z0%zT* y(z(zm*`yp(zp(zyzP"zP"z`Sp)zp)zZ6 d /;5  .; PP@+ 0  PPT  u6 d /Y Ůpye ||L.e ||S. ||w@ ||xe 0|0|F p|p|Z`V 0|0|s26 d / .7(r@I ``r   %@i Y! / iI M` `  6 d / ѲYj/ M}M}5 0G}0G}ta K}K}@ PI}PI} L}L}؄ PF}PF} F}F}6 d /vn`Ѵeqe 0Յ0Յr@i ՅՅe ՅՅY! 0օ0օy=ccAdd W 0e0el6 d /% ʮW`T}}O T}}%@i 0}0} }}7`}`}}}H )6 d /ʮWTd~d~O Tc~c~%@i g~g~ 0g~0g~7g~g~ f~ f~H6 d /A W Upo~po~O T j~ j~%@i s~s~` Ps~Ps~7s~s~p~p~Hk~k~s躧6 d /l aW`U~~O T~~%@i `~`~ ~~@5~~`~`~H~~"6 d /t_WU~~O T~~%@i ~~  ~~50~0~~~Hp~p~O6 d /<W V~~O T ~ ~%@i ~ ~ ~~5P~P~H~~V:6 d /`ҲW`Vв~в~O T~~%@i P~P~ ~~5~~H~~6 d / bWV~~O T0~0~%@i `~`~ ~~5~~H ~ ~' 6 d / `W W~~O T~~%@i p~p~ ~~5~~H~~+6 d /A`cW`W`~`~O T~~%@i ~~` ~~60~0~~~H~~6 d /WW~~O TP~P~%@i ~~` @~@~6~~`~`~H@~@~g 6 d /]`WW~~O T~~%@i ``` 6H~~! 6 d / W X  O T%@i p p   5  H!6 d /ӡWX//O T))%@i `2`2  11622@1@1H**'S6 d /n WX`9`9O T44%@i :: ::5 ; ;H55k6 d / ӲW Y`A`AO T<<%@i CC` @C@C6CCBBH== 56 d /W`Y@J@JO TFF%@i LL LL5 M MHFF}TB6 d /z`x40}0}py }}F& @}@}> }} } }Bu q}q} @i }}'6 d /`7V/ ZZ 0Z0Z,(@Y@Y pYpYPYPY:H`Y`YG YY+ u6 d /!`70d pXpXr@i 0oX0oX oXoXK> nXnXd 0qX0qXd oXoXm2 nXnX]&6 d /pn@j`7d YY 0Y0Y2 `Y`Y,(kXkXz kXkX.lXlX 56 d /{@ٲ ,P@} aa2}d aa۷e PaPa aaH lP papa!a .{6 d /aٲ ,-d @Va@VaP@} aaȂe VaVa 0a0aH lP aa!a 6 d / I  ,P@} aa2}d aa۷e aa a aH lP aa!a  .6 d /\ ŷ,l@i eed@f @e@eP  ee` ee<` pepeH @e@e eeIGx6 d /SG@,: p-ep-e /e/el ,e ,e 0e0ez +e+eٕe +e+eY P+eP+eX&6 d /h@30r PIcPIc> IcIc0Wc0WcQTcTcpKcKc| PcPcV IcIc276 d /  !I!I II.` IIu IIx IIsIIЃIIݽ6 d /8^y &O&O` *O*OC` %O %Oz ! %O%Oս (O (O``'O`'OB  (O(O 6 d /$6qOI IIpI PIPI"`I`I$@i 0I0IBI `I`Ir II`IIt6 d /- }. PSPSv дSдS@ SS| 0S0S1 SS.2 SS  SS0YC6 d /D ±2` ИQИQ}.d `Q`Que QQ/ pQpQ| @Q@Q QQe  6 d /@`L pRpR1@i 0R0RD@i RR@i RR @i RR@i =6 d / a`yr@i UUx@i UU4B UU  UUAB UUг@i кUкU܆ UU/6 d / @Zt` UUr@i U Un `U`UVD`LUŮЉUЉU0U0U*܅6 d /bB $0_U0_U0 aUaU6 _U_U@i PaUPaU `_U_Uy `U`U`H ^U^U8vT6 d /" [r@i @U@UPy5UUG UUz@i UU` U UQ9@i `U`UR@i [6 d /[K  $ Q Q0 QQ6 QQ@i pQpQ `QQy PQPQ`H QQLnׇ6 d /Y=/ PKJPKJ1 KJKJ LJLJ> pNJpNJP4 QJQJ8L,L,-6 d /m@N,%&  00ϓ Qe ߘ c`dppR  w:6 d /$ ,%&  ϓ Qe ߘ c`d  R ]6 d /B ,%&  ϓ 0&0&Qe PPߘ c`d&&R P'P' 6 d / P,%& 1 1 P1P1ϓ RRQe 11ߘ c`dSSR SSam6 d /@(P **2}d h%h%۷e `h%`h% P*P*H lP **!a Z6 d /(-d P9%P9%P ))Ȃe 9% 9% p)p)H lP ))!a Ȣi6 d / ࿳(P **2}d j%j%۷e k%k% `*`*H lP **!a M&̔6 d /@ŵ(İ4 7'7' r@ 4'4';4 1'1'& ;';'0@ 9'9'x@<'@<'Y='='F16 d /p`s4Pe `7 X (, (h6 d /H)ȵ`7 PsPswwb ssu rr { {zzDrri6 d / C ַe  L @ 6e g56 d / t4Pe `7 00 X (, 6 d /,@ O/nz``  w 8x @@B 00R ``36 d /n ,e  6    !e P#  e p p X6 d /<@P^- K ,,̍`) r S  @@.2 `,`,:@T pp6 d /&g@=@P^- 00=S K P(P( .2 ((:@T ``O6 d /Jg@M@P^- ppHT K ** .2 + +:@T ``0W6 d /w-y,`tj ¨j b| @@`w . (j 00  . f>6 d /* {93Е` e Pe e q%6 d /`7@ 8w `"`"1D"""" p"p"`""e }e Labelsprotobuf:"bytes,2,rep,name=labels,proto3" json:"labels,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"Labelsprotobuf:"bytes,3,rep,name=labels,proto3" json:"labels,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"Labelsprotobuf:"bytes,4,rep,name=labels,proto3" json:"labels,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"Labelsprotobuf:"bytes,9,rep,name=labels,proto3" json:"labels,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"MessageRetentionDurationprotobuf:"bytes,8,opt,name=message_retention_duration,json=messageRetentionDuration,proto3" json:"message_retention_duration,omitempty"fؒ/Olδ4r00p .R d x2@ݴXbә0jemٚoK@06U8U3@Ph v@v @vP@vP/@<޴Xbә0@u@[@ne@r@ h v\v v[v0,hQp1u c޴@X=0:00 :00@90@0:0P@ ЍHF e 0H0Fc7< d /lߴ x,q ! du  8@ L& ~`' u ;[` 4u ? d /iy@ )xr@i / 05m`Eb] cN1 _1` 1@i Py5``E\ d / ; xV 9 ]8 (rv   -U 2 %@i G 6`U y n /X4 ``7(`&؅y @2Z Y8w 2Z Y1 3Z Y't 3Z YPy54ZY(H d /f xps s`# s ͆`# 0 . t`# p  `#   n d /4,@@ 3x $0 p`X^ʷ` >``6 @ @i `y `\`H 00 d 2&! p3 o7 dyœ(p௷0Xœ81@ @HPPʖ{X3bO00\o@@PX!`ZvZ tA`&0 Y@ȴ0K 4H.2 40I*struct { F uintptr; p **regexp.onePassProg; visitQueue *regexp.queueOnePass; check *func(uint32, []bool) bool; onePassRunes [][]int32; instQueue *regexp.queueOnePass }ap9 d /~vб ap ue @E@E EE/ EE/ EE1 EE' EE$$ d 2[t $|r2``&`&0Ζ`&r ̖`&(`0Zz`8낖`@DD  d (3̨@7# |@ϖvp`x@ m@إ@%H`إP/`٭X,`dyx d 72!+` |p`xp I(і`& 'fsdy03`&@&ҟH Ť/Puu  %|Ӱ;;ϖ;j;і;HҖ; z; xЖ;;TT(w d 3"h` c |Yq0}f~"(ɖ00LΗ@Jh`&Y;-44H2]# W|G`&B0˖0Ȗ0(ԗ084vH*P@?;XՖ` d /m:```:p`r@i po o` oo `opoe o o050ooN1 _o`o$ g d >05  1|@2?ě; X;"Ҝ;$F0;&Û(0ݚ08((#i d 2~ .|֖|֖@Rsvbr`& x@(`0PЖ`8B@@-@H((bH>? d 1@ @|%~0<}0D U_(@~"04&;8cצ;:e;<DK@((+ d R2 O@i` |`̖)t`3`&0Җ) g (e;09;2`08H((+ d R2 Oi .  |`̖ *t`3`&0Җ`* g (e;09;2`08 H0$3k d 22U ! `e|T̳NH4'' 6Ǜ08; `9w4@篚&X($ d 08 f! `e|@2@$˭@Ш` n(6Ǜ00w40篚&Hl`ۏ d 4' ! ~` .|VtF| 0] 0P+)8`p`ۗ;`&p`&LH d L3d  N|9ז0|@ӟ*0(Ŗ8@0hA`&xR`&"Η088 MU d 0 N|ɖ0]`&(TJ`&0$My8lΘH)Pٖ0X}`ĥh  d #0@ N|m20.0;(r;*~;,A;.ږ;0tE)800&qxx1 " ;` |`b+r``0ͧ *($`!0# Ө8e ӨH9Xgߖ69 d /` ;   ٸ0@3bb@4aa^Lh;PPH/ M\\ n n0(D>1_-z ;|E0t{;U{0[`&(;0>z08ś0H;Xz;Z<<  d 2#൭ e|ʖϪӘ@? x08[yHyXp42h2l9pHHxqZ d 44AP` W|qƖ 8^$`!PΗͧX–Ϫ`ZBhk 'pdyHHB d 44u<  W|q@#@ 8^$`!PΗͧX–Ϫ`ZBhk 'pdydd  d 5V W|qƖ ϗ8P)h–ϪpZBxk ͮdydd d 5]@W W|qƖ ߖ8P)h–ϪpZBxk ͮdyLL~ d 3nY` W|–Ϫq0 ז0H^$`!`ZBhkIpdyXLFR d 3n! w  '|2(Ҍ`U,R0ŗ੡8`Ŗ`3X;hp@ pp@ \P' d 43n@ '|`ʗ`30Ҍ`U@}~HBP @ X@ x@ 4,hH d 2yN ;|I0Xp4p0p ~(\p0`p80@P \蠖/* |` ,LӖ;.@Ö@ٖ 3' 3P@} Pa`@a a@a!a AaXTwb d 3e#!  C|z8͠;`&@: (ӖPʖ֨`: p˖;phNQ d 4n!| ,|֖0xȖ0Ȗ Җ@HRsر`PG0_`&&($m d 2+`` `|Ȗ0h`&dyɖ;(X̖0tנ8נ@;HZ;J84jo[1#@]|` ,|0.;Z IN(㛙0˖^8r0Hʖ\X N`&h405xB d 0`   1|0pܨٗ; @(r '0{ '@rP Ӗ`:X0d&`D4]F d 09T` =|(Rsv(hx 38 3@0ʖBH;X`@``3hz{BxHu /STo =|f  ' ' ' b '0M '@  'P  '`d٘ 'pR٘ 'LLzX83-e` |p( '0 '@d| \Ph͖ WXr`dh90xPʖ@3@+}Y3h/`   |VۖV}`."V0Ö`&(_ۖ '0b;@I! \B:! 'H+!X< $ d 403 |_ۖ 'ٖ '. \ $ \"~ŗ;$– 3(ۖ0G8$P<<+ d ~1 # [|| Dr`dؘ; ٘0 oǟ0iHg7ǟP hh̖p@@1`z d 2"j` [| ۖr`dr@r@(@58+@K`/hpk@x44ͷ d 1|-  |`&`&`&(|0ɖ(Ӗ001;@+JHZ `D0\P d / |ϖΟ`@ۙΟ `&8@`&@`&H~`&PXw.p(f / #+ | XȖ`& s (0˖ 38 3@;HS;J;L88 d 1e -f`  |Pؖ࠲Hs@Olۗ0|Y" p`(p`&8Ӗ '@dyP>`DD:F d |3m  ,%| yO`j8H;HCyP4Oy`$`?pSՖzxnȥ .o@n(/( (LӖ;.`QÖ Qٖ 3' 3P ?*p#% @*#%!a $%(() d H0(  (|˗`&  3Y  3\~;ȗy }&0ۚ&8Pݠ@Җ^H009 d l1p!(`  (|,lΘk芙; PE;"O 3(~t0 w8UkP@<\~h^2-`  |*ݖ0qۖ0mc ~0(/080H;X#0`0p$Cد/7)M  |˖3 &&h,G& T&(@&0 &88i&@$ o, d $0T` |3̖Jx 4͆ʖ3  3(͖308z;@wך0s` |ʖ`&̖3(p3 i2 ͖ 3J 4ʤ 4 h3(8̖0xe d /P^  |););ʡ;;X_;`p0 ~8 h L*`k(*struct { value []uint8; multiline bool; flow_plain_allowed bool; block_plain_allowed bool; single_quoted_allowed bool; block_allowed bool; style yaml.yaml_scalar_style_t } Attributesprotobuf:"bytes,2,rep,name=attributes,proto3" json:"attributes,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"E d /^$@X&|M5`mt me 9 < |` |` ` ` |` } 88; d N1h@[@p0Dږ(˗`&8Ö`@Њ@H䊗``hd Qq,q *蛖0)@q{+@z80.090 a00 6p6/0 66 6@6 66o d /Y @@͗&0H t }}/{ }`}F& `}}< }Љ}Gy6 d /٦ad F Fd F FXd @ F@ Fud FFd F F]d F F!< PFPFd FFv96 d /qy Hrd 00%@i 91e w  2 pp ^ у6 d /QD%@@=:t`(00@= %f ;`4v?@PP1Aӛj6 d /l p$ P*P*P !!8w `!`!1 * *'t ,,hu &&Py5**@U --W6 d /* pp ``P 8w 1  't hu  Py5*(6 d /*p ((P 8w 1 P(P('t 0+0+hu Py5((..9lT6 d /t@Sh B B $y C C 0 z pC pC <`z C C PD PD X x D D a`x E E jx E E ρ6 d /u@Sh F F $y `F `F 0 z F F <`z @G @G G G X x H H a`x H H jx H H 96 d /G3`vdq ! `3^`3^ ! 3^3^-0 5^5^Zw 03^03^T p9^p9^̷ `6^`6^P 7^7^ 0:^0:^>Ǧ6 d /Lcr xe 8e ? t`  PPh  x ЙЙRf6 d /`t@I- jjps `j`j jjv@i j j^ jjh jj'B PjPj jjY6 d /T@D% qq & qqI- @q@qps @q@qF& PAqPAq AqAqv@i BqBq^ pBqpBqKW6 d /)P @ EqEqI- EqEqps FqFqs PFqPFq FqFqZ *q*qv@i FqFqS@ GqGq4|6 d /@ HqHqI- @Hq@Hqps HqHqs HqHq IqIqQj )q)qv@i @Iq@IqS@ IqIq$&E6 d / ״5h PtPtN+`{ ssP ss| `s`s| ss, ! s s tt~@i s s-6 d /o@ٴ5h tt@i ss| ssS  PsPs q ss] ss tt~@i ssD 6 d / E5h `u`u  `s`sy  ssP `s`s ssa s s0, psps uu6 d /pF5h /u/uy` @t@t<` tt `! @t@tݗ` ttf`! tt` @t@t 00u00ug6 d /ݴh vvvm AvAv<s 0Bv0Bv$ BvBv`l CvCv4= PCvPCv @v@v~@i AvAvh6 d /_`:0r OO% @O@Ose pOpOt OO%/e OO/e OO0e @O@Oy OOıhP6 d /550r OO% OOse OOt POPO%/e @O@O/e POPO0e OOy OOª6 d /ѱ`׫@`vBB 2 BBxBB#BBRBBBBR B BPBPBIH6 d /@pZpZZZUZZN8W`Z`ZZZ+ ZZBmu6 d / ;j_j_k_k_ a_a_ pf_pf_nf_f_2h_h_, c_ c_ c_c__6 d /  !/` 4 4dA 44"` 440+50+555P@5@5`44O05056 d /- " pmLL- `L`L- LL L LK `L`L0 pLpLPy MM4 L L6 d /Iq` p3{p3{t2 4{4{4{4{ Y 5{5{ 05{5{ 6{6{~@i 7{7{ 7{7{枵6 d /bm r ` %@i @@Y! / MffYyy@i b6 d /U@`;{` @@ 5 ` .: ``9@ ppҬ {) @) >6 d /*`;0{ p p 5    . <   @+ ` ` 0    T p p  ~6 d /* `WTp~p~O T~~%@i ~~e ~ ~ P~P~5~~~~H~~7 6 d /<] _WU~~OS~~%@i ~~ p~p~5~~~~H~~~~6 d //WV~~OS~~` P~P~4~~~~H0~0~~~``~`~6 d /N]`aW`XOSPP%@i  ``@6H``Wa6 d /`] bWYOS%@i @@ ДД@7pp@@H    [Zh6 d / ˮqe PWPWr@i UUe VVY! WWV/ wwy=pTpT @w@wApSpSXwW6 d /I`x4 } }py }}г 0}0}F& }}> }} p}p}Bu a}a} @i }}-g6 d /H8!x4}}s` }}}}F& `}`}> }} @}@}Bu }} @i }}=6 d /$d'j bhbh `D ch chԆ`D0dh0dhz| eheh{ ghgh e chch\Zjhjhj 26 d /+-e ~,~,. v,v,I7` `y,`y,/d 0,0,& ~,~,N1 _{,{,b 6 d /p qD% P(9P(9u d8989ذ `9`9@ &9&9QF"9"9 )9 )9p79p79/9/9Y6 d / t O`$P2SP2SPy5`bS`bS`$6S6S,`$8S8S`$4S4S3`$5S5SB`$3S3S`$7S7S؞6 d /ɫ2' (Q(Q QQO Q QY! `Q`QW *Q*Qu +Q+Qv QQ.2 QQ!y6 d /n@[r@i UU05 U UN1 _ U UPy5P UP Ule p Up Uٕe 0 U0 U8 U U; U U'6 d /XmKz` JJ( PJPJ}.d JJue PJPJ%/ JJ/ 0 J0 J| J J !J !JbF6 d /ZZ# JJP JJ8w J J1 PJPJ't 0J0JHx JJhu J JPy5JJ)6 d /@G$ ""P @"@"8w ""1 ""'t P"P"Hx " "hu `"`"Py5 " "=56 d /C`$qD%` +K+K% 0,K0,K,! ,K,Km! -K-K|&` -K-K& .K .K .K.K'` /K/K2Ы6 d /R q `fKK `K`K`g!K!K/ 0K0Kqe &K&K @#K@#K g K K`g@!K@!K`6 d /[Ե05 b b` bbi cc8 ccxFccC@i PdPdC@i ddHy e eV6 d /|  !!r@i !!q `!`!1 tp!p!0x!!@| P!P! !!ZE`!!V6 d /,l,%V/ w z  00 ``h} `7` ˝PPvD6 d /ަ ,%@<p<ооzK@ @  0 0Q]]}I^^D6 d /#(ۇ' 4(4(_6`% 6(6(*.(.(d 3(3(P2(P2(~P((P((X*(*( @,(@,(q 6 d /*`g(r@i ((05`(`(e ((e ( ($X5P(P( @i `(`(< ( (  6 d /G8(r@i p&)p&) P*P*05**K> 0*0*21 **,|1 **,1 p*p*Py5** 6 d /* Z@r@i 9 9 P9P90599K> 9921 99,|1 99,1 99Py5::6 d /.ypp `-00@ D@ p}<~~` 3w6 d /  8 0`` @1@@8:t926 d /+ ˳ -e 0 #0 #.8 # #I78 ##/d p #p #& # #N1 _ # #b *struct { Periods uint64 "json:\"periods,omitempty\""; ThrottledPeriods uint64 "json:\"throttled_periods,omitempty\""; ThrottledTime uint64 "json:\"throttled_time,omitempty\"" }WC\ d /np8C5dbә0o6@W`xty@ Jm@(h 0t5s t5sL6o d /&:C5dbә0@W`xty@ Jm@(h puas uas%/ ;D5dbә08|@Z@ҟ @v  v (h `=us =ups ,ݒ d ,0 @E5dbә0@@Xxě@ ~`8h `u s us) d /`<F5dbә0@W`xt!@ Jm@(h Wus PXu0sh0VД/pF5dbә0l@p9@M~ x7(h /ut 00ut( ] d ?0 @=G5dbә0̦@;ᴦ@ |(08h iut PjutH d /?@Hdbә0M|@  @hu@ R@(h PvUv v UvV { d /?Idbә0M|  @hu@R@ L@(h @v0_v v^v  ` d /3q` p3{zt2 4{ z4{z Y 5{Pz 05{z 6{z~@i 7{z 7{0z +2/`J4ږ@t/` ~  jIlI 0kIlI.` kIPmIu lImIx PlInI5 d /[j 5p`%l  $QQ0 Q Q6 QQ@i `Q`Q `@Q@Qy QQ`H PQPQ  d /Xm dz` J@J( PJJ}.d J0Jue PJJ%/ JJ/ 0 JJ| JJ !JJ0 @L@Pd!`ZvZ tA`&Y@ȴ HǴ(|Ǵ0K @A.2 @AA,$d d 0Jg@x@M@Pd!`ZvZ tA`&L; }@X(B}@W@K *<.2 +<*struct { F uintptr; srcPath *string; options *archive.TarOptions; include string; pm *fileutils.PatternMatcher; seen map[string]bool; rebaseName string; ta *archive.tarAppender }NoStandardDescriptorAccessorprotobuf:"varint,2,opt,name=no_standard_descriptor_accessor,json=noStandardDescriptorAccessor,def=0" json:"no_standard_descriptor_accessor,omitempty"FullyDecodeReservedExpansionprotobuf:"varint,2,opt,name=fully_decode_reserved_expansion,json=fullyDecodeReservedExpansion,proto3" json:"fully_decode_reserved_expansion,omitempty"IdempotencyLevelprotobuf:"varint,34,opt,name=idempotency_level,json=idempotencyLevel,enum=google.protobuf.MethodOptions_IdempotencyLevel,def=0" json:"idempotency_level,omitempty"dd} d 4q,@+ Q @Pؖnp@hpΖ`&xp; 3 3;x`dyA;!/Q(R0p D%@=:Pt`(0@=  ;`4pv?@P0(ޅs d 2aR b`&Xp4p`&0p\p `p(z˙0˙8G@bpH Ti0/@h+`S 7;.;`ח; ;R(|`&G>`& {;(i;*LDRre3 T 0[0o 0 00\W0@З0Pϗ0`Θ0p8Ö0; A;@ d /@@T@(d0I- @q@qps @qqF& PAqq Aqpqv@i Bq`q^ pBq qH@75 d *2nU 1ۖ0!0K ;0pÖ08@H|ܚ`&`Y`&h$/pQ]@x8P{ d 65`V 10?00  30PØ;8@';@( 3@84S d 1Hl@ W 1 @2` e5 {~@(UY0}H Ɨ`3P32`H@! d `2 $@9W @|;+`m4X֖.0(hܗ`28x@ڙH`xLH=w d 3*oX @Vv@r0`&(00I0@yI`&PѬ0Xy0hļ0xPӬ0D87BX d d1b`Y @m0`&Dۯ G0X0hd};x Ԭ;z;|;~FϬ;T4Q69+ d 2Z Z @R ' '0F0 xD"008@H]@`2 'xT ' 'HH# d 3^Z @00F0ǖ0 F֖00~@ pb"xA;;ٖ"<0M d 2{@![ `e'b.@ v(Ĝ0T8@P6Ǜ0Xw4X篚&p@0 d 0u`@/`\ @0B;K@Rsv0j @@h̖ X2`8 Php˖3xc;z8΍ d /Rn # ] /J2`&͖ҟX`& `&(;0p˖`&H`&Px`&XPX`&``&h,('RpP62]NX*ݖ0~0n`& s(0( #08ɖ0HjF `XLF W pX<4RH d R1@E q^ !@a_6@d4`&Җ Ӗ;(y00ϖ0@x0Pq;```* d \3<]@`_ W|;q(@)X–Ϫ`ZBh4pk̮dyTT77^ d 3tR ` WqÖ0 Ɩ0H^$`!`Ηͧh–ϪpZBxk ʩdyXXU" d @4 U` Wq ז 8P^$`!hΗͧp–ϪxZBkIdy`` d 3N]a W|;–Ϫq}0H)`ZBh4pkͮdyxxF  d L5`]`b W|;–Ϫq}0H)`ZBh4pk dyD<Ts d 0ڬ c @ʖ@|(#`30{5@]&H"`3P(+`3`2 'pƖvy84 Y d 1$` c 10pܨٗ; (?=0r '8{ 'HrX Ӗ`:`0d&hjn d /`ed`nڅ`/Z u \0`@G  nj`1 1 `vs84SXh1 `e Dw0}@fX0 PK 50;@2;B0Ö`&HR`P#X聖h`` "n d E` ۬ f  3֖աC`ԡ(ƖeY"e X–e8d"P ̡hȗ̡ H<D@ d P08f d|`Kw. K.!8Ӗ@XpҖ #Ζ`'ϖ`'((h d 0*(g ({`y'p4 X;(;*Rsv0;@;B;D6H̢4] d /'` (`h(Xr`Җ `Pr@ H˖y( ' @ 'l '88>J($ d f0WH`( i (pr 3R3 Җ)(@ʖ '0C' '@0`^P`^X`^``^h<<,i d 1i (Pؖ`?'`&@L0`& Ō`&(&}g0A '@@P–;hH`?p<8m  d 1,2j qVÖ`,wRŁ` ҟ(pǖ`@vv`&Ppv`&Xzu`&`0h`,>i`k h&3w33}3 ɖ(A` X٘3W3j ,,h_n0X@a l r`s3\,3%s3 `t3(r30383@3HGP||' d 5m#@l @P0Q0Ǵ i0(̖؟8zPӖXTk`&@80|2@1AL!@m @P`0͖0Df0 ĩ00&{Z@ҖZHӖZP ΖX`&``&h*struct { pairs_data []yaml.yaml_node_pair_t; pairs_start *yaml.yaml_node_pair_t; pairs_end *yaml.yaml_node_pair_t; pairs_top *yaml.yaml_node_pair_t; style yaml.yaml_mapping_style_t }$$nV d 2@6 o `#|``.`P`m` Ȗ`(:`0 Ȗ`8`@t p99KQ d /N=oY_@ ;E`>E|` 0E EP?Q[2 d //@?p՘@`|` PDEFE; DE0GE EEGE8w PEEGE EE HEE` FE?@ pFE`?KQ d /N@ .`q Y` 0? ?|@` ?!? ?`!?8w 0?!? ?"?E ?; P ?;$$)J00M+o  r ;Lz0paU 'p0(/'8:& XpS@ YO YVy YS S/ڬrLn 0p#`3r`3(&8qe `u`Y! uy=vAv239 d /p@rs@ʖ4Pe `7 q q X q q (, `q `q p p b9 d /t`t@ʖ4Pe `7 ~~ X (,  ~~` d / u@Sh B ` $y C 0 z pC <`z C PD 0 X x D a`x E ` jx E Q', d /@u@Sh F $y `F 0 z F <`z @G  G X x H ` a`x H jx H ` $Wz d 0\lv@*R0P0 pŖ@0I- nnps PnQj n0nv@i nn pnSjEy%p0>8`w5pbә0{@̦ 1 |@z m@(B@0h ts t`s=V d 0|9 x5pbә06{Ĝd  Ĝ{  @( Ĝ0h t`:s t9s$$yq d 2`x5pbә0VU/›W` y(:@0 @8Jm@@h ;ups ;usթ d 09`y5pbә0@W`xty@ Jm@(\@0h Xut Yu0t,,_L d 02@`z5pbә0H8@d L8B @vHJm@Ph @put pupt~O d 0m > {pbә0` `ʙ@ۚ@u@   ܚ@(~@0h v=v v }pv} `}z} @i } w} FzZ/` ~`7@-`&0~z00(2 ZY/ P ZPY& Z Y  ZY p ZY$ d /4XȬ~x>p*/1@+@:11+:+w@,t,--X./00N10M?2D2@ d /&v\ e `PSe 2 Оe  e @NB `0e   `x6 d /, ٦a q EE%; pEpE@e @E@E8w FF+1< EE EEAe EEx@< EE!< @E@E6 d / ڦa ed 0F0F%d pFpF_d FFd FF/d FF/d FF1d FFd pFpF'd 0F0FY6 d /P`S D%ll=:P~P~t`(hh@= `h`h;`4v?@`m`m>Ejj,E~~6 d /d`HS D%@@=:t`(``@= ;`400v?@>E,E6 d /d'S D%=:t`(@= 00;`4v?@>E,E +6 d /j`v ~4 ^^`@> p^p^> @^@^v> ^^5? ^^5@? ^^? ^^ L^L^` @i 2^2^:93c6 d /X Y pp6rd 2d 000rd |:d ٌ PPF< H 00 &k6 d /n`#  `9`9 `9`9^t 99@ `9`9t 99 99p `9`9E 99t p9p96 d /O  s ͆`# PP0 ppv `# 00 PPv   `# p p H w6 d /> w5 h tt ss. ss]. 0s0sp ss@ PsPsT{ ss 0s0s tt?.6 d /npB5 h 0t0tg+ 7s7sS ` 8s8s/ P8sP8s 8s8sO 8s8sK p9sp9s tt~@i 5s5sYO6 d /|w5 h ttּ :s:s ;s;sG P;sP;s ;s;sX$ v>v` >v>v ?v?v` P?vP?vn` ?v?v vv 6 d /H h PvPvf{` XvXvw @Yv@Yv YvYv< ZvZvɸ ZvZvx [v[v vv~@i UvUv{6 d /H h @v@vf{ bvbv bvbv<` 0cv0cvɸ` cvcvx` 0dv0dv` dvdv vv~@i p_vp_v+6 d /k@֫@/ r` @;7@;7 0B70B7 n 57 57j& >7>7u r@7@7~'`{A7A7@ C7C7LH8787L6767P 6 d /`. - p6p6^!`Z 6 6u`]66L} 66wt `6`6 660 ˝ 06060R . 66_6 d /x& sv p.p. =v .. .. ..{ У.У. ..B ....6 `.`.w6 d /2; D% ` M` M%@i MMps M MF& MM:/`e M My M M8w M M1 M M1` M M6 d / } e }}x4}}s` Ѓ}Ѓ}k` }}F& }}> }} `}`}Bu |} |} @i }}6 d /ů@e 0[ hh hhOYhh `h`h: ~`h`hƐuQ &c6 d /[@   ffP `_`_8w ff1 ff't 0j0jhu bbPy5ggH@k@kPY6 d /  ' M81 pYLpYL@` 0gL0gL1`Y^L^Ḽ7fLfLACeLeL&@i ZL ZL8lLlL@ P=LP=Lp]Lp]L(>6 d /&k , ,xe sasaP@} aa2}d PraPra۷e raraȂe rara @a@aH lP aa!a {4(6 d / D%pPRiPRiPUiUis ViViİ XiXi,( Si SiI QiQi YiYiF `Wi`Wi ZiZi6 d /- x 1` gg gg8w gg @g@g)E ggHDgg  g g. pgpgu g g6 d /9G, :`?dd dd> dd ddȂ` ddz  ddh pdpdV dd}1>x6 d /  }. ɐɐp|` ːːx}ȐȐ ϐϐ` @ɐ@ɐď`PʐPʐ5ːː. ͐͐ܒ\nO6 d /  }. 88p|` p:p:x`\88 >>` `8`8ď`995;;. <<ܒu6 d /?!@-`8 }. `^`^p|` `` ]] pepe` ]]ď`0_0_5``. bbܒ]q 6 d /e#@2 r@i @R@RV/@i RR/ RR05RRm`ERRN1 _RR RR@i RRPy5`R`R]6 d /8[@ r@i `}I`}I}. yIyIv 0{I0{I@ {I{I| zIzI1 zIzI.2 pzIpzIPy5@|I@|I  |I|Iyn6 d /cs  D% `PLSPLSe NS NSt KSKSo` OSOSz 4 PNSPNSZ>OSOS)XNSNSpZSpZS OSOS66 d /9'`@ `H 0Q0Q QQ QQO` RRQQ Q Q1QQQQOe Yz96 d /@ r@i PRPR` RRO` @R@R05RR`u  u ru 9I u ؚ`n6 d /\l q  `fKK @K@K/ fKK/ KKqe `K`K@`gKK~' h@K@KgKK KK~6 d /jl q  `f K K KK/ KKɇfKKqe KK@`gpKpK~' hKKȬ`hKK `K`K6 d /xlq  `f K K K K/ K Kqe KK@`g K KIf K K~' h K K6h K K pKpK/\6 d /*f`L,% r@i  ps  05@@K> 21  ,|1 ,1 Py5pp:ݍ6 d /*`( z ( (( `(`(L p(p(`(`(]` ''e ''`'`'؁  ( ( ((j|p6 d /G@( ,xe V% V%P ))2}d `U%`U%۷e U%U%Ȃe U%U% ))H lP ))!a BZ^6 d /@( p`<$$ %%ΰ*%% `%`% % % $$H$$NcPL6 d /=H1(  @h&@h&J&&E e&e& f&f&@i f&f&5 &&pHe g&g&&& 6 d / 4( p`<k*k* `l*`l*ΰ*  l*l* HNp6 d /lc@%( L |(|(r@i * * @ *@ *05 * *K> * *21 * *,|1 * *,1 ` *` *Py5 * *}]{6 d /o`˵ /B @2@2E`e33z @e 0 0L  p1p18`0`0X 88Ѓ44n\6 d /Ϯױ  vv`w @|@| || @}@}X; }}w {{ `r`rLL+` 0F0F}6 d /&v` e ``Se 2  e  e @@NB 0e  ``@8s d .2୵ qp``Җ@Z`&Ӗ x8Җ`&PRy`&Xdy``&pS;xB;zZN/L 4–tpxpD%0=:@t`( @= ;`4`v?@@,$C* d ;c b*w`& p (pٖr(lr Rh353 q@ct d /@40 0u I- jP jps j j pj jv@i j j^ 0jj j jhh۾u d 5=`dk 0h10+V0 ׹0 ϴ8 l mu@I0n@Wjm nVjEy d X9n@ 1Yq0 @qaV0G`&0  % 4Z9,$huh>2@  @J0t͙` @ ˙@0@@Bϙ;Hd;Jޖ;L(Ȗ;Nޖ;Pޖ;R@8p/R d b1 @d@@Ϭ00}0@ŭ0PDK`E;p;rR;t;v ­;x`T d ;>cവ @@F0E0 0 0(t0X6hqI0x0@0[ 'X9 d > @J{|( 3P Xz Sh0`}9U@@8PBŬ   ԯ@@<<Ê\ d L2@9 @;_;;:"r`?@ 6@0@@yH$\yXhLLo`|4} Y e0!0}~` e0(g08W0HC\ 'X< 'h9xW0U`HHF d 3B/! .` d|@#) *( *0) *8o *@.&H;P;RرY. 8,: d 1n!@ `e@f}!H y(''06Ǜ0H; `Iw4P篚&hdT G d $3S!`  `Bx{V VH`&p*`&x>`&)`&pÖĂ`&2VdT G d $3S=!` `x{W WH`&p*`&x>`&)`&pÖ Ă`&2WLL d 04mi໵ *0 W0Ȗ0 ɖ00@;P̗0X0hbؖ;x.ҙ08 G d /S@ ;΄`x0{dy0/`8 r&@`&H8`&P`&X ;`Ă`&h\\Vժ d D4*  Wq@#@ 8P^$`!h)pΗͧx–ϪZBkIdyޏm/```74 9XΖ`jЖ`j r@i YPZ/@i YZ05pYZ|EYZ Y ZPy5YZw@/t```74–tpxpD%Y#Z=:PY0$Zt`(Y$Z@= Y%Z;`4pYP%Zv?@Y%ZldKX d 4$@@ `7`ݖ`3 3`Ŗ0Ϙ(`3@ԗ`3P`Fx$,WP:s d (=(n"  5whϖ3jt Dϖ`&p{0ׇ`&Xh>`z`<0 d `0>"µ Yl`)`3ͳ`3#^(?0`^0٨8Pt;H]`*P6Ǜ0Xw4X篚&pPHh d H44` µ `iʖ 3sG 68@h`H+PPʖ@xzsɟ D7襖/D`+õdҖLP˖ L M@ΖLK`L dy 5.:-S" ! ;-XT<+ d 3:&,uĵ ,%d@@xϖ`&0y8)`&H;P鯗;R@Xdyp(ϖJ 3x d 4q(ŵ ( hϖ%pΖ 3xXٗ@Od@Od`&`&& ֙;@|@O\l`+hh d P50@ `Ƶ @Rsvpp4 t(t8h3gHϖ`&X6`&`N  ԥhc rp@ {4,_ 1n *#@ǵ pіǵz`@s`Hk`P\ 3X3Z4s3\[3^ח2`U$;dp];f  l/k(`/# ȵ 3 3 3Җ+ɖ3332x (| +0l+8 BN/H)sɵ 3 3 3Җ/ɖ3332x (|.0l 0840gAVH0{)@ɵ 2,2x 4 .2 3 .ô(і20і28іs@іsPۆ` `4,c  1IYʵ d|ȵzô@sôHkôP\ 3X;Z4s3\[;^ח2`U$;dp];fXL0W d 2o[˵ p /p /Q7`3 !`30^y 3@03HP8hЖ << Z d 1d̵ Ӗ;333Ml\ pʖ(k@ 3Xe;`7@Jh%pP:s d (=(n"[`͵ 5whϖ3jt`]ϖ`&p {0ׇ`&Xh>`zढں/)mI@ε6($;yzz  zz z>R`zz.. (  'X/.! ϵ8( – Vp Wڅ`RR/Z RR0`pRR@GRpR RRnj`RpR1 pRR*struct { F uintptr; t reflect.Type; valIsPtr bool; keySizer proto.sizer; valCachedSizer proto.sizer; keyMarshaler proto.marshaler; keyWireTag uint64; valMarshaler proto.marshaler; valWireTag uint64 },$T}; d 1| lеL*R0P0 ܖ00pŖ@@I- nnps Pn0Tj n0nv@i nn pnVj((G46 d 2 ѵ 5|bә0@\@~lđ(l0뜨8D@x@Hh 0u`t 0ut@<ZM' d D1@u#cҵ |ږ}oŖQ8AՖ@@0HՖXd`dy0pe :E:6*0F:( / d 0T`ӵLP`19 &( 0J8x40}S}F& }X}> 0}Q} }W} @i }pR},,nض d (1Re 0"e@Ե |pe);~ =:@`  ş(6 @ؙH~P,(@' d /[ յT 05 be` b Ki cf8 cpfxFcfC@i PdLC@i d@gHy egD< d 1N!zյ X@i  =ߖ(֖0@ Ֆ`&P;X"ߖ;Z{Ԗ;\O;^0M$`Ř0pȖ`&*func(string, *tls.Config, string, string, string, bool, bool, string, amqp.Table, amqp.Table, amqp.Table) (*amqp.Connection, *amqp.Channel, amqp.Queue, <-chan amqp.Confirmation, <-chan *amqp.Error, error)h`Bh d 3`t׵ $Ɩvdy$2 '(ZzE8{1Hʖ@X쐘 `' Eߗ!<< @X&2ص 3d00o0 {`&0I@ќ8jʘҜ@ϙҜH?ҜP@ҜX4X`f;hќp2g d /)`( se 077l` 077"& 077t` `17@7|j 17 !7 @27 7 27 7@ 37P 7 p37`!7x` 37@7\X d (4@ڵ @l(@Vv@ PӬ08ļ0Hy0XѬ0hyI`&xI00`&r0@,at@<2Tc ۵ @dJ0 @ ˙@0ey@0Pǖ '`'ז;pޖ;rޖ;t;vBϙ;xݒ d @8@ܵ @{G0C06Ҭ@ͫ @Hj0`}ͫp^z( 8*0dwD@" d 1v_ܵ X5@f˜@|—`0p@8@P G@h폘pϗ"x!;;; ;THXJ d D3 .ݵ d|.&ۆvh˖(`(@m@H`3`) *p *x0^ *՘\;A d /x`@/ e ::t :@:Ow P: :`v : :J4rP: :W4  : :}. `::1 :p: 0:@:~ :@ :hd` d 5-F qߵ !_6@dq5Җ:  Ӗ;hc0p{?00ϖ0x0Gt0ttpLa d <`! ;` r >`8ř@yT;ʖϪ$`!ͧ*93ШXXs d \4 ڬ@ n0.y`Ҩ AҨ0ߗy@byPC@``yh*yxqٗ@$tddIk d 4ح@  `7HƖ:v `ݖ`3( 38`Ŗ0@Ϙ@P`3hԗ`3x͗` $ ,WDD@ d p4@+"` `7(Ȗ`ޖ@ޖ@ r 90;@(^vHl@`p;h꬗;jݬ;lޘ@ip\@<0 d 2D@! x07n0 &(@;0ʹ`8ʹ"@d׳;HP6Ǜ0Xw4X篚&pDD|H d p3:b| ,rpӳpp B (i/;00r`[8 H^;XRsv`Dp'x00&ժ d 2_$! = @@n 3凖 3ܗ % S(V08:@`<H-;PޘrXS+ d /&^ %` PoOfOe oO@cOe 0pOcO8e pOdOu pO0dO' `qOcO qOhO~@i @rOpaO@R 0eO eOXL3U d 28` d|Jw. K.!8`@@ΟH`(|xӖ1;ݘ;Җ#\T͖/ d 3@ (0ɖ0/0 4֖00@G0hږ`&xNݖ;;P%(*w0<(@H<  d 1JԖ  0^ 0 0;H&Pk 3Xă ,`i`&hV@p ;(i@/ : 's ' ' ,Y '0\ '@ 'P\ '`5 'pWBB Bp p/ d 5] Ɔۆ` br3X;{3 t3(8t Ƴ0t 't3 u Ƴt ' 388" 0%*b p2;s 4 r֗ '( '8 3H0P @X+@`p@hXP( d 2!f @4`&=`& `& }71(̖28x@&{`&X 3`(3xΖe[ҟ<6 d /q   s@i 2s8w 1 PPPy58 6 t j00%6 d /$P |  .G 6 d P`g# #`g@2"@2" $ |ad .&6 d /j ` 8 ..033 ..@1//3@@S==??*88˝;;99)!6 d /^b   Fqt P ПП8w 1 't pphu Py5PP;00Z6 d /) ٵ`( se 07 07l` 0707"& 0707t` `17`17|j 1717 @27@27 2727@ 3737 p37p37x` 37376 d /`x5 h ;u ;u@i ss`| НsНsS ` 0s0s ss] ОsОs9 PsPsK ПsПs ;u;u~@i ss6 d / `ѵ5 h 0u0up tt0`$ t t d ptpt! tt& tt! ptpt tt t t 0u0uŒ6 d /9`y5 h XuXug+` ttS  t t/ ptpt ttO ` ttK` tt` tt YuYu~@i tth6 d / z5 h @pu@puw][ 0t0t; ttv _ tt}. PtPth0 ttH,`2 ttK @t@t pupu~@i t t&H6 d /{ h vvl HvHv+ PHvPHvbl HvHv  IvIv  IvIv. JvJvFC `Jv`Jv vv~@i Gv Gv0C6 d /#`|d 1o n;n;ps o; o;pn o;o;t{ o;o; `p;`p; p;p;pu c;c;W q; q;D q;q;L @r;@r;6 d /6 `e 1` eeФX 0e0e ee8w e e pepe)E eeHDee  PePe. eeu PePeQI6 d /6`e 1` ififPX PkfPkf hfhf8w @hf@hf hfhf)E kfkfHDifif  pjfpjf. jfjfu pifpifEG6 d / `e 1` `f`fvY @cf@cf `f`f8w 0`f0`f `f`f)E cfcfHDafaf  `bf`bf. bfbfu `af`af|zs6 d /7 @ 1` gg gg8w gg `g`g)E ggHDgg  pgpg. ggu pgpg8 @g@g[y6 d /൩D Q2Q2JX2X2^2^2pa2pa2Pf2Pf2Pt2Pt222Ċ0202Ѝ2Ѝ2@2@26 d /S; .`7@M@M91 PMPM| M M7 MMҘ MMmZ@ MM4N 0M0MZ MM pMpMfO MM2H^'6 d /Z $N D% - V/ @@ pp2 ,(pgpg}@d@d` hhz ii9jj2> 6 d /@ N s w wq wwt2 w w ww `Z 0w0w0ЩwЩw ww~@i ww `w`wFeEW6 d /H  N  0 u wws pwpw:& wwd PwPw@z ЭwЭwy `w`w ww~@i PwPwyy ww` @w@w/6 d /c`W  ZO Tpp%@i @@ ЩЩ5ppПП00>pp6DJ6 d /a`CW  Z  O T%@i  5@@>6f6 d /b F PEPE2 FF@s@i DD%`GHHV/ uu 0u0u4PP)`GII5 PRPRpQpQ&6 d /tm hy Dr,r,s,s, t,t,4pu,pu, \ `gq,q, q,q,Ҟw6 d /t|AN 1` PfPfvw ff 0f0f8w ff ff)E `f`fHD0f0f  ff. ffu fft6 d / BN 1` ffӶ[ `f`f ff8w PfPf ff)E f fHDff  ff. ffu ff%,6 d /SBN 1` @f@f_4d ff f f8w ff ff)E PfPfHD f f  ff. ffu ff6 d /I Cx 1` ggw @g@g ШgШg8w 0g0g gg)E ggHDЩgЩg  `g`g. ggu `g`gou6 d /,Cx 1` ug ugt pwgpwg ugug8w `tg`tg tgtg)E 0wg0wgHDvgvg  vgvg. vgvgu ugugc6 d / Dx 1` PIgPIg< KgKg 0Ig0Ig8w HgHg HgHg)E `Kg`KgHD0Jg0Jg  JgJg. KgKgu IgIgg6 d /Dx 1` QgQg@E 0Tg0Tg QgQg8w Qg Qg pQgpQg)E SgSgHDRgRg  PSgPSg. SgSgu PRgPRgLA6 d / Ex 1` ggw `g`g gg8w PgPg gg)E g gHDgg  gg. ПgПgu ggv@6 d /apEx 1` fgfgt igig fgfg8w egeg @fg@fg)E hghgHDgggg  hg hg. phgphgu gg gg@Z6 d /%O Fx 1` $g$g< 'g'g $g$g8w $g$g P$gP$g)E &g&gHD%g%g  0&g0&g. &g&gu 0%g0%g*A6 d /7'Fx 1` gg,d `g`g gg8w PgPg gg)E g gHDgg  gg. ggu ggn%6 d /?O Gx 1` @/g@/gd 1g1g /g /g8w .g.g .g.g)E P1gP1gHD 0g 0g  0g0g. 1g1gu /g/gҥ6 d /Gx 1` gg|@\ gg gg8w gg PgPg)E ЁgЁgHDgg  0g0g. ggu 0g0g86 d /2J Hx 1` g g|@\ pgpg gg8w `g`g gg)E 0g0gHDgg  gg. ggu gg`6 d /H@q 1` `g`gd gg @g@g8w gg gg)E pgpgHD@g@g  gg. g gu gg 5:6 d / MY 1` `Zd`Zd@] \d\d @Zd@Zd8w YdYd YdYd)E p\dp\dHD@[d@[d  [d[d. \d \du ZdZdr6 d /MY 1` @Od@Od"wN QdQd Od Od8w NdNd NdNd)E PQdPQdHD Pd Pd  PdPd. QdQdu OdOd!3@k6 d / V 9 9%V p9p9.V 9 9/ 9 9bV p 9p 9vV 0909u0V 99'V P 9P 9̈ X@9@9c<6 d />" D Q \\.@i в\в\>` \\w \\ G \\ A\\ \\\\-\\˝`\`\~6 d /&^@ %` PoOPoOe oOoOe 0pO0pO8e pOpOu pOpO' `qO`qO qOqO~@i @rO@rO@R  J6 d /  O?SSHSS{SSt`SS; SS5 SS>PSPSQЬSЬS֌SS` SS֝6 d /]t@7 t` `T`Tr@i PrTPrT, LlTlT` gTgT0 jTjTVD`LdTdT%F@i sTsT@i qTqTSa cT cT, 0lT0lTz6 d /  bZ t` U Ur@i UU, LpUpUn UUPUPUPUUUU` `U`Ut6 d /?7B - !U!U- !U!U p!Up!U}. lUlUv plUplU@ lUlU| @mU@mU1 mUmU.2 mUmU  @nU@nU 266 d /b ( / Ю%Ю%R0 %%-U %%%@i `%`%F& p%p%05%%Py5%%F %%Bp%p% % %v6 d /M( qT I&I&s I&I&P J&J&0%%Py5N&N& L&L&N&N& PQ&PQ&8Q&Q&Ѓ`O&`O&)6 d /``  <$<$ =$=$s@i 0=$0=$2sp=$p=$8w =$=$1 =$=$Py5 >$ >$8 6 `>$`>$t j>$>$>$>$ M6 d /i z  `` @@{e ) 6 >+ @@   7 V _ } 6 d /@u h. `~ `~ F& } } 8w } } } } Py5  8 6 t j @ @  5 &6 d /tm hy D@"@""" ""4"" \ `g@"@" ""44 d F2`t$dyLy8]y ny0}@$2X,{ `'d +! D t  t @ 9/m@H64$';yzz  zz z>R`zz.. (  ~C, d /3 N s w2wq w8wt2 w/w w00w `Z 0wp(w0Щw(w w5w~@i w?w `w;wFeBw X* d /H3 N  0 u wKws pw`Qw:& w@Hwd PwHw@z ЭwIwy `wHw w0Ow~@i PwJwyy wLw` @w Mw,,vW d 1 `@  5bә0YU@@Xp9@ x(ě@0~`HLPh uPs us,, d 2` ! 5bә08@xI@(@0 85@@Jm@H\Ph PtJt tIt0(;e d F0H8"XP`1L`: t '(Y&8&@HHx4}}F& `}}> }н} @} } @i }}#Y d /@ee"ps o.]pG@c 6G5` P . &8 oX  :} ( w Py5 (  NYRDP/eM@#@2(}@`0r@i @RRV/@i R R05RRm`ERRN1 _RR RR@i RRPy5`RRV[ d /C@$q(tp`&xp`&D%` +KPJ% 0,KK,! ,K`Km! -KpK|&` -KK& .KJ .KJ'` /KJ5G(/lc Z(%((W}T\`jr@i ** @ **05 *`*K> **21 *@*,|1 **,1 ` * *Py5 **@j d <?@!Pf`& P@?`3`ϖ2 @ʖС(tٗ `&~ҟҟl٘Әdy]9 d /d3@'S j×D%00=:t`(@= ;`4v?@>E,E\TXj\ d d45`1t ( $2N;H;2؎01; я0(  8@^P[eh Fy@XH@{ d r16k@I) –&&˜`&;;ϗ;Q;p4 `&(tl0$H2ҟ`V@xplC*8 d 4$`) 30}@@(@@ X0`Q0pRͦ0(\0R0J0ld0:60Qї d 9Z* @~(ഫ@–ഫ ഫ@Uഫ`ഫ`YഫzϘഫ`Qഫeഫ@ǖഫ ~ഫ@ഫ`ഫld  d 4+ @0'0w0 w '0*+0@0P@*`B 'x ĭ ')@t"/ @,ѿ>H<2, @dʘ0 @ ˙@0ey@0Pǖ '`Bϙ;p'ז;rޖ;tޖ;v;x;z`X` d 3e`- @0d};V;Fí;Ӭ;;x;`& `&(&00լ@LhЈ XHXJ d D3`@. d|.&ۆvh˖( (@m@H`3`))p)x0^)՘\;JҘ)xl² d |5! / `e@Zm%4'% ʭ@$8ߣ%Pݐ$h& |$@6Ǜ0w4篚&8, "X d 2˝!0 `e@ P@@ 3@(z@0y8ث@@`=H6Ǜ0Pw4P篚&hlg/0 .{Ԗ;Ȗ[y0~y@H– 'P  '` 'p '$ '*# '@ 'y#OP<yg d 0c` 1 7UBʖϪxhr '0dy@LPX@p;xח`&[&xΖ&&YӺ d x5LkB2 `7q ੡ @ |@8Fʙ@P\ʙ@h@@A@[@D@D@>Ø;$ 3XH& d X4hb3 0)y`& ߅0(x08:(HxX`hr(p$t@ptw;* $9 d /@Y(`4( ؙp`< % % P)P)ΰ*  )) HNPPv d T3(@ (@5 (Hږ0&}`~ ;0A '8–;H@PPؖ`?hH`?p؇;x T ;)|k . d 5|h` Ԗ 6 tιps`&p`f s e(s eXq@RV ;Z4ҟE`J< ^Om d /k07 $ 0 p`X^ʷ` t >``6 ~`@ @i `y G `\ I `H =A p 8w/?`7B@pCV#8 '`}. lUwUv plUPxU@ lUxU| @mU yU1 mUpyU.2 mUyU  @nU zU( Z,10G@(8(@W}pʖ--&H P*@3*05*3*K> 0* 4*21 *4*,|1 *4*,1 p*`5*Py5*5*BW6 d /&oa r@i ?F?Fs@i #F#FPy5>F>F  `%F`%F sOP5FP5FR  `0F`0FR*F*F@9F@9FR;F;F  )F)Fg@C_6 d /"-`٦a -d FFP/d FFd F Fd `F`FXd FFud F Fd `F`FAe F F]d FF!< FFd `F`F6 d /Vm٦a -d FFP/d FFd FFd FFXd FFud FFd PFPFHd FF]d PFPF!< FFd FFTH6 d /zq F& @D @D 05D D m`EE E ` PG PG i H H 8w M M N1 _J J 1 D D C@i H H C@i J J jt0L 0L d6 d /e`P r@i m"m"05`k"`k"8w t0"0"r ""p |"|" Є"Є" s"s"@i "" i"i"ږ@i n"n"E6 d /%$ @i pp@i FP P @i 00X@i ppK@i   M ppu 00D@i u e 5P6 d /`׵$ V/ (!(! (!(!@i ll@o@oyy mmb00N '\*6 d /]`$ Fe q q  @i v v @i s s @i h/  0 d d u Ў Ў u @i P P NP P 26 d /# S Cb b @Z @Z 1 g g O`y K K 2w 0N 0N 2 `T `T = j j h Pk Pk 7e e 7`U `U ̈́6 d /[ @S M3e }! ! }@ P" P" } " " ,69 : : q p p z   H@ P# P#  6 d /[@S M3@ }" " } " " } # # ,69 ; ; q  z@ @! @! H P+ P+ 6 d / 5 h uu;| ss ssy pspsP ss< PsPs ЫsЫs` 0s0s0+ ss}. ЬsЬs uuD6 d / 5 h PtPt; @Jt@Jt JtJt b Kt Kt} . pKtpKt. KtKt0 @Lt@LtJA LtLtK `Mt`Mth MtMt tt˄S16 d /]  1` LELE3 0ME0ME LELE]d MEME@ pREpRE$5PSEPSE `LE`LE8w KEKE1 WEWE LELE` u dEdEFP_6 d / `e 1` f f]@ ff@ PfPf f f8w 0 f0 f f f)E ffHD f f  p fp f. f fu p fp fC6 d /`e 1` @!f@!f]@ #f#f@ #f#f !f !f8w f f f f)E `#f`#fHD0"f0"f  "f"f. #f#fu !f!f<6 d /`e 1` ff `f`fA5D ff ff8w PfPf ff)E f fHDff  ff. ffu ff%˕6 d / `e 1` @]f@]f3e _f_f0w _f_f ]f ]f8w \f\f \f\f)E `_f`_fHD0^f0^f  ^f^f. _f_fu ]f]ftmM6 d /x`޵@/ e ::t ::Ow P:P:`v ::J4rP:P:W4  ::}. `:`:~' : :1 :: 0:0:~ ::6 d /` y ExxpxpxQ x x+Rxx`R x xz RxxR x x: WxxV0x0xRڂ6 d /@`7 r@i YY/@i YY YY05pYpYK> 0Y0Y|EYY21 `Y`Y,|1 гYгY,1 @Y@Y YYPy5YYWC>6 d /t `7 D%YYqf XX=:PYPYt`(YY@d XX@= Y Y;`4pYpYv?@YY.2 PXPXď 6XX4 XX4hj6 d /m`ܲ , O3 babae aaaaP@} aate _a _a| `a`a `a`a @a@ay[P_aP_aH lP aa!a  ʦ6 d / Y # 1` @f@f ff ff f f8w ff пfпf)E PfPfHD f f  ff. ffu ffǑ6 d /# 1` ffe ff@[ 0f0f ff8w f f pfpf)E ffHDff  PfPf. ffu PfPf)W.6 d / # 1` 0f0f[5 ff ff ff8w pfpf ff)E @f@fHDff  ff. ffu ff6 d /%N 1` pfpf'5d ff> ff PfPf8w ff ff)E ffHDPfPf  ff. 0f0fu ff,f6 d /| N 1` ffJ PfPfvw ff ff8w ff PfPf)E ffHDff  0f0f. ffu 0f0f%'6 d /jN 1` ff_4d 0f0fvw ff ff8w ff 0f0f)E ffHDff  ff. `f`fu ffe6 d / x 1` ggd ggt PgPg gg8w @g@g gg)E ggHDgg  pgpg. ggu pgpg'n6 d /Ix 1` @g@g gg\ gg g g8w gg ФgФg)E PgPgHD g g  gg. ggu gg6 d /P x 1` pqgpqg tgtg\ sgsg PqgPqg8w pgpg qgqg)E sgsgHDPrgPrg  rgrg. 0sg0sgu qgqgP6 d /} x 1` EgEg @Hg@Hgd GgGg EgEg8w DgDg 0Eg0Eg)E GgGgHDFgFg  GgGg. `Gg`Ggu FgFg? 6 d / x 1` >g>g @g@gd `@g`@g =g=g8w P=gP=g =g=g)E @g @gHD>g>g  ?g?g. ?g?gu >g>gy6 d /x 1` 6g6g 9g 9g] 8g8g `6g`6g8w 5g5g 6g6g)E 8g8gHD`7g`7g  7g7g. @8g@8gu 6g6g9 6 d / x 1` pxgpxg K {g{gt zgzg PxgPxg8w wgwg xgxg)E zgzgHDPygPyg  ygyg. 0zg0zgu xgxgh6 d /dx 1` +g+gw\ 0.g0.g< -g-g +g+g8w *g*g 0+g0+g)E -g-gHD,g,g  -g-g. `-g`-gu ,g,gA86 d /u' x 1` p_gp_g4v bgbgG( agag P_gP_g8w ^g^g _g_g)E agagHD``g``g  `g`g. @ag@agu _g_gD6 d /Ox 1` cg cgU pegpeg45@K egeg cgcg8w `bg`bg bgbg)E 0eg0egHDdgdg  dgdg. dgdgu cgcg6 d /rJx 1` `g`gwL ggM gg @g@g8w gg gg)E pgpgHD@g@g  ЗgЗg. g gu ЖgЖgu6 d / x 1` jgjgt@L PlgPlgM lglg igig8w @ig@ig igig)E lglgHDjgjg  pkgpkg. kgkgu pjgpjg*6 d /Jx 1` (g(g<L `*g`*gM *g*g 'g'g8w P'gP'g 'g'g)E *g *gHD(g(g  )g)g. )g)gu (g(gNV6 d /y Y 1` VdVdd PYdPYd, YdYd VdVd8w VdVd PVdPVd)E XdXdHDWdWd  0Xd0Xd. XdXdu 0Wd0WdrUU6 d /jY 1` ]d]dx `d`d]d P`dP`d ]d]d8w ]d]d P]dP]d)E _d_dHD^d^d  0_d0_d. _d_du 0^d0^d>6 d /_J  Ä@ 88qT 88s P8P8P M9M9k` 881 p8p8w @8@8Py588 0808te 88?H 88ߵ@6 d /e  ]6 D%`aQQJ%@c QQu QQ pQpQ% 0Q0Q2e QQ~'`aQQ QQ4 QQ@Q@Q~r QQ=Ү?6 d /v ` [[}.d 0[0[ue [[/ p[p[| [[ [[@i [[`p[p[i@[@[P[P[@[@[Pxf6 d /'  z ## | ##6"" e $$` %%` P%P%;%%1 ` &&@#` 0'0'IS6 d /,% i`  @@, ppr@i - PP21 b` B   z@i  4  #e {6 d /m( !) r$ r$%`n$n$.`$$u0@M$$V r$$*o$o$ a$a$:")pr$pr$< $$9@`$@`$"jX56 d /`?( D% ( 0*0*% **% ! **~' ( p*p*Py` **`wP*P*z ) ! Ѓ:F6 d /v( 05'' ' 'A ''< P'P'2 ''le 6 ' ' S  '' ''?A6 d /K{`( O3 E%E%e D% D%P ))te 0B%0B%| C%C% C% C% ))y`x`B%`B%H lP ))!a Y76 d /`G( i` ** P*P*, **r@i Ї*Ї*- **21 P*P*b` **DS @i L ȗe 006 d /mt /@i ~~j@i @~@~ 2 ~~E B4e P}P}6@i @@@i  }} ; }(A6 d /k/ F& 05 m`E0 0 ` i   8w Ў Ў N1 _ 1 C@i P P C@i ` ` jt F#7/t@4*`ì`&m0I- jjps `jj jjv@i jpj^ jjh jj'B Pjj j@jPHOdf d L4Sp` u 5bә0 Je Ԇ80HP @X@ǘU`Q x @|ʘUh @t s tr((#x2>` v 5bә0@c 1 @z Y@(@0@8|@@ @Hh t s 0tsPH=,N d P4!w 5bә0{8@9@ I@8PLhB pvxJm@U@h u Qs uPs(({ d 2!x 5bә0@K@ W`xt y( @0@A@85J@@Jm@Hh uks uks((uqv d 2!y 5bә0@K@ W`xt !( @0@A@85J@@Jm@Hh Gu@s Gus0 ꣷ d C0W Pzz@$p|@֞p 4p@^J@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 F=g d C0NjP{z$p|@֞p 4p^J T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 A3g d C0P|z(p|p 4p^J T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 +f d C0 P}z@-p|@֞p 4p_J@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 6d d C0 P~z-p|@֞p 4p@_J T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0Pz8p|@֞p 4p_J  T (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 j d C0mPz@:p|@֞p 4p_J  T (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 V7i d C0' Pz;p|@֞p 4p`J@  T@ (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 R d C0 PzDp|p 4p@`J@  T@ (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 fo d C0 PzDp|@p 4p`J  T (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Yv d C08PzEp|p 4p`J  T (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 %pG d C0> Pzp|<p 4paJ  T (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 - d C0R Pzp|@֞p 4p@aJ  T (Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 V U d C0Pz`ڭp|@p 4paJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 .Gv d C0k Pzp|p 4paJ@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 B^L d C0 Pz@p|p 4pbJ@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Q d C0  Pz=p|p 4p@bJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Q d C0ť PzJp|@p 4pbJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 @  d C0+ Pzħp|@p 4pbJ@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 m;M d C0 Pz`%p|"p 4pcJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0zPz@rp|@lp 4p@cJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 d d C0& Pzxp|@֞p 4pcJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 @A\ d C04Pzzp|@֞p 4pcJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ' d C0Pzާp||p 4pdJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0 Pz}p|@֞p 4p@dJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ̩ d C0T Pzŝp|p 4pdJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 |P d C0"Pz`p|p 4pdJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ،" d C0( Pz`p|@p 4peJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 f0 d C0\Pz`p|@֞p 4p@eJ@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ? d C0Pz@qp|1p 4peJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 <  d C0 Pz@qp|œp 4peJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0 Pz@p|`p 4pfJ@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 - d C0rEPzp|%p 4p@fJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 , к d C0Pzp|p 4pfJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 , к d C0Pzp|)p 4pfJ T(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Pe d C0Pzp|.p 4pgJ! T!(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 e6 d C0~"Pzp|@p 4p@gJ" T"(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 RC d C0Pzp|@p 4pgJ# T#(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 S d C0aPzp|@֞p 4pgJ@# T@#(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0Pzp|p 4phJ$ T$(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ,uS d C0y Pz@p|@ p 4p@hJ$ T$(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 K72 d C0 Pz@p|@Cp 4phJ$ T$(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 }+ d C0 Pz@p|p 4phJ% T%(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 u! d C0 Pz@p|p 4piJ% T%(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 cM d C0 Pz@p|@Νp 4p@iJ% T%(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 e@ d C0 Pz@p|@p 4piJ& T&(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 k d C0EPz@p|@p 4piJ@& T@&(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 [f d C0Pz@p|@֞p 4pjJ& T&(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 z% d C0PPz@.p|p 4p@jJ@' T@'(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0 PzDp|Xp 4pjJ* T*(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Α d C0 PzDp|@Xp 4pjJ+ T+(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 yTI d C0 Pz@p|@p 4pkJ+ T+(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ) d C0 Pz@p|Xp 4p@kJ1 T1(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 9T d C0 Pz@p|@Xp 4pkJ2 T2(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 4b2 d C0 Pz@p|`4p 4pkJ@3 T@3(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 "+ d C0Pz`4p|@֞p 4plJ4 T4(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Ӥ d C0Pz@p|p 4p@lJ@5 T@5(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0 Pz@p|p 4plJ@6 T@6(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Ğv d C0l Pz@p|@p 4plJ6 T6(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 U[ d C0 Pz@p|p 4pmJ7 T7(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 4 d C0t Pz@p|@$p 4p@mJ9 T9(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 [BI d C0Pz@p|@%p 4pmJ: T:(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 λ% d C0R Pz@p|%p 4pmJ@: T@:(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Y d C0N Pz@p|(p 4pnJ@; T@;(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  aw d C0(mPz@p|(p 4p@nJ; T;(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ƎO d C0(Pz@p|)p 4pnJ; T;(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 & d C0Pz@p|0p 4pnJ< T<(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 tB d C0-Pz@p|1p 4poJ@= T@=(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 B\ d C0P Pz@p|@1p 4p@oJ= T=(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 +4 d C0- Pz@p|1p 4poJ= T=(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 | d C0( Pz@p|@7p 4poJ@? T@?(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0~Pz@p|@Bp 4ppJ@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 | d C0( P¶z@p|Cp 4p@pJ@ T@(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 sFn d C0"Pöz@p|@Ep 4ppJA TA(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Zt d C0 PĶz@p|@p 4ppJA TA(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0ȯPŶz@p|p 4pqJB TB(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 3Xv d C0b Pƶz@p|p 4p@qJB TB(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0OPǶz@p|p 4pqJC TC(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 КY d C07 Pȶz@p|p 4pqJ@C T@C(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 7e" d C0Pɶz@p|@p 4prJC TC(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 a d C0qPʶz@p|p 4p@rJD TD(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 E, d C0}P˶z@p|p 4prJD TD(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 Q d C0@P̶z@p|p 4prJ@E T@E(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ar0 d C0 PͶz@p|p 4psJE TE(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 R#" d C0< Pζz@p|p 4p@sJE TE(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ֋ d C0P϶z@p|@p 4psJG TG(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 \ d C0KPжz@p|¸p 4psJ@G T@G(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ‰ d C0 PѶz@p|p 4ptJH TH(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 k~ d C0PҶz@p|ٜp 4p@tJI TI(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 [ d C0w PӶz@p|p 4ptJ@I T@I(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 @5 d C0x PԶz@p|@1p 4ptJK TK(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 d#, d C0nPնz@p|@Lp 4puJL TL(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 iJ d C06Pֶz@p|`'p 4p@uJM TM(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 , d C0 P׶z@p|zp 4puJM TM(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 3Sw d C0c Pضz@p|p 4puJ@N T@N(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ` d C0Pٶz@p|ӝp 4pvJ@P T@P(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 + d C0jmPڶz@p|`p 4p@vJP TP(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 B d C0P۶z@p|`Sp 4pvJQ TQ(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 >k d C0PPܶz@p|p 4pvJ@R T@R(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 m8 d C0EPݶz@p|@p 4pwJ@S T@S(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 uAL4 d C0 P޶z@p|}p 4p@wJT TT(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0 P߶z@p|p 4pwJU TU(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 ?L d C0ImPz@p|p 4pwJ@U T@U(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 }p d C0mPz@p|`4p 4pxJU TU(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 \ d C0JPz@p|@p 4p@xJ@V T@V(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 NR d C0SPz@p| p 4pxJ@W T@W(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0mPzp|@ p 4pxJW TW(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 !j d C00 Pz@p|.p 4pyJ@X T@X(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 gel d C0 Pz@p|/p 4p@yJX TX(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 %G_ d C0 Pz@p|:p 4pyJX TX(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0 Pz@p|@;p 4pyJ@Y T@Y(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 v d C0 Pz@p|;p 4pzJY TY(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0@ Pzp|#p 4p@zJ@Z T@Z(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0XPzp|p 4pzJZ TZ(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 }P d C0 Pzp|p 4pzJZ TZ(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0 N d C0 Pzp|@p 4p{J[ T[(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X0  d C0Pzp|@p 4p@{J\ T\(Q7 40 483@3H;J(p3Lp3Nk3Pؗ3X<Pp/w!&>+&-&ݗ&& &(o&0&8&@y&HX&P:&X &`&hU&pllMC d 5]`t$pٗӭ0͖`׭Җ; ;"'%;$n;&&`ح(A0ҘeKd`*w d 4w`t$D{ 2 n8ؗ2PdX3T ;V@X ;pmexl;ۙz; 0TTO02\@`&U`&U`& '9 '(`&8r0@0PD`&`2`&h`&p@`&x:ҫdPHF d 3B/!d| ))()0))8o)@.&H;P;RرY.y1;`[;JҘ)lXS蚖/A~.RsvT;Җy@ʖ '( '8 BHňBXЖBhBx 'іyіy 'Җy0${, d 42Ccŗ;B;;; D;Θ0P; fҗ(v;0c ;2;4c@)8`|@ wHph d $5ŚNL)—0X03(#3*A000@0PxP0`|Xp.0ߖ0–0&}lh  d <5N—0X0L) 3(#3*A000@0PxP0`|Xp.0ߖ0–0m0HH\ d 477` ൭e9Ԙ&x@k@ B@(yc0З8d'@ԙ`3Hۙ;Xv`vpb;d 404P d 21z[XP`1Ȃ& Q&(\Hҟ00Hc0Xx40}@m}py } r}F& @}q}> } k} }p} @i }k}PP# d 2o["{ +ҪRsvh\@Xחߧ` ]ߧhΖߧpp`)y2 wU~,(iY` Yb d (8! w 'Ҍ`U(R'0ŗ̡@`Ŗ`3h;xp@ p@ p@ p@ p@ p@  Ir@@l.Hdd d 4Ͱm=Y0֖ࢥw; Q r8@× HŘ Xw,O&C&И`&≘`& 'O@LLճ d 4p#(wޖ0'`&Ɩ0`&(Ō`&0Pؖ`?8&}g@A 'P@`–;x;zH`? w`T@J d 1*U((L \`{0 ]>`0B8p`oHb4Pi@XI0`C@ p,Rsvd;4/ī@Q੡2 _2$_ 3(t 30 38 3@~ 3H-2Pۗ2T2Xۗ2\2`r2d(kȜ7@/ILP`1Ȃ& 0(&8t '@x4 }@\}py }a}г 0}f}F& }a}> }Z} p}@`} @i }Z}dDFJ(,3a q}~0(,H8o`u 3Ė 35w 3u 3 3Ȗ` ;|ɗ; II)59 d /` ߖ@ ?$ ?$ p?$p?$s@i ?$?$2s@$@$8w @$@$1 @$@$Py5 A$ A$8 6 A$A$t jA$A$PB$PB$ie d /` y Exwpx`wQ xw+Rxw`R xwz Rx0wR xw: WxwV0xwRwpw-< d /` n@E vu [- : ` E B@ `    E E  ʅ@i ؅@i P @i  E`  d@u@@i @<9k r0 5@ @P!`ZvZ tŖ;Uٖ;P;N;Ė ' jߖ`30lB@:`<P 0pK 0/D.2 /DM,6 d /'(   r@i ii@:;`i`i$s`Q@i@i` @i@iD` ii iiXii iix @i@i? ii PiPi PiPi6 d /sO` r@i hhn0@M phph$s@1`h`ht`Ihh<-0h0h) J h h8`Jphph\@/hh΀ hh~B hh C hh2hhAI56 d /l  r@i N Nr@i 0h0h hhH`pGpG2 UU- SS5:EEٌ VVw VV PTPT 0M0MPy5PgPge6 d /9 -% ii` jj @@` jj|~ v ?` w`v o o8 p pwv oo8 PqPq ЋЋ @j@jR6 d /Sp`u5 h @t@t\1s pspsz ssw`m s sc1[ pspsj1 ssq1 ssw`i ssz ssx1 @s@sw`i ss tt[R6 d />`v5 h tt` `s`s. ss]. ssp` s s@ s sT{` !s!s` !s!s.` "s"sJA` "s"sK` #s#s 0t0ti6 d /  hp qc^c^- pp^p^ pPr^Pr^ ` x^x^V/ ^ ^& ql^l^! qpg^pg^ 0 qm^m^: w^w^: qg^g^{` x^x^ P^P^e06 d /r  1` @JE@JEve KEKE JEJE@V @KE@KE JEJE@ PNEPNE$50OE0OE JE JE8w IEIE1 VEVE IEIE` u 0YE0YE6 d /Ԗ IJ`e 1` ff]@ f fA5A f f@ p fp f ff8w PfPf ff)E 0 f0 fHD f f  f f. f fu ff&G6 d / IJ`e 1` $f$f 0'f0'fh@ 'f'fA5A 'f'f $f$f8w $f $f p$fp$f)E &f&fHD%f%f  P&fP&f. &f&fu P%fP%fP} 6 d / Ų`e 1` (f(f\Y `+f`+f +f+fA5D +f+f (f(f8w (f(f P(fP(f)E *f*fHD)f)f  0*f0*f. *f*fu 0)f0)fUx6 d / 1` `(?`(?5 *?*?]d +? +? @(?@(?8w '?'? '?'?)E *?*?HDp)?p)?  *?*?. P*?P*?u )?)?8 (?(?b޽6 d /"  6 1` -?-?@ @0?@0?5 0?0? `-?`-?8w ,?,? -?-?)E /?/?HD.?.?  /? /?. p/?p/?u .? .?8 -?-? 6 d /A 1` 2?2?@ P5?P5?5 5?5? p2?p2?8w 1?1? 2? 2?)E 4?4?HD3?3?  04?04?. 4?4?u 03?03?8 3?3?w/6 d /*`: D%q`g`g @g@g%n`g`gt gg /c pgpgF& gg60nggv g g `g`gƽ gg@ g g ggL|6 d /' DzB v` 1212@2@2C2C2=2=2bT5252@72@72oT3232TP?2P?2P;2P;2V E2E2f9s E2E2 9C6 d / /  75 75U a5a5ƔH5H5UPD5PD5 ;5 ;5E]5]5  R5R5U8585N8W5555+ 6565[?26 d /e_  H 99/ p9p9- CC2v9EE/ @9@9~H PJPJ&:H JJO?`Pp=p=̻@:@@@@@y@8JJ)I JJ99;@6 d /rj`:/ d4||^-@y | |hs || Z ||Y ||Ը`0||0||J{ ||F `|`| ||@u {{6 @|@|6 d /c17 (r@I r 00%@i Y! PP/ iI ЃЃI  @@J e `  @@ @@6 d /77`e F uu@x@x6#*6 d /ষ qe r@i p=p=e Y! @>@>y=0,0,A$$p <<A(A8P\=6 d /i`7 r@i pWYpWY}D^Y^Y| RYRY2@i @PY@PYF ;PVYPVY u ]Y]YTJu ZYZY6 WYWY^S0W0W@i XYXY,_Y_YP` RYRY7U[6 d / N 1` pfpf@~ ffP PfPf> ff PfPf8w ff ff)E ffHDPfPf  ff. 0f0fu ff6 d /@lN 1` ffBv[ ffƤd `f`f5@ ff `f`f8w ff ff)E ffHD`f`f  ff. @f@fu ffwq6 d /I`x 1` gg `g`g ДgДgt gg `g`g8w gg gg)E ggHD`g`g  gg. @g@gu gg^(6 d /'x 1` `g`g>w@ gg 0g0g5 gg @g@g8w gg gg)E pgpgHD@g@g  ТgТg. g gu СgСgm6 d /px 1` mgmg>w@ pg pg `pg`pg5 ogog pmgpmg8w lglg mg mg)E ogogHDpngpng  ogog. PogPogu ngng76 d /t@x 1` AgAg>w@ PDgPDg DgDg< DgDg AgAg8w AgAg PAgPAg)E CgCgHDBgBg  0Cg0Cg. CgCgu 0Bg0BgzK6 d /! x 1` 0:g0:g>w@ w@ 05g05g p5gp5g5 4g4g 2g2g8w 1g1g 02g02g)E 4g4gHD3g3g  4g4g. `4g`4gu 3g3g6 d / x 1` g g@ ggd ggt pgpg gg8w `g`g gg)E 0g0gHDgg  gg. ggu ggb6 d /px 1` |g|g4@ ~g~gʻe ~g~gt P~gP~g {g{g8w @{g@{g {g{g)E ~g~gHD|g|g  p}gp}g. }g}gu p|gp|g!}6 d / x 1` pgpg gg}XK @g@g gg PgPg8w gg gg)E ggHDPgPg  gg. 0g0gu gg^z6 d /#, 1` L?L?@ 0O?0O?4Z O?O?45 pO?pO? L?L?8w L? L? pL?pL?)E N?N?HDM?M?  PN?PN?. N?N?u PM?PM? Ԛ6 d /\ Y 1` `ad`ad4 cdcd @dd@ddp cdcd @ad@ad8w `d`d `d`d)E pcdpcdHD@bd@bd  bdbd. cd cdu adad}\6 d /$c1 O ``  P`P` Щ`Щ`@ e Ь`Ь`KGe ``T  P`P`P ``6 ``qN а`а`_ ``8  `` P`P`e6 d /1 O ``  `` p`p`@ e 0`0`KGe 0`0`T  ``P @`@`6 ``qN 0`0`_ ``8  p`p` в`в`E6 d / @ DODO` u =O=O~@i :O:O 0NO0NO  EOEO FOFOI GOGOx  LOLO@i PCOPCO >O>O@i @O@OG@i @O@O ] 6 d / / 0S0S @S@S}. @S@S(e SSe SS@ иSиSK SS`J 0S0Sځ@ @S@S1 0S0S.2 SS e SS\=(6 d /4µ v SS(SS)0S0S@i S S6@i SS` 0S0S 4 SSb>SS6/XSS S SP@i pSpS`PSPSP6 d /M ?|S|SqDG`^PSPS`^0S0S SS" S S ?ЁSЁSҍSS9SSA S S"SS&;SS:Y36 d / k,% i` EE- CC, I Ir@i GG- KK21 PIPI@ P]P]b` 0C0CB [[z@i `\`\4 \\#e  <6 d /-  Tu tt te P  vn0 PPv@ pp> P  vvhu  rrq6 d /|h5 ,(++y `+`+zP+P+6 ++~++ 8JIJ^++9p+p+2++PW6 d /׷ ?3 :FD ` 4  7 e e 7N `HO(/ d B0@0f50q 38m* 3@m* 3Ho;P\`&X^y;`p աhth* 3`&<3`&@ؗ22|t` d 5,H6 Б@ @@0 @H#@`P@xP@00(Ɩp`p VQ@g PW`IFFZ d 7RJ|7`@Ę0OH`XPx>P G/ 8NPhdM d 5%8@9J00B0 u 0dL08^`&H|}PL hlM;p`&x/`&QX@Ԝ 0xl d 4q{)"9`e@@N|@ҟ(;$ҟ@FT@$X:%p''%`@8!"@6Ǜ0w4篚&jwJ5 d /rj` 00 q / d4`{`{^-@y P~{P~{hs {{ Z {{Y Ѐ{Ѐ{Ը`0p{p{0{{J{ {{F P{P{ {{6 {{``; d l3BC!൭;exk@Ԙ&B@ u+@(Nw0qH@ XS;h;ypvd'ԙ`3ۙ;@  d /H!< , 4זY; ,xe a0aP@} aa2}d aa۷e a`aȂe aa aaH lP a`a!a  K+ d (:k`l!|=,֖0xȖ0Ȗ RsرHxg`&9@<;|y`3`3&4`ݗ`LLf?  d (< #@!|>,x`r˖) ւ@] `rӳRsv*Sɖ@ŸPҖEhH`&p$@x 'p[By5 d /` 0@d ( D% ( C'C'% D'D'% ! D'D'~' ( 0D'0D'Py` E'E'`wM'M'z E'E') ! J'J'ЃpE'pE'N'N'j d /`$!(@( 4[ז@Y; ,xe )`F*P @)F*2}d )0G*۷e )G*Ȃe 0)G* `)0H*H lP )H*!a 0 ě`JȰC0)VAz 4Ӗ 4ppôJ 4 T`h(Q7083@3H;J(p3Lp3Nk3Pؗ3Xٿ d /` nB` a= ~   Ǽ` 9  ּ =`  ` : =@i =@i H@i 0  = = 0 @@i 1@i .2@w Tf d /aCW (Pɖ `& Z `O TP%@i 0 и5@>6((c֪6 d 1."DXĖ Wr`d΄@ pi0`@38 `H]@=T@Tr` =T@AT£ 0>TATr >T BT _?TBTl?TCT3^@@TCT00yU d 2`b!E 5bә0|z@K@ W` xt(y0 @8@A@@5J@HJm@PS@Xh kut lut<\ d /;-h!3) @ I14q I(Y! I(P @J`+t{ J@*d @K, K=2r L1' pL`>y L/ޯ@r @MAr MPAJ9 d /`! G( ~ӗ`li` T(T( **, P*P*r@i **- **21 P *P *b` * *QS @i W їe d9hL/d2HS @j×r ۦr ۦHp ۦD%@`=:t`(`@= ;`40Pv?@>E,EqS d <pI@0>@0(Xw08wHϬ0pt'ٯ00ڇ@Ȓ0{ 'sO 'M@n0 Z/џ !~J. @vܖ`xΖ 'ʖ;(- 6@6^!`Z66u`]P66L} 6p6wt 66 6@60 ˝ 0R . plΓ d T5rK=K.0p n_#0 0宗;8y@S0PΖ`phr0;v0y/*fT,uL,% @W}̖ ; B;"r@i ps P 05@K> 21 ,|1 `,1 йPy5p@@@ d 29M(vΗ + <`(08 x@—HUPo ܢXs`ehRИpt@x@@+ d 2 NvΗ + <`(08 x@—HUPo ܢXs`ehRИpt@xH~ /lO Ȗ}0Ȗ}6ږ& XŖ&(Ė&0@Ŗ&8lږ&@ږ&HXƖ&P&X&`ږ&hږ&p""&xpƖ&ږ&S,6 d /Dw  <ЦiЦi/1 Q0i0i ii<ii&> 0i0iY! `i`i`Aдiдi; ?`i`i? Cii 0i0i`NiiiiPiPi!}6 d / `   =ii pipi< i i&> iiY! ii\>ii1 ii @i@i iiN0i0i iiii06 d /!- Lp" {{r e p}p}he ||)e }}  0~0~.{ || ~~: {{ } }k@i ~~x ? ``vz6 d /`w5 h uuw] [ \s\s;` \s\s`^ p]sp]s`` ]s]sGb ^s^s}`- `^s`^sh0 ^s^sH,1 _s_sK` P_sP_s^e _s_s uu~@i pQspQs..6 d /`x5 h uug+` msms+` 0ns0nsx` nsnsS  osos/ PosPos osos9` ososv` ppsppsb|` pspsK` pqspqs uu~@i 0ls0ls`6 d /`y5 h GuGug+` ss+` ssx ssS  PsPs/ ssܬ ss9` @s@sv` ssb|` @s@sK` ss GuGu~@i ssq6 d / `e 1` ff|@` ff`(Z f f pfpf8w ff f f)E ffHDff  @f@f. ffu @f@fI @f@f ff.6 d / @`e 1` `lf`lfk@ `of`of]@ ofof c nfnf0 ofof @lf@lf8w kfkf kfkf)E nfnfHDPmfPmf  mfmf. 0nf0nfu lflf.6 d /n `e 1` pDfpDf|@` DfDf`(Z GfGf PDfPDf8w CfCf DfDf)E FfFfHDEfEf  Ff Ff. pFfpFfu Ef EfI ff АfАfL|6 d /'  . v` 11PC 1 1`1`1111111bTP1P10101oT11T 1 1V @2@2f9@s 22 [B6 d /hd ` 3 0@o@oaCoooo`popo`ooM0o0o0o0o&oo7@ popoN8@ oo@o@o^U6 d /d  N i`# ``s`# ps`# РРs`# .`# &W `# v`#  @ 7@ pp`# @@6*ɫx6 d /џ`J. r@i 66- 66^!`Z66u`]P6P60566ހ 66B 66L} 66wt 66 660 ˝ 0R . Ó 6 d / ,q ! mmdu 0n0n nn8@ nnL& @o@o oo~`' pp ppppu pp;0q0q[` qq r r4u rr^6 d /i) r--ءyP-P-څ--hvdP-P-v--\P-P-/ --0 - -G-- 0 -0 -8 - -nj`!-!-1 !-!-6 d /P\ ! ` V/ wG ބބw z  00 `` ݄݄D PބPބfF߄߄GV6 d /   F @@`2 h9:R0?``J. }DA`H00@y@8 Z 6x6 d /ȷ  V ЉЉ9 щ щ]8 щщ(rv щщ P҉P҉ ҉҉-U `Ӊ`Ӊ2 ӉӉ%@i ԉԉG pԉpԉ6`U ԉԉy 0Չ0Չn ՉՉaߓ6 d /38O e 0}0}x4}}c0 } }p` }}г }}e `}`}F& }}> } } }}Bu Ж}Ж} @i }}` 6 d /n ' ` 9L9Le 2L2Lu @9L@9LNz 8L8L@` `0L`0L /L/L`!`6L`6L4`b 3L 3L_e5L5L@ p)Lp)L P-LP-L c` 01L01L/ +L+L6 d /H`< , ,xe aaP@} aa2}d aa۷e aab aa>~ ! aab a aȂe aa a a6@i aaH lP aa!a \"h6 d /n, t ccs`# ccb cc cc`# c cx cc2 @c@cX{0c0cH@c@cccP+ cc0 X ccz$6 d /ళx 1` ggE МgМg gg @g@g< gg ЙgЙg8w 0g0g gg)E ggHDКgКg  `g`g. ggu `g`g6 d /e Y 1` KdKdF MdMd"wN `Md`Md MdMd5@E @Nd@Nd JdJd8w PJdPJd JdJd)E Md MdHDKdKd  LdLd. LdLdu KdKd4E6 d /Y 1` RdRd"wN TdTdP Ud Udd UdUd `Ud`Ud pRdpRd8w QdQd Rd Rd)E TdTdHDpSdpSd  TdTd. PTdPTdu SdSdZ6 d /! ps @D`@D`s`# E`E` D`D`s pE`pE`͆`# 0F`0F`0 E`E`. A`A`t`# B`B` @B`@B`p F`F` C`C``# C`C`  pC`pC`N76 d /  9 v 0m[0m[QBp[p[Pv[Pv[U0~[0~[[[U`[`[,[[J0[0[[[V0}[0}[f9pl[pl[ o[o[> Y6 d /0o ñ@ L pSRpSRJp[Rp[RcRcRfRfRjRjRhRhRWRWRkRkR\R\R`R`R|`# TRTRe URUR`YR`YR@ 6 d / ı y..n..@.@.8.... //~// . ...f..ܙ..Ϝ.."P.P.^T6 d /. e y.. ..P.P.@.@.4 `.`.6 P.P.8..7@..N8..`.`.f . .u6 d /T,% r@i -  PP05K> 21 P  ,|1 = ЏЏ,1 ppPy5#e |y06 d /\&,% -`tXt<00$K1K``Դ / /"ZZ@ ^V6 d /`@( ,xe ))P @)@)2}d ))۷e ))e v% v%>~ ! s%s%e 0u%0u%Ȃe 0)0) `)`)6@i v%v%H lP ))!a TZԫ6 d /g  >(**((@*@*`*`*{46 %6*j80*0*P*P*59**9***struct { F uintptr; currentChain []*x509.Certificate; sigChecks **int; err *error; c *x509.Certificate; hintErr *error; hintCert **x509.Certificate; opts *x509.VerifyOptions; chains *[][]*x509.Certificate; cache *map[*x509.Certificate][][]*x509.Certificate }ţ d / "w (:`gr@i p r@i 0 H`@ 2 `- 5: ٌ ` P  Py5 pphҝ d 5Bvy&`Ȗ@Ö@~@@HÖ@ K@(Ö@0@v@87@@ 'HLg@j@L/ߘ/0̖`&=@U>H75Z@k z1U 'I 'P '   '0l  '@Æ 'P`Dۚ}(y 's 'O`j K`j0X0@O@P|%ڨXLL / d 4i`(@{(ZX\{ F ҃q@ @[`?(櫗`?0>@8-`&Pp;X⪗;Zߗ;\˖;^V '` 'pjӘvXӘTL d 3}`| nՖ0מܖ;ޖ;;;ۖ; }`&(0;0D`&8(Rq@3H*3P&ԗXǗp/;@Ήf/!} @:`^#00 r@i 0' @ 'H` '2 `(- (5:0 )ٌ p `) ) *Py5p*,, d 2]"~Np OƖvB1 ޥ8Nr` @;H*;J P Pr` ^ ^% ^^ np^^j& ^^uq^^~' {^p^@ ^^Bశ d /! ,q ! m^du 0n ^ n _8@ n@_L& @o` o_~`' p_ pp^u p_;0qP^[` q`_ r^4u r_pN d /i !) r--ءyP- -څ-@-hvdP--v--\P--/ --0 -`-G-- 0 -p-8 --nj`!--1 !-p-vwy6 d /lo@$% bbr= pVpV p]p]T__%F __gR R ` 8 [ZZ^\\p: _ _Ȟdd5~ 6 d /  ` pp @@/e  x PP   N8` pp @i _@@@i 4e  ߝ6 d /OϷ V@ ~i ~i' fifiB4gigi4 hihi| xixijV 0}i0}iGniniPiiPii7pqipqi<PziPziP{iP{iZzizi riri: fifi`6 d /@`- xs MM? ll@i PFPFxz FFR` PNPN0 NNx{@ kk B plpl 0l0lHe F0X0X]gg!` TT \\3{gF6 d /βഫ@ r ppF& @p@p@ pppp pp @ pp9 pp pp ppZ' p p pp pp1 pp(` pp3W.i6 d /-{U`e1` ff ffA5@A fftd 0 f0 fEW ff]X PfPf ff8w ff @f@f)E ffHDff  f f. pfpfu f f2hG]6 d /@Ų`e 1` 0Lf0Lf|@` LfLfe NfNf`(Z OfOf LfLf8w pKfpKf KfKf)E NfNfHDPMfPMf  MfMf. 0Nf0Nfu LfLfI ffl ffo~6 d /rƲ`e 1` PfPf|@` PfPfe RfRf`(Z RfRf OfOf8w POfPOf OfOf)E `Rf`RfHD0Qf0Qf  QfQf. RfRfu PfPfXI 0f0f@ ff䜢96 d / @V`e1` PdfPdf< PgfPgfd gfgf c ffffRc gfgf} gfgf 0df0df8w cfcf cfcf)E pffpffHD@ef@ef  efef. ff ffu dfdf*“6 d /dгB22 22 t 22t 22sK62222bT22T22 2 2V 333O22Zt 2 26 d /S`91s P2P2d) %2%27@ 22N8@ 225M`ZP"2P"2mZ@ 2 2T` 0202c` 224N #2#2r` 22zZp2p2Z 22 E6 d /b  N i`# s`# ps`# s`# .`# &W `# @@v`# @@ ``@ 7@ `# 6*f 6 d /0@ʲ/;` 44O` 44v 44|` 44  44}  44(}  4 4dA  0404B`np4p4(0404@4@4 44@4@4u6 d /zoʲ   LLZp j@L@L- LLA/` L Lp 0L0L/ LL_` LL&` `L`LK LLM`p `L`LA LL1 LL6LL pLpL m6 d /0 V/@i e 00/0 w@i pe 00R !?S`` S@i pp600@i X,rB?6 d /؇ʷe F օօn0=օօ6 d /A`m@PB` PvPv  vvF` ||Ue   { 0x0xz4ttcwwd uu7@ ssN8@ t t+ @z@zzZe 00<<2 d 1(k ="` `7 4rd z`q}DPY`Z| YZ2@i 0YZF ; u TJu 6 ^S@i ,P` *struct { Families []string; ActiveTraceCount map[string]int; CompletedTraces map[string]*trace.family; Traces trace.traceList; Family string; Bucket int; Expanded bool; Traced bool; Active bool; ShowSensitive bool; Histogram template.HTML; HistogramWindow string; Total int }O d 6Dwt`$D{ 2 n8T@Pyh ;0 ;m;ߘ@n(ߘl; bׂnۙz; S@(x d 05= S@֚Ѭ0yI`&r0 y000@KP@*ۥXPӬ0`ļ0pí00`&I0N0A`&@xB@@ ' d 6@NPT2\T00B0(—08X0HL)X3`#3bA0h0x0xP0|X.0ߖ0–0&}!0 d H6bm@ ; Ix7@0| @bH ٸP+r`Xps`L0n(ޗdy `bϲa9`!ͧ9\\y 3L`!ष;əEGʧ@ d ~'(pv'8 ɴHrɴPvv'XȘh&͗p'xT&'TT:gg04!;~{@AޖP' |ߖ08@@@HӗPB'XPh}ppvĜxvvĜ'GʧX5 d 8` ڬ 䂖@r0҃ ٗ0HU`XP `;hߗypC@`yd*y4@(c@xx`M d h5H@فy `&0ʙ`&n`& I`&(`&0@80\ 9@SXRsv`{5p( wxd^@ӣ`3zvă`oZ`3T`'/"*`p O;D;;;ז;Ę;ؖ;ז;L;L;L;;;L;M;@Ė;p a!%/F@p ז;ז;ז;;;;;ؖ;Ԇ;;L;$;.;9;#;.;p `_%貖/l@ u`3~2QZ 3 3 0Ɩ 3(w 30u 38ɀ`3@2PQT 'X`&hԖ 'p|}}z}}v`3B0 d 6o Ka(30j 0 '( '8w`&Hu`&PȖ0X Ė0hx}P ' ' "ۋ"9ז@B 0AEg:< d 6n୷+җ} Ω@&`&P0XWhf~Hwޖ ŖĘ;  B`&(w`&0ښ`&8`&@A`&He (h0)h44e ҹ d 1nQ"``7 LW}2? w/(RsvPҘ``0d `ZZr@i Z Z ZZ}DZZK> ZZ| ZZd @ZZd Z Zm2 Z Z2@i `Z Z6 d /L@`FbT  00S009 LLhs ď`CPP? ``$(ppe PP6d  Je Ve ``4PP46 d / z"`x r FPP` }}ue xx7e @y@y6e xxe 0x0xe ww  0z0z yyZ zz<{ zz9 yy'`x2 ~~V6 d /`E5h kuku`` ttg+ tt+ ttx ttS  PtPt/ tt tt9 @t@tv ttb| @t@tK tt @t@t lulu~@i @t@tp6 d /A 5 r OOXse 0O0O)u OOo O O60  ЕOЕO&  OO0 pOpO1 `O`O OO OOc OOG OO 0O0O @O@O 56 d /=`e 1` HfHf|@` HfHf@e JfJfe JfJf`(Z Kf Kf GfGf8w PGfPGf GfGf)E `Jf`JfHD0If0If  IfIf. JfJfu HfHfI ff `f`fuB6 d /8``e1` ,f,f#<e 00f00f P/fP/f /f/fA5D /f/f /f/f<e p0fp0f ,f,f8w +f+f @,f@,f)E .f.fHD-f-f  .f .f. p.fp.fu -f -fh6 d /!`e 1` SfSf|@` `Tf`Tfe VfVfl|q VfVf`(Z WfWf SfSf8w 0Sf0Sf SfSf)E @Vf@VfHDUfUf  UfUf. UfUfu TfTfCI ff* ff 6 d /;-`F)@ I I4q IIY! IIP @J@Jt{ JJd @K@K91` -- KK2r LL' pLpLhu ++pu **y LLޯ@r @M@Mr MM$M6 d / @z4`2` ZZd cQ Z Zt@Z@ZZZZZPZPZ0Z0Z7@ pZpZN8@ Z Z8@ ZZ+ Z Z9 ZZZuj6 d / ; D% XZ XZ`iPfZPfZH/ pHZpHZV/u GZGZ @FZ@FZ8@i EZEZ1 XpKZpKZ=KZKZ cZ cZu GZGZ~3@Z@Z4AZAZ_PZZZZHPZPZ[u EZEZ~6 d /k`=, t dd@b dd cc dd8`# dd ddӿ dd d di`6 dd2 `d`de d dX{ d dP+ `d`d0 0 d0 dX ddMH 6 d /E)W,l@i e ed@f `e`eP  ЂeЂe` ee<` ЅeЅeH ЄeЄep PwePwe> eeteteM@i 0e0e* e e0 wewe#ee/6 d /ַt0 p6p6 @6@6Z'@i 66x@i 664B 66  6 6AB 662@i 663d 06064d 06066 6 6 66? 66666 d /j_@ ps p6p6e  7 7& @ 7@ 7 p 7p 7e 7 7' 7 7J 7 7B@ ` 7` 7h@ 7 7 Ue He g 7K@ v@ Fhm d He`PfPpBj 'p 3 as2(r 0r X?i +R & x`   p`& p̖; dy  r}!r}!`&!},`& !x)1 d X5' $z·*ȖPW;7 `0B; ]ߥ(^,0&,HDߥ`^,h&,~ )@S`&X @>;^nј ``wqu(4ׯ! ķ;əEGʧ@ d ~'(Ŗ8pv'@ ɴPrɴXvv'`Șp&͗x'T&'th͜= d 5\a|`ŷ,pq@@` *@8pӳ@xPE;;`hʖ\pr[ ^;0r`[ pRsvi/; * d /!3,%s@ ЗPhs` Pue Иe @e 0=e 7e ye Pe pt{ /` p @2 p' 0` %*struct { allocfreetrace int32; cgocheck int32; efence int32; gccheckmark int32; gcpacertrace int32; gcshrinkstackoff int32; gcrescanstacks int32; gcstoptheworld int32; gctrace int32; invalidptr int32; sbrk int32; scavenge int32; scheddetail int32; schedtrace int32; tracebackancestors int32 }G؝/!ɷ  (dZϲV Љ9 щp]8 щ(rv щ@ P҉ ҉-U `Ӊ2 Ӊ%@i ԉ`G pԉ6`U ԉy 0Չn Չ d /؇B!@ʷe (iݖ`9F օ؅n0=օ م2 ׅم@s@i `ׅم ׅ@څ ׅڅz ؅څ @؅`ۅ` ؅ۅp˝ m . " d /p!ڬ˷ (Ֆߠ% zz z {rPI G G \  GG HH[ d 40d!̷5bә0VUK@/› Ҟ(W`0xt8@@@HҟP:@X @`z`h)p;@xJm@vh Ou;t @Pu ;t2y d 8"ηޖ;E@X֖" @ (*00p@@pPx `і{"h;  ਫ( i!H5`&Xps"`dyh`&x 'B`&hha d d5O4! c@Ϸ xs@˜s K ](&00W{@Z`VH`VPw`VX@``@htwpRsvd֗`;#n W"  dy``y,3` .з 0"0 0 00(`&@w`&H$;P";R$;Tۖ;V}0X;hЖ;j0p;ҖhҖ0ϖ++=!9  d X7 "ѷN wіvpv(҃ J8n{HྦྷPіX^`Z .h_+`$p>6;xfG@gl|ՖŖ`&(Ŗ`&0)8@@&X? d =ҡ_"|ӷ,x`0"(d[0X˖)h˖7WL ڑ =XRsر`ݘVt@ʖ ӥxz xԘ0Ҙ`ߝ@ Z`; 'pxxP d 4˩ "(@Է(|0@4X ϗy(Qy8VyHȗyXӇ`&h pG ?x@hY&ꟗ&] w Rsvfӥ*`ԥ-@䤗v``P d 4 (շ(Vtr 3F@&r Vx` \0<\ '8PV 'HVXVh0Xx 'R3ҖR;C;+;e`?\`?6  d 7n!ַ/0|@u@(u0@(Ȗ`Pޖ@`ޖ@pSPTӗݞR`r xi/;蘗P"Әӟӟcv ˖@8?@@] d /` ط @8Җ 3ɖ 3?3 :FD `` 4  7 e e 70N .*struct { *docker.Config; HostConfig *docker.HostConfig "json:\"HostConfig,omitempty\" yaml:\"HostConfig,omitempty\" toml:\"HostConfig,omitempty\""; NetworkingConfig *docker.NetworkingConfig "json:\"NetworkingConfig,omitempty\" yaml:\"NetworkingConfig,omitempty\" toml:\"NetworkingConfig,omitempty\"" }Je6 d /&Pz@i p""p"" ` "` "@ ""dw @!@!|w ""L `"`"""6""  0 " " @"@"  ""H!@i ""Ѓ5""`p!p!u ""96 d /nk`Υ@ P`GP`G` TGTG% ! TG TG` TGTGo WGWG  YG YG[G[G  0]G0]Gj& eGeG~' ( P_GP_Gx`' aGaG`$ UGUG& XGXG ' YGYG[G[G^G^G(6 d /B/`V/ 00E00Ew `0E`0Ez 0E0E 0E0E 1E1EAA7AAhEAA2Hp\@p\@F g@g@F@s@@s@B\@\@9@Y@@Y@DO~A~AUOAA AA(6 d /B/@  V/ ??w ? ?z P?P? ?? ??`u=`u=7==hE==2Hl<l<F v<v<F`<`<Bm<m<9j<j<DOs=s=UO@~=@~= ==w6 d /{`[`e1` XfXf 0\f0\f3j [f[fb< ZfZf@Z `Zf`Zf| P[fP[f| [f[f4d [f[f WfWf8w PWfPWf WfWf)E Zf ZfHDXfXf  YfYf. YfYfu XfXf6 d /S๵`B91@s 1 1d) 01017@ @1@1N8@ 115Ms Ҙ 11`Z11mZ@ 11T` P1P1c` 11 114N `1`1r` 11zZ 1 1Z 11 #m6 d /LXB` (3(3  )3)3@ F  z4c)3)3d Pe }Q `)3`)37@ '3'3N8@ @(3@(3+ +3+3M@i 5353N@i 7373#6 d /' / `V||V||Q1 V`|`|N{`V||d{V||yW`VP|P|WV||Y\ ||-`V||@V||-D VGpELiE6 d /,D%@ pcpcr cc2@ cc cc&} @c@c cc@ @c@c j pcpc5ccA c c<0c0caLccj cc ccj c c 6 d /Pe - -/e --n%@ --Pd @-@-@ --1 --@ p-p-.e e e e !e *e e $@ @ 汹6 d /H; SSڅ`@R@R/Z SSu SS\0S0S0`SS@GRRpSpS SS PSPS8 0S0Snj`SS1 SS`SSvsSS@ RR|6 d /lt-- --`-`-=E--B@-@-p-p-u X- X-\-\-~-~-L--a--E--G--L--L - -  0-0-{$6 d /l Ʊ$%s ͆`# 000 s @@iv  `#   00v `# H `` l  46 d /`Ʒ,%s@ ЗЗhs` PPue ИИe @@e =e  7e ye e ppt{ /` pp 2 pp' pu ` MC6 d /   !!Yp!p! ! !;* @!@! !! 0!0!= 0!0!  !!:  !!NY`!`! @!@!!!/ ! !@ !! 0!0!b0 !! 6 d / Pe ##/e ##n%@ p#p#Pd Й#Й#@ @#@#1 ##@ ##.e e e e !e *e e $@ @ x[gE/,;" ;  4ՖB`ՙ;- Ή@i Ή %@i ωp@i @ω= ωe ω`e ωDe Љe @ЉP@i pЉ n4  R> d /) !S/д|@^{d4p| n{^-y |]{ |`c{hs |pv{ |b{ Z |e{Y |f{Ը`0`|@g{0p|e{J{ `|m{F |l{*|@_{~' |`{ |y{6 0| |{ G d BS@E"{``& `& &`&(`&0`&8*`&@`&H  P2`&)`& r& pÖࢢ Ă`& 2 唗`3( ɗ 8 K#A EELLY d 4"@5bә0VUK@/› Ҟ(W`0xt8@@@Ht@P`Xҟ`:@h;`p @x;@Jm@h IuPt Iut d /j_ p!( ޖe  77& @ 7@7 p 77e 77' 707J 77B@ ` 77h@ 7 72Ue e  K@ X@ T d /P@Eq x` - 0e ` - s` m3 p ur`E/7` m! 8e :& /@ F& H $`/ - hv \ D & ک 1 R DS ||Ž# d 5ԯ#{+ 30ٗ@rZ(xݘ@,80P0`0p`0ә;pS;(\7-p f`Xy"" ;a`њ@ d 6x#@N  wpv,v( ر8ҙ hn{p^ xr2&>6;f̖gVgh%,;l|舖`o  %Ǫ(F0tt d 4,"``7 T+04a  3(9 30Λ 38 3@z`Hf;P$_ R~zXav`|pZ;xpm@j: gvgb@v5 3vn;L&.x d /' !/ `V|{V|P{Q1 V`|{N{`V|{d{V|{yW`VP|{WV|P{Y\ |{-`V|{@V|{-D Vp{{G{pE{L{{[o6 d /r u%I `M@   |& & 4 ( ( * * zM  5 `' `' | ) ) 5 ! ! " " | ( & & M p p 6* 0 0    !    . 6 d /U`e1` :f:f|@` ;f ;fe =f=fwe >f>fcXe @=f@=f5e =f=f`(Z @>f@>f :f:f8w 9f9f @:f@:f)E =f=fHD;f;f  `PcPc ccx} cc cccc6xcxc 0c0cR `c`cOcc][6 d / #`>,0@O e e@ ddг@i ddfee  e e@ ee ee' 0e0eJ @e@e0e0eƊ 0 e0 eM @d@dYee e e\ddQdd[cdd6 d /֠14 P`P` ``~@``5_```` ```` ` ` 5`_``DFNrx`x` @u`u`  0|`0|`  pz`pz`@_ ~` ~`Ƈ66 d /.ε8; RRnpRpRڅ`RR/Z RRu RR\RR0`pRpR@GRRRR RR RRnj`RR1 0R0R1 pRpR`@R@RvsRRC RR &D6 d /&s2 PPO PPPP-PPs `P`PY! PPL; PPb P P PPv % P P`KPPPP x PPh > P P PP 2 PP.2 PPď PPHPPLT6 d /ث2 QQ-%PQPQftKQQO 0Q0Q-vQvQs@Q QQ zQzQY! QQv`% Q QKQQ1`wQwQ 2xQxQ %yQyQ.2 ЁQЁQ pQpQ(}Q}Q{ QQDð6 d /2QqD% /K/K `f 0K 0K 0K0Khr @1K@1K/ 1K1K"! P2KP2K'! 2K2KXse 03K03K,! 3K3Km! 04K04Kt` 4K4K P5KP5K 6K6K1@ 6K6K 7K7K' 7K7Kx 08K08K{6 d /,i2j bi lj P P "& p p t@ 0 0 ׈` @ @ t . |j ` ` =0   05 G1 p p a P P j `   P6 d /`s@i 0202. p2p2Py5`2`2@ P2P2 W4 8 й2й2|@i p2p2M 2 20 22 ڝ `2`2m P2P2Ua22vy 2222a6 d /=#@ `  r@i ##e1 5##te @#@#R@ ##5<@ ##j ##+@ p#p#A ##Py5$$!##`8 @ $@ $  A@i $ $@@i $$T$$x@i `$`$KX$$hhHf d 5d" 5bә0HV@  9(x@ě@HkL@`g@hpL  Utv@|@ @\P;@h puRt u Rt06`6H G@v 0`&*;0 k0060@<0P0`70pJ0k0v&0`&TX`&d`& ;Ef`&s`&H`&wy`&H0}0Xȑ6G3v00:30 200c0@֦0P0`l0p100pf0A0;c0\0ͦ00F00ͦ`&(`&0`&8xxG d 5  " | ,p`fX`  30P 384d6@dX4`i 3xp@;D;PI;ɘO 33;Xg;pڗ 铘K`sX`s@P3= d @I "t`$p`? @ʖ(Ӗ`&@ `&H  P 9X b*` ח`&x t`& Hϖ`& A*; \; k; ә; 3 Z2   G`!ݡ`!Ж]@|eb d t5 "((Hږ0w`2Ɩ0`&(Ō`&0Pؖ`?8&}g@_PA 'X@h–;~0"~V#I%H`?K0͎0w`SՖz%Qxxx|^ d 5@"( (p`fk`  30P 384d6@dX4`i 3xp@;D;PI;ɘ@ O 33;Xg;pڗ@ 铘K`sX`s68dn6 d /? &P;";" @="@="| 4"4"L08"08"I"I"0 \Ѓ 4"4"#5"5"`C"C"$0G"0G"tRR"R"a 6"6"#="="O`?"`?"d@ B"B"`B"B"*`L"`L"P6 d /t I< y ppA::6D` `?`?. <<   pp$ 9 "` 00 Q` p9p9` s6 d /` 3333~"4"433J3333J44333333F33FP4P4@ 4@ 4Ċ4433`,4`,4\1414J33/6 d /L;5+` pp .`< 009@   Ҭ` ``` { , @ , ``Í` A` <` pp0` <`  |` J  ` @@T` F=L6 d /;` @@   .< A   pp ``Í      g=  00A A PPZ6 d /)/д|д|d4p|p|^-y || ||hs | | || Z | |Y ||Ը`0`|`|0p|p|J{ `|`|F ||*||~' | | ||@u `r{`r{WD Su{u{6 0|0| 6h6 d /p@˷( Y Y ZZ% zzrI 0k0k/@ XX@ XX zzgI ;G LG H  ]GnG 76 d /` ' ` )L)Le LLu 'L'LNz &L&L@` L L L LD !LLm`A #L #L b0L0L4`bLLH`e%L%L_e &L &L@ KK `L`L pLpL 0L0L c` L L/ `L`LS,6 d /Dx1` LgLg@ OgOg̊e PgPgV|J PgPg pPgpPg@E 0Pg0Pg NgNg K OgOg.(e PgPg< 0Og0Og LgLg8w KgKg 0Lg0Lg)E NgNgHDMgMg  NgNg. `Ng`Ngu MgMgv6 d /_$`=-b-bm&b&b P(bP(bݔ` (b(b bbxmabb bbbbb0b0b#bb&b&b%L@$b@$b$ /b/bX+@i @b@b b b=X6 d /2/@2; RRnRRڅ`RR/Z `R`Ru RR\RR0` R R@G0R0RRR RR RRnj`RR1 RR1 PRPR`pRpRvsRRC @R@R1Q pRpRv]t6 d /# 3(qT ((s ((P P'P'k` `(`(2s''Py5P'P' ''''e -e (( D ''  0'0'0  ((7Se  '' ((e ((Ѓ0(0(| x nY d @!Pf'P$T`p@0  ɢ8Մ L@H;P[@X]`&`c1 hn1hh`&hh͖`&pdxs`&`&0T;;l`&`& 3`&dy(d`֡PL)7 d @3tj!`(Yiݖ$(—I({;@J`ƧHЗP;R%;T;VC;X(;Z8Hͧ`DH`!hPHpPdͧx`d`!pdqҖ = @Q}pQ}  q[ d 9]|),$9?@,p+r[0r`[ q`ۨ0ʖ;@U2;ByH@zXd[0`ʖ`pjؗ8ј\Pݘ_`$`p 'x;;u;zؘۨ]@S@]@v譖/`@" +(ږ@R U s PIYI͆`# 0PI@ZI0 `PIZIs PI[IiPI`[Iv QI[I`# 0QI0\I `QI\I QI]Iv QIP]I`# RI]IH 0RI ^I `RI^Il RI^I RI _Il%) d Q"p,ۆ` g;;;[;pY;& 3[;`3 ˮ '0<> '@q 'P '`і`3p Y˖ Y0 Y0 Y`W<~:`  $p`3 T` x Y llЈ d 5j@O"-`:02× @( ᧚(ܖ@08+`m@ `HږP``&hvx_ 4Xʘ2fّ›1% d 7 @@/ 108ۚ0"A/@@0eX0Hw@Xv0pe0@r@0|;=~;Z;}@ɴÛޜۚ@.|P2^/0d}H3"X 5Sd d :0@00w{08w@Hڇ@`*+ -h'0(z8( @N0Hӌ0X0hѬ0xy0y0~0"Z׬ Zx@H`&&0<8 d p7=H`X(2(0r\{  ӖYq 3 ^ ('; a;ЖVV\ؗ '>8-;`k@ :(B@8a;@6;B*";D3F`?Hv`nPbR d 7#`!(`3(0҃\{ g\` p;(f;*;,;.p@0&r n8@[`?P;X '`U 'p-`&Ә;ڙ;>@ߗ )R ݡ:`p` U&ܯ6 d / q Jc60`c05` `=` i ```00=8w 1 PPC@i C@i jt4 00>@i 0t_d6 d /@+@p -< @@s< .= (y`ob`oF&   pp:   :@ |@  PP"   00 @@ f`o G\ٖ6 d /@}X ΎΎr@i ̎̎r@i `uێێ @ @ H` 2 - 5:0 0 Pe @͎@͎e ͎͎`0v ؎؎ٌ p p w  Py5ََ:6 d /0d̷5h OuOu@j @t@t+ AtAt`~ AtAt1 AtAtS  0Bt0Bt/ BtBt BtBty PCtPCtB` CtCt] 0Dt0Dt9 DtDt 0Et0Et0A` EtEt EtEtK `Ft`Ft` FtFt @Pu@Pu~@i ;t;t 6 d /.`e1` ffvW ffs@X ffW ff@X ff @f@fV 0f0fܶ@Y f fA5C pfpftd ffE@W ff ff8w 0f0f ff)E ffHDff  `f`f. ffu `f`fc6 d /˝/`e1` 0f0fts 0f0fv ffv ff@p ff ffh@ ff@ ffA5B ffpp PfPfw ff ff8w pfpf ff)E @f@fHDff  ff. ffu ffT>ݭ6 d /n`e1` P?fP?f|@` ?f?fp AfAfe BfBfq `Bf`Bfe BfBfe Bf Bf`(Z `Cf`Cfe Cf Cf 0?f0?f8w >f>f >f>f)E AfAfHDp@fp@f  AfAf. PAfPAfu @f@fI ff @f@f 6 d / `v` o o > *oodI~PoPo*ppԔ7p7pnoo04p04poop+pp+p(p(p"L;p;poozL1p1p+N6 d /ׯ÷;5+  .< @@9@`  Ҭ ppB` {`, pp@`, Í 00A < 0 @@< | J` PP  T h6 d /tj (YV@i P>}P>}9 P7}P7}]8 8}8}- 0?}0?}@i =}=}%@i <}<}@i `:}`:}@i `=}`=}2 @9}@9}= @Q}@Q}6@ :}:}e 0:}0:}e 9}9}De 9}9}e 9}9}@i 8}8}   6 d /e)۩C D%@ РcРcp ccr 0c0c |`c`c.} PcPcecc eccu} ccw c c- `c`c$>cc ccx} cc 6 R OXzz6 d /ƭ ps 0808o.]p8p8pG88@88cp8p8 886G08085` 88P @E9@E9. p8p8&8 o88X 0808 88 0808:} ( 88w p8p8Py5E9E9 F9F9( 88I6 d /6f`f - -r - -W --  - - wp-p-r`b--t --  P-P-/ --& --zX @-@-v`--;/--`--d] --@i --u@i --#b`--* --wC6 d /p ( q&q&0 x{&{&)j&j&> <l&l&0c&c&Dt&t&ʴPx&Px&DIx&x&`Ge h e @ H0'0'ˆ@  6`# ''  0|&0|&v&v&`# ' '36 d /v( l*l*0 xl*l*)0m*0m*> <m*m*0DʴDI`Ge h e @ Hˆ@  6`#  `# 56 d /)ϸyPPFppFMPP@i '' ==?@i @i h\vv d 7bb`@N|@~y@; |—@(@@@BPNyhXOx冘`GH 3Ƙ 3䇘 3S$; H 30 3(聖 +0 9H"՗ЪPR@Xse +}|P`- P,}p|HH৅ d 0338!O  P`1Ö : 0( &8&@ƖIHI`;xŖEx4}}c0 } }p` }}г }`}e `}}F& }}> }} }} @i }Ѝ}}` P} d /2 !@Qq(vv`$pv`$D% /KK `f 0KK 0K@ Khr @1K K/ 1K K"! P2KPK'! 2KKXse 03KK,! 3K Km! 04KKt` 4KK P5K K 6KK1@ 6KK 7KK' 7K@Kx 08KKpd|C d 5+=@"R`e<S@@DԴ C 5ٳ@(@@082@@HPX`f@h/@pXX@x)@@' @W@''6Ǜ0; `w4篚&  d 86e`@TN L)—0X0(38#3:A0@0P0`xP0p|X.0ߖ0–0—0  3 ė`3Vϗ;0B0&}(>%` pp/`;0q` p d 7Q"`U`7<҃( bU01H[@`2~xlRsv;glei@<|ؘr&ۗ0`jɑ k(Bݘ 30_ '8 3H 'Pn` d 6E)m!|@W,<@*@ r(0ʖ\8r[H X`hE;;p[xxߝ,9O;RsvP;H`&q`&i/;];}w䗗`&(@@ d 6 `3"(X(<>x`p*҃H]>`Xq4`q@h 'p(іD@* ;;l '.@e@IdRsv`&ؗY;(t;*a0D< d 0n"@Z  ߖ@`{`&00(p˖`&8;@;B"H!"P88@X8@up 88 8P8s@i P882s888w 8`81 88Py5@888 6 8p8t j8П8808hgg6 d /ۨ@O` BNBNt @EN@ENH@5N@5N N NU!N!NbNN0N0NQNN`NN M M W ENpHiir@i hhn0@M hh/1+ii@:0phph1H0i0i: Iiit,hhIiiI@h@hXJiiJii0/ i iN1@0 i i΀ hh`M i i~B hh C @h@h?1iiD@2hh-U6 d /z $` ~ ۍۍX` څ PʍPʍ 0ڍ0ڍv. 0ٍ0ٍH/ ээl ٍٍ PЍPЍf'  w ͍͍! 0؍0؍ ̍̍`# | cQ PP@i \p6 d /5h Iu Iu@j t t+ 0 t0 t`} t t1  t tS ` ` t` t/ t t t ty t tY t t5 t tB t t] 0t0t< tt9 tt`} tt ttK `t`t IuIu~@i tt6 d /d 5h pupuw]`[ RtRth$ 0St0St 1 StSt^ Tt Tt pTtpTt`b TtTtA` Ut Ut` UtUtGb Vt Vt} / pVtpVt/ VtVt`0 WtWtH, 2 `Wt`Wt.` WtWtJA` 0Xt0XtK` XtXth 0Yt0YtE=` YtYt uu6 d /PeiS܅܅ yii pp1 qqcA rr sstA 0u0u PvPvr L MDR vvU ~~{0  ֈ6 d /QU`7r@i PXPXבpXpX{u XX"d @i p|Xp|X" > ~X~X{Wu |X|X@ {X {X``:XX1X `zX`zX }X}XM }X}X܊ ^ B@i XXLXX.@i `yX`yXu XX}懤6 d /(nF P_,P_,F0`,0`,` `c,c, e,e, b,b,.e T,T,|t w V,V,6 +P` < ^,^,:`[,`[,XX,X, W,W,],], Z,Z,0 `,`,J[r6 d /u  P^SP^SH 0&S0&SJc^S^S60`c^S^S05_S_S` P_SP_S`_S_S=` _S_Si @`S@`S``S`S=`S`S8w 0aS0aS1 `aS`aSC@i aSaSC@i aSaSjtbSbS @i \Ot`6 d /  T Tr@i T Ts@i @"T@"TP T T; aPTPT˹` `T`Tl0T0TkTTJt`T`TX@i TT@i TT&K u @T@T` pTpT T TX@T@Tb TTp T TlTT. TTޝ56 d /Ձ 8 .T.TJc/T/T60`c`/T`/T05/T/T` 0T0T`P0TP0T=` 0T0Ti 1T1T``1T`1T=1T1T8w 2T2TN1 _#T#T1 @2T@2TC@i 2T2TC@i 2T2Tjt3T3T! Ў@i tmtp?6 d /ız / / //z4 //KP/P/ / /`/`/6 //:6//EГ/Г/D0/0/6P/P/B`/`/&R//Y7@ @/@/7 //ӛ////P/P/`/`/P//}懤6 d /(n ͵ F 0"0"F""` `"" "" "".e p"p"|t w p"p"68 +P8 < "":@"@"X"" """" ""0 ""J[||y,@5` @oH0"0 0 00(`&@w`&H$;P";R$;Tۖ;V}0X;hЖ;j0p;00&;җ;3;Җ˖hҖ0ϖ Z Zf d 08R pNH7@|;I I}@8KPW;hr@p9;v;7) 3^ 3צ 3_ 3k0[&[&0I&:@";;(H@00v;H0P=M 3`%\"h, d 7`"@r=Hr 3ot@x`(B@0 z8S0@($0P%0`x<p>`x]r@t`u@ 3͖v  Pi; 3Җ`- n@T 3 3r0\/*sHp 8Ė;;;ז;;;;;;;y;;ȗ;;; ;;;#ؖ;,ؖ;l;M;5ؖ;Ǘ;p sP19 d /"@u vܖ4 dSdSJceSeS60`cpeSpeS05eSeS` PfSPfS`fSfS=` gS gSi gSgS`gSgS=`hS`hS8w hShS1 iS iSC@i piSpiSC@i iSiSjtjSjS Ž@i h^t 9 d /!(v(H ))0 x ) ))%%> <))0DʴDI`Ge h e @ Hˆ@  6`#  `# 6 d / `@D% HH- H HV/ PHPHw HHz HH HH H H2 PHPH PhGPhGB kGkGrGrG#.@i nGnGp@mG@mGe tGtG plGplGP oGoGe tG tGyM iGiGx uG uGQ`vG`vGq6 d /q{`9`e1` @e@ed 0e0evW pepes@X ff,4V e e eeA5@C `f`fN5 ee|c ee5Y ee(E ff ffPc ee e e8w ee ee)E PePeHD e e  ee. eeu eeE6 d /`7r@i cYcYt0oYoYmYmY>F@eY@eYm hYhYZ' mYmY|E0cY0cY`dYdYw@i @qY@qY jYjYx @kY@kY4B PYPY  p~Yp~YAB YY2@i sYsYeiYiY@i rYrY6 |Y|Y xYxY? {Y{Y;@uY@uY{^-6 d /@`7 i WWq 0X0Xr@i WW/@i 0W0W,`4 PWPWd `X`X05WW`FWW`[0W0W|E`W`W WWPy5WW`FPWPWF` pWpW 4 WWz PWPW'Ou WWu WWb@i P` WWu WW%B6 d /`m#1` pfpf@[ ff @f@f@J ff 0f0ff ff ff[5~ ff4 ЧfЧf pfpf(t ffw ff PfPf8w ff ff)E ffHDPfPf  ff@20f0f. 0f0fu ffXh 6 d /ReԵV% 88r0808 88% 88(t``8`8ۇu88. p8p8}@ 0909 @ 0909b 88v @8@8u0 88'  8 8hwuP8P8d P9P9Ѐ@ `8`8<@ 99O@9@9,(@ݔ88Q6 d /k@0DP [[sE [[`@[[H/ #0\0\0 F 0[0[h~@[[ [[` \` \c1 \ \ \\]p.\p.\ \ \X|p[p[L`\`\[[$\$\X `\`\(\(\2[[8\8\y6 d / X(05PG)PG)o ') ')p L)L)@i I)I)z s)s) L)L). `t)`t)0J)J)`e `I)`I)e `J)`J)P M)M)R s)s) @ O)O)/ ])])_)_)g)g)Np(p(D0b)0b)$ b)b)!e e)e)).! d H8UF@vTY0V0&`& 0(088`&HXv;Po 'X8 'hx|`&C7@@I0';D;fZ;0m2@4Z@e00Ce@bn;0*E"8`"@ ~@HQ@`\\^h?}ز3)K!T͆`Xp3j3  W($b3038`3@ZP Xv= 3`2h+*2l2pppt;vҖ.xA53zo-3|`_3~ .3 '!3xΖ3v` <Ry; d 09lo1!t$`€`JnP 0L8 `L@8LH0J PHX%@`я0x =0GHǍ;w@ݚ;{;w  ‰DU2!21@nW;0 L=8@@ wP@ϖرh_ol6 d / {`-4m ..@m `.`.@ `/`/@2@2(d @E@EO` 11h n-- `,,11 00 ::yG88`6DDpBpB(6AA;; 884G`3`3@ // .. // //=6 d /,@ V 9 ĉĉ]8 ĉĉ- ΉΉ@i ΉΉ%@i ωω@i @ω@ω(rv ÉÉ 2 оо= ωωG `ĉ`ĉ6`U 00e ωωe ωωDe ЉЉe @Љ@Љ@i pЉpЉ `n PʼnPʼn  t6 d /(k`7 0d YYr@i `nX`nX YY}DPYPYK> YY| YYd PYPYd YYm2 YY2@i 0Y0YF ;OFPEXPEX  21 ```  A - < @` ppP ,|1 =  ,1 ``b` ppPy5#e s|96 d /b( `(`( ((' @(@()''p((`((^$)$)4<))*)*)6)) )) 0)0)!)!) q ((HM@(@(hM0 )0 )G ) )M)))((O))P((6 d /S. EExe EE/@ EE60@ @E@E&@ E E91@ EE E E ЦEЦE| EEȐ kEE7@ EE РEРEҘ` 0E0E`Z0E0EmZ` EET` EEc` @E@E4N@ pEpEr` EEzZEE `E`EZ EETsZ d /! d&{33x3M3Pϖ3̖` h͖2 Pe -i,/e -h,n%@ -0j,Pd @-Pi,@ -j,1 -j,@ p-j,.e e e e !e *e e $@ @ TsZ d /![ d&{33x3M3Pϖ3̖6 h͖2 Pe #"/e #P"n%@ p#"Pd Й#"@ @# "1 #"@ #`".e e e e !e *e e $@ @ 0Ҧ d 8F w` 'l`Ҍ`U}~ᆗB(0 @ X@ x@ I@ I@ _@͘@Ƙ@k J8ePʗhɗp;xŗ;z;|;~䋙; 0^v;pL^@#6 d /p͸q Jcs@i @@60`c05` `PP2s=` i PP`=C@i @@C@i Py58 6 t jPPjt4 >@i 0t6 d /`r F  s@ &|M5`mԌԌt mPՌPՌӌӌ7e ``0C9 < |` pp|` ܌܌` ݌݌` pތpތ|` ݌݌} ߌ ߌیی d ̝:s6 d /j-`:^- U oo nnv nn|z @n@no z nnTz nnZz PnPn?z @n@nH' z nn nnz PnPn pnpn@O nn nnE pnpn @ nn&E nn܏z n nz nnz nnLz nn1@ nnfz @n@n: 6 d /n`70d `Z`Zr@i ZZ-`tYY"@D`Y`Yx` 7X7XtpYpY)ДYДY9YY Z Z: @X@X}DZZK> Z Z| ZZd @Z@Zd ZZm2 ZZ2@i `Z`Z)YY4`Y`Y Y Y*JAXAXKH Y Y@AX@AXiQL/,$"`3J&`3A`3 Xu`30 |`3@ܒ`3Pl`3`׬`3p O`3`3 `3`3Ƭ`3`3Q#`3t`3i`3س`3Bկ`3 )l`30?`3@k`3Pկ`3`A`3pӯ`3?`3{`3hԯ`3O`3γ`3r|`300~j d >"@@HՖ-N*X0QۜXǗ `rQh&} hp(F 'ۖ'pÖ}'hT0`&Ty";x`? v;(y0@(ʖ;P:@X: Lq0Mq?` MqNq< pNqNq"& W d 9@xd` 0V0 J@0PΙ 'HE 'X 'h  'x 'U0͙"t͙` @ϙ0޴əय@0HDϘ@XJp0ey{0R@ҙ0E;|;&ɘ;;;0G;hu/U@@xȖ3V3ϗ3 ܖ383b3 Nw 3bu 3 3  3( 30ݖ 38r 3@ 3H 3P 3XG 3` 3hpG 3pg 3x  3Tw 3ݖ 3 3& 3Ԗ 3 3 3S 3Q 3T VTwA0) " |[;ږ@ R U΄T02/08h `&Hbڗ 'P '` ps MI dI͆`# 0MIdI0 `MIdIs MIPeIiMIeIv NIfI`# @NIpfI pNIfI NI@gIv NIgI`# OIgIH @OI`hI pOIhIl OIiI OI`iI0$6 d /o`+ P hh@ hhr%mhhymhho hh\ 2phph% hh@e hh hh hh@| @h@h 0h0h,(O . h hic h h|hh@ h@ hPK 2hh h hy0h0ho hhY` 8B6 d /-f ' ` LLe ТLТLu KKu LLNz @L@L@` KK LLD !LLm`A LL b0L0L4`bpLpLH`eLL_eLL@ KK Lu `K`Kau KK O/u KKu K K 7Lu `K`K c` 0L0L/  pj6 d /ҡҷ,r@i dds` PdPd&@ PdPddd _e_e @d@d ddD BPdPd}E`d`d@B@O xw` PdPd1dd pdpd dd PdPd' ddJ ddddWM d dY dd O ddhdd- dd6 d /r=e cc0 `c`cd@f cc-U cch 0c0cP  ccH cc05cc{ cc? `c`c0 0c0c| 0c0c~A ccw@P ccH c c ccBe ccT0c0cccMe c c0! c ce @@i ccЃcch=x6 d / m`,%r@i -   05``2 B=`A K> 21 P  ,|1 ``= ,1 b` PPPy5  E 0 0 jE B#e `A  R | B}~6 d /Q@,%r@i -   ``052 B@@~App=`PPK> 21  P ``,|1 = ,1  b` Py5```jE``EBpp#e A`(`(R``*`*|`--B,,p d 8bC"(@(Rv6@;1`ݟ `R( іv8ӥHɖvP)@ `ٗvpz <Ɩ zXė}`ĥ,`ĥlΘZҙy L;芙; `&$Ι`&Ƙ`&HŘyGyPBy``? y '(] w8ߗP} d /+t"`6-,9p-,Hrt -,w -P, -, u `-`,6` - ,w @-,7-0,0-,< w -`m,*  @ -`n,lw -,8y @ -,v` -,8w -P,1Dp -P,Bi -0, ! -, -p, -,,@ ,,0,h",œ7/L –`3R`3w`3 `30`3@Ö`3P M`3`V`3pe`3M`3`3Hȗ`3`3&`3^`3 `3˗`3O`3V`3 Ė`30"`3@ږ`3Pٖ`3` `3pա#ա`Ɩ 3!̗ 3!0DB!;!;!Ֆ !} d /+ z" `6`# H#9#0P#Hrt #6#w #V# #X# u #;#6` `#P?#w Б#]#7@#`Y##Y#<x 0#"*`" Г#"lw `#P#8y Д#U#v` @#t#8w ##1D#Q#Bi#`R# ! # 9### @#n#H#@ W#,`Z#h"#vc6 d / qHrd   z%   h. P P F&   /` @ @ 05@ @ `   `  2s  i P P =  8w P P @ @ C@i   C@i ` ` Py5 8 6 0 0 t j   jt  {e 5 `  4>lo6 d /Z  88 8 8G P8P8s@i P8P82s888w 881 88Py5@8@88 6 88t j8888@i P7P7 ! @W7@W7 R o7o7`7`7 p7p7 @7@7M77]7]7x ]7]777 77aЄ7Є7s6 d /`d/`x  r ( 00 `` ! - 5 ^ ( @@(e ppd` }e e ne 00e ``e e zD 00 ( ``8w  ^x എഎF De 00Le ``fګ6 d /@ d/`x@Ǝ@Ǝ  ɎɎr (   ! PɎPɎ- `ʎ`ʎ5 ^ŽŽ ( ȎȎ(e ǎǎd` оо}e ȎȎe ne e PǎPǎe 0Ȏ0Ȏe ``zDĎĎ ʎʎ ( ʎʎ8w ^ÎÎx F 00De ǎǎLe @@Wv6 d /+`6--9p-p-Hrt --w -- -- u `-`-6` --w @-@-7--0-0-< w --*  @ -@ -lw - -8y @ -@ -v` - -8w - -1Dp -p -Bi - - ! - - - - - -@ ,h"/6 d /bBr@i QUQU` ]U]U_^U^U.t`X``MUMUVv`_ ]U ]U@ p+Up+U } ^U ^U9  +U+U` (U (U`\,U,UEOUOU0GUGU>DEUEU2U^ 3U 3URU^p1Up1UKUKUAUAUʆ`^>U>U` `(U`(U@i &U&Uq6 d /+,%r@i 00050021 ,|1 ``,1 Py5ЏЏB@@h @i )I@i г  F 4PP) 6@i @~@~lI  `7 00 `B@@R``x~~ | FWv6 d /+@ `6`#`#9##Hrt ##w ## ## u ##6` `#`#w Б#Б#7@#@###<x 0#0#*`" Г#Г#lw `#`#8y Д#Д#v` @#@#8w ##1D##Bi## ! #### @#@#@ ,h"$$vϓX2ǭ"ɬ@̸ydZ@{];0.` (C0(@t0Z[@`[PZ[`[>FZ[@a[m Z[a[Z' [[ b[|E`[[b[`[[c[w@i [[c[ \[c[4B `\[0d[  \[d[AB ][d[2@i P][Pe[e][e[@i N  N 7S d /pK" θq(vܖ4ߖ@ @Jcs@i @60`c@05`  `P2s=` `i P`0=C@i @C@i `Py58 6  t jPjtP4 >@i 0t0-0-D d K)!и!!ۆ` "0b p\kv= 3 `PP/D00l @y@8p-p-3xOpp`6 d /@!@Hrd @oc@ocK1 $ ococ ` ococ0` pcpcs `pc`pc@ pcpcb1`:pcpc @qc@qc` qcqcs1` qcqc1` 0rc0rc@ 6 rcrcP 6 rcrc` scsc2u @sc@sc scsc 6 scsc2 6 tctc2 6 @tc@tc@ tctc8w tctc{ tctc@ uc uc`  PucPuc~` Ff6 d /.`Dr@i pSpS]@=T@=Tr` =T=T£ 0>T0>Tr >T>T _?T?Tl?T?T3^@@T@@T%`^SST` 0S0SPv`l@S@S``SSptl@S@SY! SS ^`S`S@ SS`S`Sٻ`S`S- SS0 SS9PSPSP SS` SS` S SJ`lSSkSS(6 d /ǭ̸yr@i M[M[t0Z[Z[PZ[PZ[>FZ[Z[m Z[Z[Z' [[ [[|E`[[`[[`[[[[w@i [[[[ \[ \[x@i @M[@M[4B `\[`\[  \[\[AB ][][2@i P][P][e][][г@i 0N[0N[Ww` Q[ Q[܆ O[O[ @i @S[@S[@i N  N ,"e6 d /,%r@i ```@i 22/@i @4@4-  05  2 B77A55~99K> ``21 P ,|1  = ``,1 b` 11Py5GAAjE==, C;;#e ASSRUU|YY CpWpWPy6 d /@o" ) ") () .) 4) :) 6 @) p) v) P| ,M@ " " uЅЅ8@ @ @ @     VN'葖/p"(¸40d/`x  r ( 0 ` ! 0- 5 ^ ( @P (e p d` !}e `!e !ne 0"e `P"e "e "zD@# 0# ( `#8w P$ ^$F %De 0`%Le `%#w' d :"(""(pHҖ]>`o; e@(m0ߗy@dPRsvXă`ohVpVX;;V;}ޗ0`%  3"ܘ`&pЖ֥q@q4r@ < 3{ 3N`3 t\ 30 8Åoe|vB% 6 d /w ""r@i p p ` 99r@i nrO55 H`@ @ 2 - $ 66>3DDۇ`TP0P0= 5: ݷ ! `x`8`8`0##v  << @?@? 77ٌ (@Tw  P P  Py5 k%C'6 d /Z:D% zOzOJ% OOV% @O@Or OO`W }O}O- @O@OXse 0O0O. EOO)u OO% dP{OP{O` OOň` @O@Oo OOj&` OO {O{OW OO~' OO1 `O`O1 OO pOpO1` `O`O OOc ~O~O˔ Y  6 d /ѷNΡ RRr@i P;P;4qg 0808xe 0>0> 77` : :| 88́ LL~3PRPRQQt <<`{@@HAADpEpETDDxHHx` 8WW, PP@i 0b0bWWZZaa FFFM P P9 >>@@Df_6 d /) 8I8I 1I1Is MIMI͆`# 0MI0MI0 `MI`MIs MIMI.` 0/I0/Iu $I $IiMIMIv NINI`# @NI@NI pNIpNI NINIv NINI`# OIOIH @OI@OI pOIpOIl OIOI OIOIx 7I7IPy57I7I (I(I@i P$IP$IP@i )I)IN ! &I&IЃ@2I@2IC296 d / $F`nK`nKuKuKgKgK NK NKJNKNKJKJKv DKDK4@i VKVKd [K[K}e $` 0|K0|K `eK`eKL fKfKV EKEKW 0bK0bKW dKdK-W ]K]K:W PKPK` PWKPWKB` WKWKu YKYKEKEKpKpK_@i `K`K#KKT0K0K cz6 d /( 0_'0_' ~'~'d@f \'\' ^'^'^ @^'@^'`dН'Н'< ! p'p' w a'a'@i 0'0'A? ''p ! ' '׻`e]']'8 a' a' ( @'@'  ]']'0` P\'P\'Py` d'd'E` e'e'P  @'@'e p'p'e e `b'b'HK `e ''De ''Ѓpe'pe'0 d 7z6a#`:``z@'dΖ@a(r @3t H:dPdh;ؗ0; *;;/s`& 00 0l`&1`&`&`&ɖ`&P 0;;&;6 v`& 0@(PU@@@Xҟpp  _ P_ _ d x9:sY`##Hk>0ݗ3Hϖ3PΖ3Xi3`̖3hti3p͛3x3˖3zx3e3u63h`3Ry33̖3@Ӗ3~3rҟe@T 08lkHܢ0`p3`g`b`g\x;h %8 d `ED,[`$$ۆ` r&- 3ƆX YPZ;Xg3`ˠ3hmp '9 '^`W-L 'y zӖ- 3#z #6 d /  [9[9 0[90[9&-P p8p8d@f [9[9 [9[9^ \9\9`d@\9@\9< ! \9\9 w \9\9@i ]9]9A? P]9P]9p ! ]9]9׻`e]9]98 ^9^9 ( @^9@^9  p^9p^90` ^9^9Py` ^9^9E` _9 _9  će ؇e e J Ge e 76 d /˩Է(r@i 9( 9(:7@i A(A(`P(P(? p<(p<(w C(C(bH(H(v@ 0N(0N( p:(p:( 8(8(Be P=(P=(@i P?(P?(e M(M(U 7(7(X @  6`# N(N(J 2q S(S(w @S(@S(@ @i R(R(J@i `R(`R(2e B(B(e M(M(\"L(L(@`K(`K(I d h="t`%%$҃k2;Dؘ 3v 0 2@1;D(HN`&P_;Xؗ2\ `mex @^0ۙ;FyK;꒘|Ә;00};@r`׵Hz`׵8@͖@ x\;F\ ' 'ps`&&@|੡80ag+ d x;r"`%%300R<0 ;@0&0Hr0Xx<0hd:0xn;0Z@'08040G&0:0Y400p}0 500&0@S0P0`\0p|0l|0S00R0J0ld000Q0›0 6B07@@6@Xߍ\9 d / "`  `_9`_9 _9_9d@f `9 `9 p`9p`9^ `9`9`d@a9@a9< ! a9a9 w b9 b9@i b9b9A? b9b9p ! 0c90c9׻`ec9c98 c9c9 ( @d9@d9  d9d90` d9d9Py` Pe9Pe9E` e9e9  ڇe Ƈe e J Ge ϐe %6[ d :y@`%%̖ " 06`&`_`& "(0@P#uh`p͖0e`&^y;}`&`&ɧ`&K.!`&`P;ۙ;F`& ;ϟ($`&@d`&H;P`&Xҟ`מ;xLΟҖ K$@ΟΖ@͟Ο̟-Q d 5j^`%%`3~3`3ۆ`  ΖW(=&0 &8ϖ '@h&Pϖ&X  '`ϖ 3phЖXxs 3 3H:`W^:`WS:&` ~@+&q` R^` _ ̖lb 3=&=   3(y 08a&@pa Hk&Pi 'X8r 'h;'6 d /  ,*u@i PKaPKa KaKa&@ KaKa= `Ia`Ia|aaD |XaXaQ`Ya`Ya|0ka0ka8 vavah :gaga~a~a aaS@aa@>aaV caca@i eaea`pa`paȂPaPa l@i FaFa Ga Ga  K Paa\# a 8F@ H6 d /(*u@i `.%`.% .%.%&@ .% .%= p,%p,%|h%h%D |;%;%Qp<%p<%`}@N%@N%8 Y%Y%h :J%J%`a%a% m%m%S@  e% e%B r% r%`X F%F%@i H%H%pS%pS%Ȃ4%4% l@i )%)% 0*%0*%  K Pz%z%\# a 8F@ R6 d /, S **6@+@+`*`*S P*P*@*@*@ P ʹ P*P*z**xSк*к*#**U ++jK + +0+0+@*@*++p+p+K ****@i ++|++k@i @*@*8е*е*n****PP*P*8:e @+@+a0z d 8: @&&@"0b0}0  '0Կ '@ 'P  '`ά 'p䆪0Ԭ@8ۥ}0lĭ0AN`&d@t@*@I L@('0@`#P00Xŭ0hr0xe@@ {@t"E;;R;}E;; Ԭ;լ;`(;O0*struct { PercpuUsage []uint64 "json:\"percpu_usage,omitempty\" yaml:\"percpu_usage,omitempty\" toml:\"percpu_usage,omitempty\""; UsageInUsermode uint64 "json:\"usage_in_usermode,omitempty\" yaml:\"usage_in_usermode,omitempty\" toml:\"usage_in_usermode,omitempty\""; TotalUsage uint64 "json:\"total_usage,omitempty\" yaml:\"total_usage,omitempty\" toml:\"total_usage,omitempty\""; UsageInKernelmode uint64 "json:\"usage_in_kernelmode,omitempty\" yaml:\"usage_in_kernelmode,omitempty\" toml:\"usage_in_kernelmode,omitempty\"" }R6 d / $ r@i /@i  4qg pp@i pp jjغd @@05K> 0k0k21 kk,|1 kk,1 @l@l? Py5@i pp<@i   | ^@i 00 e пп/000` >X``l  @i `_ `_ Ѓ5``  L6 d /`Hrd  z% ``h. F& /` 0500` pp`2si PP=8w    ``C@i C@i Py58 6 PPt jjt e | V BPOPO`FTTu`$ @@&}6 d /@&@ r@i `~H`~H/@i 0LH0LH4qg ~H~H@i ~H~H H Hغd `H`H05HHK> HH21 H H,|1 `H`H,1 HH? HHPy5 H Hz@i ~@i   9a@i `e _~ ` G @i 5Zs6 d /@(,e @&@&r@i &&R0 %%)p&p& %%`O &&5`e  P&P&&&E&&+F@ &&qHd && & &Ԉ6`# `'`'&&` & &\8&&( 0&0&@ `&`&p@ &&Z@i P&P&P&P&&&]&&`# '' ( P&P&&&''' 6 d /@(( !*!* !*!*d@f @"*@"* "*"*^ #*#*`d $* $*< ! $*$* w %*%*@i 0&*0&*A? &*&*p ! `'*`'*׻`e(*(*8 (*(* ( )* )*  )*)*0` @**@**Py` ****E` p+*p+*P  e # e e 6`# `HK ((`e De ЃHgp/i@Z''ɖ`32`3|`3 `30 `3@ϖ`3P`3`1`3pLd`3`3[`3?`3&`3N`3`30h`3x`3t`3`3 z`30j`3@ `3P`3``3p7ա`pp|9{@p@p pqpq?` MqMqU1@i pp ppS@ pp` 0p0p pp< pNqpNq1@i `p`p e pp3@ ppH p pkJc q q pp^@i p p}QT6 d /0@K2%N ' 'D% )22% O `1`1(sR **b l u` EE@u QQL 0O0O(&N ''ue ))t{ pSpS& )44&N `'`'&R P*P*' )@6@6x pEpE91D77~'N @%@%@` pp (  $m"" N ## $$`9`91 )) CC' )@3@3pu T TBd @D@D7++ P/@"@9@&@ (W}*r@i `~HH4qg ~H H@i ~HH HHغd `H@H05HHK> HH21 H`H,|1 `HH,1 H H? HHPy5 HH@i l@i   a@i 0e Bc ` *G ҆@i 5HN d / "(((L 8̖`? ӖRsvdy( !*0!* !*!*d@f @"*"* "*#*^ #*#*`d $*p$*< ! $*0%* w %*%*@i 0&*p&*A? &*'*p ! `'*'*׻`e(*0(*8 (*(* ( )*P)*  )*)*0` @**p**Py` **+*E` p+*+*P  e e e `HK `e De Ѓۥ6 d /]`~N 7 m^^p m@^@^r` ^^- ^^ ^ ^@ 0^0^% ^^1` p^p^@ ^^ np^p^e ^ ^V/ ^^j& ^ ^uq^^/ ^^!`q ^ ^ 0`qP^P^ ^ ^ ^^~' {^^\OИ^И^@ ^^x ^^1 p^p^1 ^^px^^X^`^`^ ^^' 0^0^ ^^О^О^ 0^0^Ddq.`4#@,++L`.˖`.+  |s dp 3Nؗ`3 3 3ϖ 3_ 'ϖ 3pϖ 3( ; t`&(`&0Th`&8`&@`&H;Ppp 3X 3`ח h 3p/-x*;8r '.٘`3|חda']g 34=&4& 'Җ 'lq '# '  '(6 '8͖`3H ͖`3X(͖`3h1`3x2*struct { lock runtime.mutex; lockOwner *runtime.g; enabled bool; shutdown bool; headerWritten bool; footerWritten bool; shutdownSema uint32; seqStart uint64; ticksStart int64; ticksEnd int64; timeStart int64; timeEnd int64; seqGC uint64; reading runtime.traceBufPtr; empty runtime.traceBufPtr; fullHead runtime.traceBufPtr; fullTail runtime.traceBufPtr; reader runtime.guintptr; stackTab runtime.traceStackTable; stringsLock runtime.mutex; strings map[string]uint64; stringSeq uint64; markWorkerLabels [3]uint64; bufLock runtime.mutex; buf runtime.traceBufPtr } d 9F$@#1**=x` zs0 4s'0҃@Ζ"P`jXf`jh)٨xe@@@ј@V@@]r B02;9) 3r ; '(t\&88N@@`<HP{ 3X '`xP@pA 3x 3RsvҖS$" 3 'p6@ " t6 d /ͷ!` P7P7o77x j8j8` C8C81@i @8@8x` *8*8d e8e8p A8A8Z5h8h8@j8@j8`7` |8|8|{8{8 +e V;8;88 0;80;8xҙ` PD8PD8Ve p~8p~8 H @h8@h8O 9898 i:`k8`k8t" "@7@7@7@7jOP7P777I0з7з7ѯZ6 d /(!D% V HH I It IIa5 IIB`aHH=4l HHBHHv@l HH`aHHl HHv`/HHk 0H0H gHH<l HHH`/HH~k HH~'A HHS X `H`H Bk `H`H@H@Hl HH X HHk @H@HGpIpIM HHke f HHHHO pHpH` @H@H H Hl; ! HH\ 6 d /+=R`e!1` p1fp1f|@` 1f1fe 07f07fne 5f5fM< 7f7fe 6f6f 5f5f,e 4f4f'e 06f06fe 4f4f P4fP4f 4 4f4f'e 5f 5f< p7fp7f=4@q `5f`5f `8f`8fe 6f6fX 9f9fs 8f8fe p6fp6f4 P9fP9f4 8f8f`(Z 9f9f P1fP1f8w 0f0f 1f1f)E 3f3fHD2f2f  3f 3f. p3fp3fu 2f 2fmI ЎfЎfV f f6 d /azH6! VzzVzz9V0z0zVпzпzVpzpzVVzzVzzzVPzPz0VzzMVzzV0z0zL6VzzVpzpz0Vzz~7VzzǼVPzPzVzzDVzz*xV0z0z~Vzz=VpzpzVzz?\ zz׾VzzVzzlV@z@z~VzzVzzC?V z z2Vzz+V`z`zQVzzI'6 d /Pβ!@E `w`w p2xp2x`@i 05x05xvu ww[- :ww ` wwE `w`wB@ww @x@x` xx  ` x` x`*x*xy@i /x/x x xE @x@xE xx xxʅ@i xx؅@i @x@xP @i xx 0x0xE`xx `!x`!x $x$xd@0&x0&xu@@i (x(x Gww + 80.pwpw!r6 d / j,%! 79RXX{ SVVD9R0I0I`RJJQ0W0W RWWQ9;TT`VVR0X0X4< \ \P,P,F  S`i`iRp RRO`RWWXXRjj`..HHQR00ґ S``QR^^ `R^^Qjj# RqqQ;P`P`p`aa|R@x@x-e 4e _09095n6 d /z!@ɳ ![ "" p!p! .`   B/ %.  S/ Ӱ `  `  8p     00k9` : ``^}   0 0 6 @@D  =@i @@C@i =@i p p C@i @i ``A@i  @i 00@i x5 `   M  F*struct { ReadCountNormalized uint64 "json:\"read_count_normalized,omitempty\" yaml:\"read_count_normalized,omitempty\" toml:\"read_count_normalized,omitempty\""; ReadSizeBytes uint64 "json:\"read_size_bytes,omitempty\" yaml:\"read_size_bytes,omitempty\" toml:\"read_size_bytes,omitempty\""; WriteCountNormalized uint64 "json:\"write_count_normalized,omitempty\" yaml:\"write_count_normalized,omitempty\" toml:\"write_count_normalized,omitempty\""; WriteSizeBytes uint64 "json:\"write_size_bytes,omitempty\" yaml:\"write_size_bytes,omitempty\" toml:\"write_size_bytes,omitempty\"" }Ri`l d @L_!F,,b *wQ0THS`,Wxp`F R'`&pٖ`6l`6PQ"( >Fq˜q \q8pŗ@oPBqh(@;~;`&;uY@C@@@dȗٟ(<P@Y;Xϙ@`<@x4QL;L!@w@ϙ@Q@X@@ Qq8 d /az"I6! VzyVzy9V0zpyVпzyVpz0 zVVz zVz zzVPzz0VzpyMVz@yV0zyL6VzyVpz y0Vzy~7Vz`yǼVPz@yVz0 zDVzz*xV0z z~Vzy=VpzyVzpz?\ zаy׾VzyVzylV@zy~VzyVz0zC?V zy2Vz`y+V`zyQVzpyIy<<c  d 0ԥ#e`KpOşB1ş(KH@;Pr0Xܖ i@pV% `F9pP9r` F9P9rG9PQ9 PG9Q9% G90R9 G9R9(t`@H9S9ۇupH9S9. H9T9}@ H9T9 n I9T9j& I9`U9u rJ9U9 @ J9PV9b J9V9v K9 W9u0 @K9W9' K9X9hwuK9pX9~'`{L9Y9Ѐ@ L9Y9<@ L9Y9@ L9 Z9O@M9Z9,(@ݔه d 8*,TM,, Җo339@ 0(p0іij8`q3pTq3x<38Ж 4d 3@p 3h '0n`WLs 'Y ;!;;;ݗ;;`'ݟ;p' '>`3tX W{ 3@<30!<38Җ3@}3H[P3X 3`Bh@pr 4ҖJ 3Y '6 d /?z`Y6"`Vzz`Vzz9`V`z`zй`Vzz`VzzV`Vpzpz`V z zz`VЭzЭz`Vzz1`V0z0z`Vzz;6`Vzz`V@z@z`Vzzm7`Vzz`VPzPz0`Vzzx`Vzz~`V`z`z`Vzz%\ zzľ`Vzz`VzzX`Vpzpz~`V z z`Vйzйz2?`Vzz `V0z0z`Vzz-`Vzz3 `V@z@zppU 6 d /F$@1=" 0O bbr@i bb r D bbpsU pbpbs bbU bb@i pbpbx bbx bb KbbK> bbPybbbbJPbPbCPbPbF]b]bbbL bbT b b bb'Obbbb4Obb bbmHPbPbiJpbpb bbYbYbJbb PbPb@ b bbbD36 d / "r@i @@r rer@i 6! @@/ PP05PPm`E@@b@m@m] cmmN1 _ИИ21 ,|1 00,1 1` 1@i  Py5``E00@@H z ФФz@i `E  ۙ`E85pbnn  cqq{9 _``1 b1 1 ~Ѓ58#6 d /mܱ"!c`# nKKWW0707P"P"ʌ__G````**Ep&p&P!P!]]((،ZZ(LYY"\\p$p$ PP7    + Vhh8h  "{DD &;OX#^;a  d /?z"Y6"`Vz wy`Vz8y9`V`zyй`Vzpiy`VzyV`Vpzy`V z`Kyz`VЭzPBy`VzPWy1`V0zy`Vz.y;6`Vzy`V@zZy`Vz`4ym7`Vz@ny`VPzTy0`VzQyx`Vz@Ey~`V`z?y`VzHy%\ z yľ`Vz|y`Vz2yX`Vpz6y~`V zpcy`VйzNy2?`VzP`y `V0z`&y`Vz@``0o{Cl;;N;`& 3PS 3 3 3] 3 3%]& &(hؘ 30N 38ؗ"@*;Hta;Jrژ;L1;Nؙ;P;RPXpb`dhӘ p{o& w ?/|_#m!4}T wdy r@i 7p7r 77re` 7 76! 77/ 77057 7m`EP77b77] c77N1 _07721 7p7,|1 77,1 7071` @771@i 77 7@7Py577``EP7777&K X d@i p`E%U`E05rb  c; _&1 1 J1 |5  NP/+@#p"(}Tpvr@i S Sr 0 SpSrep SSr@i S0S6! SS/ SS05` S Sm`E SSb SS] c0 SSN1 _ SS21 SpS,|1  SS,1 P S0S1` SS1@i SS S@SPy5` SS``E SS SSG  @i ,`EN`E5b  c _1 21 1 D5,Z6 d /`J,%!\%` ` ` ,d --`j j50 0 [`y@ @ t`=Б Б i lkP P 4 6 .$ "&`n t`o 9  8 @ @ / v 0 0 / ` ` vr ` ` ‹e @ @  p p ~'` l   x` `  = Q2`zp p j {` ` 0 `> = ' D (y Ё Ё ` ` C H|  @ @ h n;6 d />0 u%q x` - 0e P P ` - s` m3 0 0 p ` ` u r`E /7` m! P P 8e :& /@ F& 0 0 H ` ` $` / - hv P P \ D & ک 1 ` ` R н н e R DS 鼈6 d /%q 0 0 x` ` ` - 0e ` - P P s` m3 p u@ @ r`E /7` m! 8e 0 0 :& ` ` /@ F& H P P $` / - @ @ hv p p \ D & ک   1 P P R e R DS  ~6 d /nǵ%q x` P P - 0e `   - @ @ s` m3 p u0 0 r`Ep p /7` m! 8e :& P P /@ F& H $`0 0 / p p - hv \   D @ @ & p p ک 1 R ` ` e R DS "96 d /b%q x` -   @ @ 0e p p ` - s`   m3 P P p   u  r`E  /7` @ @ m! p p 8e   :&   /@   F& P P H   $`  /   - @ @ hv p p \   D   &   ک @ @ 1     R   e R DS   36 d /k(ǵ%q y y x` - x x 0e ` ` ` - s` m3 y y p 0 0 u r`E /7` Ц Ц m! 8e @ @ :& P P /@ z z F& H `{ `{ $`  / @ @ - hv \ { { D & ک 1 x x w w R @z @z pz pz pv pv e R v v v v DS 0w 0w ]6 d /0@c%q P P x`   -     0e   ` @ @ - p p s`   m3   p   u` ` r`E  /7`   m!   8e P P :& /@ F& H $`` ` / - hv   \ @ @ D p p & ک 1 P P R e R DS 1o@N6 d /Vq %q 0 0 x` ` ` - 0e ` - P P s` m3 p P P u r`E /7` m! 8e 0 0 :& ` ` /@ F& H $`@ @ / - hv \ D P P & ک 1 0 0 R p p e R DS  66 d /̨`&` pMpMs @M@M CpMpMjIMMjMMMMC`M`MГMГM~uMuMprMprMqMMF MMMMvMvMjMjMĊMM lM lM!GPMPMҊMM`PM`PMMMHMMHPMPM~M~M |M|M`M`MMM`M`MpMpM̏@M@MnMnMx MM3 MM `M`Mte `M`M MM_pMpMM6 d /d 'q x` - 0 0 ` ` 0e ` - s` 0 0 m3 p p p u r`E /7` ` ` m! 8e :& /@ @ @ F& p p H $` / - ` ` hv \ D & ک ` ` 1 R   "*e R DS @ @ X6 d /ݬ_'q p p x` - 0e 0 0 ` ` ` - s` m3   p @ @ u r`E /7` m! 0 0 8e p p :& /@ F&   H @ @ $` / - hv 0 0 \ ` ` D & ک 1 @ @ p p R "*e R DS cc6 d /j@`'q   x` @ @ - p p 0e ` - 0 0 s` p p m3 p u r`E` ` /7` m! 8e   :& @ @ /@ F& H $` / ` ` - hv \ D 0 0 & ` ` ک 1   R P P "*e R DS 6 d /`'q x` -   @ @ 0e p p ` - s`   m3 P P p u r`E /7` @ @ m! p p 8e :& /@ F& P P H $` / - @ @ hv p p \ D & ک @ @ 1 R "*e R DS  iB6 d /Oa'q P P x` - 0e   ` @ @ - p p s` m3 p u` ` r`E /7` m!   8e P P :& /@ F& H $`` ` / - hv   \ @ @ D p p & ک 1 P P R "*e R DS nƚ6 d /`a'q x` - P P 0e ` -   s` P P m3 p u r`E@ @ /7` m! 8e :& /@ ` ` F& H $` / @ @ - hv \ D   & @ @ ک 1 R 0 0 "*e R DS ` ` O@~6 d /Pa'q x` - 0e P P ` - s` m3 0 0 p ` ` u r`E /7` m! P P 8e :& /@ F& 0 0 H ` ` $` / - hv P P \ D & ک 1 ` ` R "*e R DS Z+o6 d /;!f@ ' u @@Xse  }7 -yy` wwT xxJy` cc `y`y\y- z zL r r[S uu|&0q0qny cco ss~-zz?-zz >{{[ ``[`|| 4=S T  > T ``T @@> T `T 00[T 1 7 p{p{7 P|P|8`  L0l0lmmLooLL 0s0srMЊЊي6 d /(  ($ @ n  c NWN}e Ι `d[@ P!; ~"P"P>H _~h睿6 d /NeuB) $nUnUr@i nUnU 0oU0oU0 oUoU` oUoU_pUpU.t`XPpUPpUp`XpUpU^pUpU3 hUhU`` @qU@qUʷ` qUqUt qUqU.@i iUiU>``rUrU6 `rU`rUVv`_rUrU~`sUsU@ PsUPsU } sUsU@i sUsU9  0tU0tU `tUtU` tUtUy uUuUG @uU@uU`\uUuU I uUuU`H vUvU=A p PvUPvU vUvUE0>D2U^RU^ʆ`^` @i D譖/, #|,&#4-`3y '0z D%`. `0f\@q1 ~9Ä1 r `- pЈ% hs1 @9 !  L . ` `m!`S ` 0^e  u @ T P X{ `t{ @u v `: `P`w`. 0E P ' 2 `. ' _2 & P8 P2   2 p0(  4Pޖ@ d /@|QQW z ۳H0 0w% Pr7s`,`ݳ``x| M 3 4 \ ۇ dEE(=dw s}8 svwwf~ s~ s,I9wZ96<wC< sr> {@ @ Z sc C 0w@Pw `p} s 8 BI~Br ?`vID` `x `xDwDʯ s  sDp 0xwppxxa d h<!66@Yq0`&K`&`& 0K`&(ؖ`&0F֖08ZH Z`xv`&F̗`&0˜0G0Y0.ǘ`& G0NȘ0(Mۖ08K0H0Xj@hʘ@p`&! 'B0 X0R0D00ٖ@M00:%(00O0@<0P0`PȖ`Upo;˗;X;;;Y; F; 8Ֆ;Յ;M;;Ö;;L;شb9 d /(O# .` (p 4$ @ n P><P>< c NWN}e Ι `d[@ P!; ~"P"P>H _~A6 d /z6 `* p_p_L.@ p_p_q p_p_$ __8 __Ќ y_y_Ծ __@ `}_`}_@ __B{@ }_}_@ __@ _ _,@` }_}_@ __<` ~_ ~_ }_}_@@ __$< P_P_@ p~_p~_  {_{_$A __W< __0 z_z_NA `_`_h< __@ P_P_@ __^@ }_}_A@ __t| ~_~_  __p  {K__  __ __@ Ѕ_Ѕ_@_@_d`_`_vL__  _ _0, d :@ $@z 88@*w0@@(ǖ0@k0P0`Y@p|`/Y~@u00bؖ;"0  \Q nۖ  nZw  n a# n HQ (V n0O;8;:;<K;>A;@;Br3`&H;P`R++X0@YpPX`&x1 `&d`&H _~T5x6 d /;+,(D(n(5 @zw z (&(d;4(|0|]66(7R*7#Le ‘f9+Ut+++9H ,@ :` , J.E d /;i# (+,(UD(n(5 @zw Pz @S(0Z&(d;40(|@0|]6 6(70R]*kZЀ7S#PLe ‘Хf9+UtS+P+P+pz9H ,W@ :` ,@,,o d ;499`"00?0 ٥"0s~08—@HF`a;byhJ;x0NyT ;XĖ@Hp;~;\yO;Ƙy;˗2; #0͗;v 0&0(HG@؟8ϗ;P;R yXƘ;h0p{y;Oy;lw;ݖ;Z0Oƛ;3ߠg;RЗ;z;T0\;0`&;s(0Z`& ;((y0ԗ;@`J;BbHTPH6 d /Zࡳ,!1 yOOj1POPO n ,P ,P} n 1P1P8{ n PP n "P"PPP@O@OPP`rPZPPZPPPq`n VPVPHOOɵ@HOO`vOO @pOpO.2n `PP`PP?2n RPRPn TPTPn UPUPtn PWPPWP11OPOP`` lPlP9 w dP dP0 wbPbPx PPsPPsPx o PP< ?PP@n PPPPP W wPwP`n PP} o PP>KOO O O4pOpOPPD P P O OpOpO(OO OOVp|Pp|P*6 d /@@ҵ,'s L:L:`# P:P:ܢ PU:PU:ps 0N:0N:s`# R:R: V:V:s N:N:͆`# 0S:0S:0 0W:0W:e ::. @M:@M:t`# PQ:PQ: U:U:L& K:K:]/PO:O:u T:T:v N:N:`# S:S: W:W:v L:L:`# Q:Q:H U:U: ::::x PL:PL:+`# P:P:> U:U:2 M:M:8y`# R:R: M:M:`# pR:pR:  V:V:֏ @V:@V:0 ;:;:  0;:0;:, `<:<: E` p=:p=:`1 A:A:Q ::: :: I: I:6*4  X W:W:Ѓ J: J:0:0:Gl6 d /N,!>%&&S`  r@i <` $$PeV`ppTrPPf'3 jpp-3`.` $$%@E/}`'`'` | 00p G?;` ``  \ ' \PP`` ^`pp,` ~`m -=i~@O``` %%@(@(!@i !!@i ""C@i P#P#~3@@YPP8@i f PPX X 9Z $pp_֛>6 d /@,,rv ;{;{ <{<{̄  <{<{ <{<{te p={p={@` ={={P 0>{0>{p >{>{h  @?{@?{s @{@{ @{@{11  0A{0A{s A{A{X1w B{B{ pB{pB{:v B{B{2 `C{`C{=j C{C{E 0D{0D{hs` D{D{t@ E{E{ئ pE{pE{t E{E{  0F{0F{e F{F{38 G{G{˸` `G{`G{Cx G{G{s;` PH{PH{(w  H{H{L `I{`I{ I{I{ @J{@J{` J{J{Ȏ K{K{?` pK{pK{2 K{K{ `L{`L{|  M{M{` pM{pM{` ` M{M{YPN{PN{ N{N{~@i PO{PO{]d6 d /( ,$^-@S ++,,e@,,.t ,,N8,,ݵ8,, ,,;,,h0,0, , ,s`8p,p,@8P,P,0t ,,s ,,X ,,3 ! ,,,s ,,;  ,,/X , ,`t ,,$t ,,` ++ ++u u ++{ ++{` @+@+h ++>6@+@+:70+0+86`+`+\ @+@+Z  + + + +w !,!, ++d ++xF++`+`+8++ , ,)++*@+@+>+++BY++شb9 d /(f#ҹ+p 4$   ,@,@n 0*@0*@ c NWN| -@-@}e Ι `d[ P!; ~"P"P>H _~A6 d /׹-%^-@S nnnne@ n n.t `n`nN8nnݵ8nn  n n;`n`nhnnnns`8 n n@8`n`n0t nns nnX n n3 ! `n`n,s nn;  nn/X n n`t `n`n$t nn` nn n nu u PnPn{ nn{` nnh nn>6nn:7PnPn86nn\ nnZ nnPnPnw nn nnd nnPu bjbjF RNF$19 d /# ع,$ܖι^-@S PnPnnne@pnpn.t 0n0nN8nnݵ8 n n nn;nnhnnnns`8`n`n@8nn0t `n`ns nnX @n@n3 ! nn,s nn;  nn/X nn`t `n`n$t nn` @n@n nnu u nn{ @n@n{` nnh nn>6PnPn:7nn86`n`n\ nnZ `n`nnnw @n@n nnd nnG DN|Fx d <7,X@۹<<r ij 3@`3HX z` :|%4\`WpXϖXr 'g&1>&0Ζ& ˖&(k&0.&8<;@,;BA;D";Fk`'H`͖;J/ 3P/ X*;hDr3j65`3pu&T 32 20nW/j `W8ڗ`(g 34g 3,iWJ 4@ 4<3e`&b; 33/ f3Hf3P3`WXb`33TzW/6 d /`.&i2@B@Br@i //%` JJֆ@i GG߆ 4 **e++sR GGt@i 0-0-l `,`,.`--v`E33.`E@<@<:=` M M MM O O05p1p1=5EE2`B4466N1 _DDހ@i 0021 '',|1 '',1 @(@(= ]XX?ZYY| [WW[C`[PZPZ[@V@V `\pUpUR[WW // @i KKPy599# @ @\ 50L0Lj F@>@>` PdPd@i  @i ..@i 0 0 5@i ! !XX !!#@i !!T p"p"c d /{#0,,4. 6ɖp rv ;{@{ <{{̄  <{0 { <{ {te p={@ {@` ={ {P 0>{{p >{{h  @?{@{s @{{ @{ {11  0A{ {s A{0{X1w B{ { pB{{:v B{P{2 `C{{=j C{{E 0D{{hs` D{ zt@ E{{ئ pE{{t E{@{  0F{{e F{p{38 G{{˸` `G{0{Cx G{0 {s;` PH{ {(w  H{@{L `I{{ I{{ @J{p{` J{{Ȏ K{{?` pK{{2 K{{ `L{{|  M{`{` pM{{` ` M{zYPN{P{ N{z~@i PO{{y96 d /\ N00D%` WwWwry аwаw PwPwj wwp PwPw@ вwвw @w@w ww  @w@w̄  ww PwPwte ww@` PwPwP жwжwp` `w`wh  wws иwиw ww11  0w0ws wwX1w 0w0w ww:y PwPw2 мwмw=j `w`wE нwнwhs PwPwt@ wwئ PwPwt пwпw  PwPwe ww38 @w@w˸` wwCx @w@ws;` ww(w  wwL 0w0w ww @w@w` wwȎ @w@w?` ww2 @w@w ww|  ww` w w~@i ww, d = "@@@%@6@v@0n@H'0`z@pJۥl(@L@@Ь@꽭@O@0ŭ0 J00\y0@b|0P0` ܯҫpx~@ҬɫuM@00 ' '  '(Կ '8ά 'H䆪0Xں0h<0x 'ά ' ' 'F ' 8h@P00hK`&xejԬ ~ '+"ĭ"f~"  ' 'zѬ '6 '}0};( ­;**;,a;.x;0? d /\#@ N//(. 6}ry аwpuw Pwvwj w`Wwp PwWw@ вwVw @wVw wWw  @w0Ww̄  wpww Pwxwte w|w@` Pw}wP жw`wp` `wwh  wws иww w0~w11  0wws wlwX1w 0w@w ww:y Pwpsw2 мwtw=j `wowE нwqwhs PwWwt@ wwئ Pwwt пww  Pw`we w`Vw38 @ww˸` wwCx @wyws;` wp{w(w  wwL 0w0w wpXw @wqw` wrwȎ @ww?` ww2 @ww ww|  w w` wPw~@i wUwKQ6 d /ɲ2, Z3Z3` 3 3 0303 j3j33U 33 0m30m3εQ k3 k3 po3po3%`W3`W3 ]3]34 ! `Z3`Z3zv  Z3Z3v@_3@_34 a3a3o`c3c3 d3d30`30`3 i3i3z`f3f34g3g3 /d q3q3F& q3q3O/ 8V3V3j& ~3~3u 33 $3$3 ! `Y3`Y3*|` `]3`]3w`! _3_3[8 b3 b3: d3d3B  e3e3h`! `3`3 ! i3i38|! g3g3  " h3h3t`w3`w3~'Hr3r39@ ( [3[3# @\3@\3nv3v3 x3x3Pyay3y3@Bz3z3z@i @3@3 u33"]3]3=Nb3b3q`e3e3`h3h3986 d /%Z2/ v:v:s n:n:`# j:j:ܢ r:r:ps p:p:s`# l:l: 0t:0t:- 0u:0u:s p:p:͆`# m: m:0 t:t:@v Pv:Pv:. 0o:0o:t`# k: k: r:r:6 w: w:L& m:m:]/Pi:i:u q:q:v @q:@q:`# m:m: t:t:v o:o:`# k:k:H s: s:` y: y:[ `w:`w:7 v:v:T u:u:l x:x:>|@ x:x:x n:n:+`# `j:`j:> 0r:0r:2 o:o:8y`# l:l: @p:@p:`# `l:`l:  s:s:֏ s:s:0 f:f:  @f:@f:, `d:d: E` e:e:`1 0h:0h:Q ::: 0:0:p~@v u:u:c:c:sd:d:-9&6 d /,,2'D%`. ``f\q1 9Ä1 r - pp% hs1 @@9 ! @u L  .  `  m!`S ` ` ^e  u @ @ T  P  X{  t{  u  v : ```w`. E PP ' 2 `. ' _2 & hu Pu  pu pp8 PP2  2 pp( f }} 4ޖ=7 7@ + g ! 6 d /` '4` 0fx0fxa= gxgx~ pkxpkx rxrx wxwxǼ` xxxx9  zx zxּ pmxpmx=` p|xp|x~` ЍxЍx }x}x` xx: xx=@i xx=@i xxH@i `x`x0 @x@x xx= xx= xx0 ЉxЉx@@i xx` @x@x7: A\x\x1@i cxcx.2@w UxUx JxJx(G@Tx@Tx@i 0Sx0Sx  0Vx0VxPV + 8@i MxMx` pPxpPxV@i KxKxxpOxpOxDOxOx` xx `x`xX KX xx ` xx ` xx0  Z@i "PRxPRxa6 d /aD4&.\\\Hq \\@W\@W\ \\²\P\P\`` Ќ\Ќ\ O\O\IG X\X\v#PS\PS\# U\ U\ FZ\Z\H Y\Y\W` p[p[f @V\@V\ c\c\sE \ \`@\\.` `\`\L&`#`\`\Pv \\VX@\@\N @\@\v [[0 F @\@\h~@\\  Y\\>> \\`@P\@P\t pQ\pQ\0`F \\4z a\\' b\b\L ]\\B \ \1 \\lC`]\\ 0\0\ \\`\`\1|\|\zf\f\r`n\`n\„\\T]\]\u\u\6*`\`\І\І\d\d\` s\s\x\x\@t\@t\?P6 d /`77PD^ ! ` < ! D D% "  ! @ " XK !  ! {H ! ViPh  =b<N`]`]: ! ]]]]7]]ԉ`  ! LL "  ! D R~ȋ ڋ  9    ]]  )V ` .HHg d 3$e /,OB1şKH(h͖`&8ܖ A x9@y9j& y9z9u rz9{9 @ {9{9b |9P|9v |9}9X p}9}9u0 P~9~9' 9@9 9 9hwu9Ѐ9d `99~'`{9p9Ѐ@ 909<@ 99@ 9`9 9 9:} ( 99w `99!99O9P9Py5Ј9P9 Љ9 9( p9Њ9,(@ݔ*struct { full runtime.lfstack; empty runtime.lfstack; pad0 [64]uint8; wbufSpans struct { lock runtime.mutex; free runtime.mSpanList; busy runtime.mSpanList }; _ uint32; bytesMarked uint64; markrootNext uint32; markrootJobs uint32; nproc uint32; tstart int64; nwait uint32; ndone uint32; alldone runtime.note; helperDrainBlock bool; nFlushCacheRoots int; nDataRoots int; nBSSRoots int; nSpanRoots int; nStackRoots int; markrootDone bool; startSema uint32; markDoneSema uint32; bgMarkReady runtime.note; bgMarkDone uint32; mode runtime.gcMode; userForced bool; totaltime int64; initialHeapLive uint64; assistQueue struct { lock runtime.mutex; head runtime.guintptr; tail runtime.guintptr }; sweepWaiters struct { lock runtime.mutex; head runtime.guintptr }; cycles uint32; stwprocs int32; maxprocs int32; tSweepTerm int64; tMark int64; tMarkTerm int64; tEnd int64; pauseNS int64; pauseStart int64; heap0 uint64; heap1 uint64; heap2 uint64; heapGoal uint64 }6 d /D;D% ;] ;] @]@] E \\r`E \\ fp ]p ]a."p]p]/sW]W]0E p\p\Z~@\\N]N]e> U]U]8wF 0\0\w 0"]0"]\\B \\\\P\P\-pJ]pJ]ݺ@i ]]]]]]bB\\\\O`@\@\E`K \ \`K \\` \\E]E]b E `\`\j @U]@U]T]T]p6]p6]` +] +]8]8] Ep=]p=]xB]B]/K]K]$\\ P]P]S]S]ʅ0M]0M]`-]`-]`H]`H]2I]I]<2@\@\d@4]@4]`]\\` \\]M@\@\0 S]S]YK \ \@K P\P\P` \\,p\p\>` \\-@#]@#]`` p]p] G \\zb^6 d /0j(<T@i %%s@i @%@%KR %%` %%h ! %% `%`%J & &%%C p%p%%%6`# p%p%  &&PP!&P!&(&(&@7&@7&WbP6&P6& p%p% @%@%ފ %% %%$&&%%/%%p&&GLP&P&N%%Č&&L0%0%XL` && 4 &&֌&&,%%W %%@i %%X0%0%0%0%Yp2&p2&N %%@ %%7&7&DNP8&P8&؁ @%@%&%%[ p%p%@ %%H P%P%rU %%d ]&]&%% % %`# %%uc5&5&[%%Ha@ %%@ %%8%%3&3&a%%a6 d /ml@P<^-@T 8v```K 00,( PP ܱ @@ K | PPc`# ``$` P#P# (mkSFZ@@0d>``n7J``r PP@ \ PPhN8Hppv ## Ծ\  ^  [: Q _ݝ0$0$ \>6 d /)`=-2% M 8%@ n nD% '@@F%`M ^- M b l 9 @u L "&'t ue rrue rr,`M nnt{ PP@ mm/ mm& '& M v@F@@|0@ PmPm' '$'(91D``~' M  @ yy M @|@| 0y0y@`'pp` m m,`2 llލN 0~0~ 5 xx1 PnPn֭e `r`r1 M 0V0V 00' '`` 2``j pu  4t  5t 00* 8 5 P @s@sf9ppvvN p p4\WWYY:@@:`M ``:``:: PJ6 d / `[>2.` TTr@i TT` TT` 0T0T0 PTPT_PTPT`` TT@! T Tt` TTx` TTV7@i TT~TT TT@ @T@TV]TT` @T@T;]ЧTЧT]TT } TT; _TTN TT@i 0T0T0'`TT0 TTD `T`T $pTpT` `T`Tp` TT@TT8TTTTLTTpTpTڂ  TTFF TTTT0 ` ЮTЮT @i вTвTԍ@i PTPT~Je TT` TT` PTPTJPTPTJPTPTJTTؓ TT|T T TTTռ TT`pTpT@ PTPTTT0TT[2PTPT} `T`Tp0T0TbTTq[0T0TO T Tx,ă6 d /%J>82%M D%'  P%'..'P2P2 9p@p@`mh% ++Մ -d ``Hrd %`N PP`N %'"00%:  9 BB%@u NNL MMt @@Ze e R&())X{ `R`Rt{ @P@P|&'@@b:'00֨'((&'r`m&M &M ==!'66 ''PP7  0`)6''@@H'(@*@*91D@L@L~'M ``r ;--q  t PP l`5 pp1 ``1M ?? BB''pp 2` ??j Pu RRpu QQ('P:P:\0 0  ' 'p p 'p"p"f9@I@IN &06#,`#;L`0  ߞDf0 ĩ00^-@T 08PV^ c^ R` n eP ! p^`# }^`  $vP^^3!^6BHZœМ ! &   P    !P]p %6 d /)0/@7rx || ||̄  || `|`|te ||@` @|@|P` ||p | |h  ||s p|p| @|@|11  ||X1w || ||:y ||2  p|p|=j ||E @|@|hs ||t@ | |ئ ||t ||  @|@| ||e ||^e p|p|38 Ц|Ц|˸` 0|0|@y || { ||A) A`|`|F ||- ||e ||Q @|@|Fe ||0 ||2e @|@|Cx ||s;` | |(w  ||L 0|0| || ||` p|p|Ȏ ||?` @|@|2 || 0|0||  ||` @|@|.2@w ||T  ||4e `|`|WD S3|3|yy ې@y  Gq) 0u ||b5S6 d /BA| ЬvЬvp u uFpupu%uu'VPuPu+`0u0uP лuлu @%uuquua %uus`uu+: uu&%pupup`@u@u: u u5uuN&uu uuE@&uusPuPu:uuS&&uu<`0u0u uuN&uuhwuu<uu''pupu`uud uu$ @'PuPuuupupu'0u0u8`uu| PuPu'uu: vv:6PvPv<uu0u0u(@u@uH:`uu` `u`u%@( u u!uu\@u@u (PuPu?` vvnuu+`uuC] PuPu (uug@pupu*)0u0u5B`uu 0u0uR@)@u@u< vv`uu~~`u`up)pupuD`@v@v uu)vvS6vvnX/)`#@0/?64p 6H\k' rx |p]| |@^|̄  |^| `|_|te |b|@` @|pc|P` |`t|p |`u|h  |n|s p|0o| @|c|11  |d|X1w |z| |z|:y | [|2  p|[|=j |S|E @|T|hs |}|t@ |@v|ئ |v|t |x|  @|0y| |@|e |0S|^e p|`|38 Ц| p|˸` 0|Pq|@y |`\| { |]|A) A`|p|F ||- |P||e |||Q @|{|Fe | ||0 |k|2e @|@l|Cx |0a|s;` | b|(w  |l|L 0|`m| || |U|` p|V|Ȏ |@r|?` @|ps|2 |e| 0|h||  | w|` @|w|.2@w |S|T  |p`|4e `|a|yy W|ې@y Y| `|Gq|) 0u ||bJv6 d /Z( 9G;, --e 0 0 Hrd 4- r r e @ @ e Je z% r 2f ` ` x - p p s p p p u r` sj   t "& p p U (ue p p xe /@ P P F& ` 0 0 6@d H @ @ $ - P P \ `x 0 0  P}` 25 0 U1   ~' @   F@@ p p ` ` Ю Ю  @ @ A@ Я Я  @ @ wg \ @ @ \ f 0 0 .2 Q2 C ~36@ N 'J l8)$xc 9  PP/Z(`#`9G;4d|`2{ 4ꄖ,  --e 0  Hrd  4- r P r e @  e 01 Je z% # r 0% 2f ` % x @p - p & s ( p p ) u P+ r` , sj  - t P. "& 0 p 1 U 3 (ue p 4 xe 5 /@ P 05 F& `5 ` 0 7 6@d 8 H @ ; $ @> - P ? \ = `x 0 @  @A P}` B 25 pC D 0 @F U1  H ~' `J @  @K K P F@@ p M M ` N Ю O  @ P A@ Я S  @ T R wg T \ V @ X \ Y f 0 @Z .2 Z Q2 @\ C ] 0m ~3 6@ N 'J l8F )$xc ` 90I PL I6 d /6 #Ofppr ^-@T W PP8PP wr`bt ) 00  / &  z Y ``v;/d@^ ] X ^ (c |3$ P ! ]`# x wpp^` 0 6 @ƛ2P"^ԛ/^!<^P`ʏ  ! * =6 P D, CPp   v TPI^܏ T*struct { IOServiceBytesRecursive []docker.BlkioStatsEntry "json:\"io_service_bytes_recursive,omitempty\" yaml:\"io_service_bytes_recursive,omitempty\" toml:\"io_service_bytes_recursive,omitempty\""; IOServicedRecursive []docker.BlkioStatsEntry "json:\"io_serviced_recursive,omitempty\" yaml:\"io_serviced_recursive,omitempty\" toml:\"io_serviced_recursive,omitempty\""; IOQueueRecursive []docker.BlkioStatsEntry "json:\"io_queue_recursive,omitempty\" yaml:\"io_queue_recursive,omitempty\" toml:\"io_queue_recursive,omitempty\""; IOServiceTimeRecursive []docker.BlkioStatsEntry "json:\"io_service_time_recursive,omitempty\" yaml:\"io_service_time_recursive,omitempty\" toml:\"io_service_time_recursive,omitempty\""; IOWaitTimeRecursive []docker.BlkioStatsEntry "json:\"io_wait_time_recursive,omitempty\" yaml:\"io_wait_time_recursive,omitempty\" toml:\"io_wait_time_recursive,omitempty\""; IOMergedRecursive []docker.BlkioStatsEntry "json:\"io_merged_recursive,omitempty\" yaml:\"io_merged_recursive,omitempty\" toml:\"io_merged_recursive,omitempty\""; IOTimeRecursive []docker.BlkioStatsEntry "json:\"io_time_recursive,omitempty\" yaml:\"io_time_recursive,omitempty\" toml:\"io_time_recursive,omitempty\""; SectorsRecursive []docker.BlkioStatsEntry "json:\"sectors_recursive,omitempty\" yaml:\"sectors_recursive,omitempty\" toml:\"sectors_recursive,omitempty\"" } C6 d /]`WSQ )_)_z 08_08_۳0>_0>_H-_-_0 _ _0w,_,_% ^^Pr^^7s``^`^,`^^ݳ`0^0^`x ^ ^| 2_2_M `)_`)_3 @2_@2_4 `^`^\ 2_2_ۇ 0^0^dE^^E^^(=^^dw s__}8 s__vw _ _w__P^P^f~ s _ _~ s__,__I9wP_P_Z9__6<w__C<`_`_ s__r>0 _0 _ 1_1_ {@ ^ ^ ^^@ ^^Z s#_#_;_;_`9_`9_&_&_c P^P^C ^^0w__@__Pw__ `/_`/_)_)_P+_P+_`__p__}^^ s__ =_=_8 2_2_B`"_`"_I^^p _p _~4_4_Br06_06_ B_B_A_A_?`^^v^^ID`^^ `x ^ ^ `x^^DwC_C_DD_D_ʯ sG_G_  spI_pI_Dp0F_0F_ S_S_00N_0N_x0Q_0Q_O_O_wR_R_pL_L_p0K_0K_ ^^0 ^ ^I6 d /ԯ+S:` 0606<`x66qUP66ޠd p|6p|6p 66@ 6 6 <6 <6L`Y (6 (6 `'6'6/ &6 &6`%6%6.`7 p%6p%60 66s 66%` @6@6` p6p6v`! 664 66o 66 0606  664! 6 6 ! 66  66= 6 6X ` 6` 64  0606f! P6P6` D6D60u` ;6;6{ M6M698 M6M6@i pJ6pJ68 66= L6L6!@i pG6pG6@i w6w6` ( <6<6z@i N6N6 pO6pO6~'`' E6E6 66 66 `6`6m@`' pD6pD6 P<6P<6L 66w@ 66@ 66' 66` o"6"6v?` $6$6o0!60!6 @6@6p@i 0x60x6=@i px6px6@i 0N60N6p O6O64` `)6`)6E 66H66  `6`6  66P6P6l @i x6x6$y6y6a66aP6P6a66 ^6^6`6`6K ! `6`63M 6 6 ! B6B6 ( <6<6 ! 66T` 6` 6 66S6S6@i z6z6S3@i Pz6Pz6{6{6`O6O6V6 d /@XPV% f9f9r` f9f9s ( 88rg9g9 Ph9Ph9ps i9i9% i9i9 ! 0808 88d 883  8 8Ф`d88:t88t88 j9j9(t`pk9pk9o.i`8`8pGl9l9`^Ь8Ь8cm9m9 po9po96G q9 q9ۇur9r95` ps9ps9. 0t90t9P t9t9}@ u9u9 nv9v9. w9 w9&8 ow9w9> x9x9j& y9y9u rz9z9/ `8`8 @ {9{9b |9|9 ! P8P8P ! `8`8  88 0808z}  88v |9|9X p}9p}9u0 P~9P~9' 99v ! 88H` 88~ ! 881 88 8 8=  88O  Я8Я8T ! p8p8 99 # @8@8K> 88G 8 8hwu99i?`88`@8@8X# 88Q# 88d `9`9~'`{99Ѐ@ 99`88<@ 99x ( 88@ 99 99|`@8@8x0808:} ( 99w `9`9!99O99Py5Ј9Ј9 Љ9Љ9te 88( p9p9,(@ݔ 885Y`^88+ 884 88]6 d /೹@*`V-@ gg POPOl r rRr mm9 @6@6Z gg>1 pp@i WW X X.`@??.` j 55s@F xx` 00 @@` W  Xk xx` qqe pp e ``y(e )e Ye ww6e pupue 004=e pwpwe  e ЃЃe pxpxI=e 5e uu.@i 33pj 33 `7`75@F P}P}= cc^} P`P`( aa-e vv=e vv9@F @{@{Y@F 0z0z7` `3 ``` pp/ qql8 ttT| 66@F @@4} 11B} 11F <r x@F v l l`# 0m0mH ll@ iiP ee> 1F OO/e uud --"@ 0/0/ 00y<@ // //{ 0 0l @.@. .. ..1C p0p0>  0K0K`@DDx@i 0303 @j 22W 55 `4`4 66 nnr ^^. 77 NNxr OO^BB ! 0A0A@2@2` prpr K` 00 WW<  @i __՜6 d /#״5~}| 9u9uñ аqаq PqPq*@гqгqz qqU0q0q/qq@`q`qqPqPq:`qqz pqpqV`q`qlqqqq+pqpqs` q qU: qq!&@qq90q0q {qqEWqq1`@q@q qq`qqtPqPq:qql&qq 2``q`qx qqQ@qqmprpr,qq rr`PrPr` rrl,rr"{rr{rr`rr  r rD @rrrrr2'r'r0!r0!r (r (r`0r0rͺ @*r@*r{01r01r:9r9rP3rP3r2N@:r@:r`BrBr3 `pErpEr(`Lr`Lr` UrUrY NrNrpUrpUr8 _r_rDv brbr@ brbr WrWr _r_rE> jrjr) drdrO krkr: 9u9u:60:u0:uf` srsr9  mr mr? trtrv  ~r ~r = rr@! r r@ 0vr0vrP!~r~r* @r@rR rr\!rry` PrPr. rr !rr?` `:u`:u91 rr @r@rb@"rr` ДrДrz" r r< :u:u r rCPrPr,"rr`0r0r^ rr "rrD@r@rrrRT#rr`rrp rrU@#rr1_rrwrr #rr`rr  r rrrҹ0r0r $ r r1#rr"D`rr @r@r@$0r0rrrDPrPr)-$@r@r`rrK_ `r`r $PrPr( PtPtۙ Htt_( `t`t HttS6мtмt{3H6 d / W@t 0gG0gG EGEG]*`GEGEGFF/` 0G0GpGAGAG"q GG0pGpG``G`GX :G:GXGPHPHq H@G@G0`HpGpGH0G0GgH G G IpHpH`I-H-HIWHWH GG PGPGI0CH0CH`8G8G` GG йFйFr LGLGbu ХGХGt 0G0G)LGG| kPGPG4 ;H ;H&GGx` GG. GG JGG`} H H~GGj`G`G} } RG RGDy~GGq GGRy}HH6jGG}(H(H6 ~5H5H`=HH`y`~@H@HPZHPZH*6 G G GG@ 2G2G8` GGz`J`H`H)7JFF}J G G8 KЏGЏGC pGpG|`KHHz`<GGzK*H*HRK@8H@8H L=H=Hz`LSHSH GGd/ GGGG|`GG89 'G'GR0@i FFx PFPFyLPNGPNG0~ MGG`M G GM`_H`_HMGG NGG=` GG HHy 5G 5G gGgG PGPG`G`G 0G0Gr> H H`NGG` "H"H `1H`1H \H\H\ \H\Hz GG@mIGIGpmGG  &G &Gz  G G;`l`G`GqA FF3> GGqdPGPG PGPGslGG x` .G.GP "G"G z #G #GU`GG`s*G*G P)GP)G9 H H G GGp>G`k>G>G@ @F@F@i FFGG:"@F@F wG wG& ! @F@Fe @F@F ! FF7FFn. FFMGGwOGG#G#GZ F FGGp`?G`?GT6 d /'·*z PP- @ @@ \%` 00,d  `o`o--`j@1@18r@K114g@A@A.I B Bұ`3??@`@`@j5 0 000qi`N`NKOO/ 5 M MpMM5i0H0HKHHq 5FFGGġ` p{p{r`0S0SȅwSS^&RR8RR[`ypWpW@PXX h@a@ar2J b b`4__\````t`=pVpV޴VV3 L` PPbkззK``35жжu@PPlk@@Kмм 4 6@@u`/`/U>>3 L L^vEEPQPQv`UU ^^4`4ppt@@` 5`v o`` @@`ڤ00v 2k @g@g 444`''<p9p9z??pCpC( GG4`pLpLRPP6`YYe `i`ie i ic!`q``}q00~@N<;6htqPPN;H&N`hJ73rxpt`;  .`& "&`n  tnΈ@L   9@t oL`9t`oL 9.otM9+pp.L6 hIny3@8   ` jj7`oo9 rrZ`@q@q/  v vr 003‹e   {{~'`ss0 vyy{@ ггH ddl gg}` PkPk x  ւh@Jw> 4}DO0 0 hPP@J00> 4}pp`p**M**> :`(`(}@0)0)>p;;~M<<`:P:P:C ; ; =` ` uB  Q2`z@@Xz0E0EPEE =0D0DCDDazIIQ0J0J$  >HHC I Ij {@N@N@QNN0 `>@M@MCMMx`{RRsQ@S@S>QQ< @0R0RxPPAPAH  i\\CJp]p]4ZZ0@[[=??@@@@@'Pt2Uy=pp(y ii 0h0hH|llgg*         h ЛЛ*struct { TotalPgmafault uint64 "json:\"total_pgmafault,omitempty\" yaml:\"total_pgmafault,omitempty\" toml:\"total_pgmafault,omitempty\""; Cache uint64 "json:\"cache,omitempty\" yaml:\"cache,omitempty\" toml:\"cache,omitempty\""; MappedFile uint64 "json:\"mapped_file,omitempty\" yaml:\"mapped_file,omitempty\" toml:\"mapped_file,omitempty\""; TotalInactiveFile uint64 "json:\"total_inactive_file,omitempty\" yaml:\"total_inactive_file,omitempty\" toml:\"total_inactive_file,omitempty\""; Pgpgout uint64 "json:\"pgpgout,omitempty\" yaml:\"pgpgout,omitempty\" toml:\"pgpgout,omitempty\""; Rss uint64 "json:\"rss,omitempty\" yaml:\"rss,omitempty\" toml:\"rss,omitempty\""; TotalMappedFile uint64 "json:\"total_mapped_file,omitempty\" yaml:\"total_mapped_file,omitempty\" toml:\"total_mapped_file,omitempty\""; Writeback uint64 "json:\"writeback,omitempty\" yaml:\"writeback,omitempty\" toml:\"writeback,omitempty\""; Unevictable uint64 "json:\"unevictable,omitempty\" yaml:\"unevictable,omitempty\" toml:\"unevictable,omitempty\""; Pgpgin uint64 "json:\"pgpgin,omitempty\" yaml:\"pgpgin,omitempty\" toml:\"pgpgin,omitempty\""; TotalUnevictable uint64 "json:\"total_unevictable,omitempty\" yaml:\"total_unevictable,omitempty\" toml:\"total_unevictable,omitempty\""; Pgmajfault uint64 "json:\"pgmajfault,omitempty\" yaml:\"pgmajfault,omitempty\" toml:\"pgmajfault,omitempty\""; TotalRss uint64 "json:\"total_rss,omitempty\" yaml:\"total_rss,omitempty\" toml:\"total_rss,omitempty\""; TotalRssHuge uint64 "json:\"total_rss_huge,omitempty\" yaml:\"total_rss_huge,omitempty\" toml:\"total_rss_huge,omitempty\""; TotalWriteback uint64 "json:\"total_writeback,omitempty\" yaml:\"total_writeback,omitempty\" toml:\"total_writeback,omitempty\""; TotalInactiveAnon uint64 "json:\"total_inactive_anon,omitempty\" yaml:\"total_inactive_anon,omitempty\" toml:\"total_inactive_anon,omitempty\""; RssHuge uint64 "json:\"rss_huge,omitempty\" yaml:\"rss_huge,omitempty\" toml:\"rss_huge,omitempty\""; HierarchicalMemoryLimit uint64 "json:\"hierarchical_memory_limit,omitempty\" yaml:\"hierarchical_memory_limit,omitempty\" toml:\"hierarchical_memory_limit,omitempty\""; TotalPgfault uint64 "json:\"total_pgfault,omitempty\" yaml:\"total_pgfault,omitempty\" toml:\"total_pgfault,omitempty\""; TotalActiveFile uint64 "json:\"total_active_file,omitempty\" yaml:\"total_active_file,omitempty\" toml:\"total_active_file,omitempty\""; ActiveAnon uint64 "json:\"active_anon,omitempty\" yaml:\"active_anon,omitempty\" toml:\"active_anon,omitempty\""; TotalActiveAnon uint64 "json:\"total_active_anon,omitempty\" yaml:\"total_active_anon,omitempty\" toml:\"total_active_anon,omitempty\""; TotalPgpgout uint64 "json:\"total_pgpgout,omitempty\" yaml:\"total_pgpgout,omitempty\" toml:\"total_pgpgout,omitempty\""; TotalCache uint64 "json:\"total_cache,omitempty\" yaml:\"total_cache,omitempty\" toml:\"total_cache,omitempty\""; InactiveAnon uint64 "json:\"inactive_anon,omitempty\" yaml:\"inactive_anon,omitempty\" toml:\"inactive_anon,omitempty\""; ActiveFile uint64 "json:\"active_file,omitempty\" yaml:\"active_file,omitempty\" toml:\"active_file,omitempty\""; Pgfault uint64 "json:\"pgfault,omitempty\" yaml:\"pgfault,omitempty\" toml:\"pgfault,omitempty\""; InactiveFile uint64 "json:\"inactive_file,omitempty\" yaml:\"inactive_file,omitempty\" toml:\"inactive_file,omitempty\""; TotalPgpgin uint64 "json:\"total_pgpgin,omitempty\" yaml:\"total_pgpgin,omitempty\" toml:\"total_pgpgin,omitempty\""; HierarchicalMemswLimit uint64 "json:\"hierarchical_memsw_limit,omitempty\" yaml:\"hierarchical_memsw_limit,omitempty\" toml:\"hierarchical_memsw_limit,omitempty\""; Swap uint64 "json:\"swap,omitempty\" yaml:\"swap,omitempty\" toml:\"swap,omitempty\"" }*struct { Stats struct { TotalPgmafault uint64 "json:\"total_pgmafault,omitempty\" yaml:\"total_pgmafault,omitempty\" toml:\"total_pgmafault,omitempty\""; Cache uint64 "json:\"cache,omitempty\" yaml:\"cache,omitempty\" toml:\"cache,omitempty\""; MappedFile uint64 "json:\"mapped_file,omitempty\" yaml:\"mapped_file,omitempty\" toml:\"mapped_file,omitempty\""; TotalInactiveFile uint64 "json:\"total_inactive_file,omitempty\" yaml:\"total_inactive_file,omitempty\" toml:\"total_inactive_file,omitempty\""; Pgpgout uint64 "json:\"pgpgout,omitempty\" yaml:\"pgpgout,omitempty\" toml:\"pgpgout,omitempty\""; Rss uint64 "json:\"rss,omitempty\" yaml:\"rss,omitempty\" toml:\"rss,omitempty\""; TotalMappedFile uint64 "json:\"total_mapped_file,omitempty\" yaml:\"total_mapped_file,omitempty\" toml:\"total_mapped_file,omitempty\""; Writeback uint64 "json:\"writeback,omitempty\" yaml:\"writeback,omitempty\" toml:\"writeback,omitempty\""; Unevictable uint64 "json:\"unevictable,omitempty\" yaml:\"unevictable,omitempty\" toml:\"unevictable,omitempty\""; Pgpgin uint64 "json:\"pgpgin,omitempty\" yaml:\"pgpgin,omitempty\" toml:\"pgpgin,omitempty\""; TotalUnevictable uint64 "json:\"total_unevictable,omitempty\" yaml:\"total_unevictable,omitempty\" toml:\"total_unevictable,omitempty\""; Pgmajfault uint64 "json:\"pgmajfault,omitempty\" yaml:\"pgmajfault,omitempty\" toml:\"pgmajfault,omitempty\""; TotalRss uint64 "json:\"total_rss,omitempty\" yaml:\"total_rss,omitempty\" toml:\"total_rss,omitempty\""; TotalRssHuge uint64 "json:\"total_rss_huge,omitempty\" yaml:\"total_rss_huge,omitempty\" toml:\"total_rss_huge,omitempty\""; TotalWriteback uint64 "json:\"total_writeback,omitempty\" yaml:\"total_writeback,omitempty\" toml:\"total_writeback,omitempty\""; TotalInactiveAnon uint64 "json:\"total_inactive_anon,omitempty\" yaml:\"total_inactive_anon,omitempty\" toml:\"total_inactive_anon,omitempty\""; RssHuge uint64 "json:\"rss_huge,omitempty\" yaml:\"rss_huge,omitempty\" toml:\"rss_huge,omitempty\""; HierarchicalMemoryLimit uint64 "json:\"hierarchical_memory_limit,omitempty\" yaml:\"hierarchical_memory_limit,omitempty\" toml:\"hierarchical_memory_limit,omitempty\""; TotalPgfault uint64 "json:\"total_pgfault,omitempty\" yaml:\"total_pgfault,omitempty\" toml:\"total_pgfault,omitempty\""; TotalActiveFile uint64 "json:\"total_active_file,omitempty\" yaml:\"total_active_file,omitempty\" toml:\"total_active_file,omitempty\""; ActiveAnon uint64 "json:\"active_anon,omitempty\" yaml:\"active_anon,omitempty\" toml:\"active_anon,omitempty\""; TotalActiveAnon uint64 "json:\"total_active_anon,omitempty\" yaml:\"total_active_anon,omitempty\" toml:\"total_active_anon,omitempty\""; TotalPgpgout uint64 "json:\"total_pgpgout,omitempty\" yaml:\"total_pgpgout,omitempty\" toml:\"total_pgpgout,omitempty\""; TotalCache uint64 "json:\"total_cache,omitempty\" yaml:\"total_cache,omitempty\" toml:\"total_cache,omitempty\""; InactiveAnon uint64 "json:\"inactive_anon,omitempty\" yaml:\"inactive_anon,omitempty\" toml:\"inactive_anon,omitempty\""; ActiveFile uint64 "json:\"active_file,omitempty\" yaml:\"active_file,omitempty\" toml:\"active_file,omitempty\""; Pgfault uint64 "json:\"pgfault,omitempty\" yaml:\"pgfault,omitempty\" toml:\"pgfault,omitempty\""; InactiveFile uint64 "json:\"inactive_file,omitempty\" yaml:\"inactive_file,omitempty\" toml:\"inactive_file,omitempty\""; TotalPgpgin uint64 "json:\"total_pgpgin,omitempty\" yaml:\"total_pgpgin,omitempty\" toml:\"total_pgpgin,omitempty\""; HierarchicalMemswLimit uint64 "json:\"hierarchical_memsw_limit,omitempty\" yaml:\"hierarchical_memsw_limit,omitempty\" toml:\"hierarchical_memsw_limit,omitempty\""; Swap uint64 "json:\"swap,omitempty\" yaml:\"swap,omitempty\" toml:\"swap,omitempty\"" } "json:\"stats,omitempty\" yaml:\"stats,omitempty\" toml:\"stats,omitempty\""; MaxUsage uint64 "json:\"max_usage,omitempty\" yaml:\"max_usage,omitempty\" toml:\"max_usage,omitempty\""; Usage uint64 "json:\"usage,omitempty\" yaml:\"usage,omitempty\" toml:\"usage,omitempty\""; Failcnt uint64 "json:\"failcnt,omitempty\" yaml:\"failcnt,omitempty\" toml:\"failcnt,omitempty\""; Limit uint64 "json:\"limit,omitempty\" yaml:\"limit,omitempty\" toml:\"limit,omitempty\""; Commit uint64 "json:\"commitbytes,omitempty\" yaml:\"commitbytes,omitempty\" toml:\"privateworkingset,omitempty\""; CommitPeak uint64 "json:\"commitpeakbytes,omitempty\" yaml:\"commitpeakbytes,omitempty\" toml:\"commitpeakbytes,omitempty\""; PrivateWorkingSet uint64 "json:\"privateworkingset,omitempty\" yaml:\"privateworkingset,omitempty\" toml:\"privateworkingset,omitempty\"" } !#$%&'()*+,-./0123456:;<=>?@ABCDEFHLMNOPSTUYZ["\ ]^_`abcdefghijkmnpqrstuvwy{|}~ # ( + - / : @ P [ ` }!!!<# #?$5$6${%!%%%*%-%<%>%O%T%X%c%d%i%l%m%q%s%t%v%x&;''()) )()?) ){***.*/*0+-+1, ,0, - ---0->-c-k.*.../.0.?._/*/.///i0.00010X0b0n0s0x22255380: :=:]; > ?>??A3A4AMByCNCcCfCoCsE+EBGBGOGTIDIdLTLlLmLoLtLuMBMXMcMeMnMuNONSNdNlNoNuOKONOUOnPBPMPcPdPePfPiPoPsSTScSkSmSoTBTZTeToV1V2V3V5V6V7W/XiYBYiZBZlZpZs[?[[[ [][^" ">""\ \$\'\(\)\*\-\.\/\0\9\?\A\B\D\E\S\U\W\[\"\\\]\^\`\a\b\c\d\f\n\r\s\t\u\v\w\x\z\{\|\}  ­] ]*]:][] ]]__a/aAamb/bwcecrdDdadbdldodseEebedeleneoeqesfFffgbgegngth2hHhchdhshuhzi)iIidifilinipitjajskBkbkmkolLlelhlllmltlwm=mambmqmsmunNneninonsnuoOocokonoporospbpipmqsrRrcrfrirorws s3sSshtbtetotvu0u1u2u3u4u5u6u7u8u9uUuculupusv2v4v=vtwsxXxixtzh{ { {{|0|1||} }}¡¢£¤¥¦§¨©ª«¬®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿŒœŠšŸƒˆ˜͏ΑΒΓΔΕΖΗΘΙΚΛΜΝΞΟΠΡΣΤΥΦΧΨΩαβγδεζηθικλμνξοπρςστυφχψωϑϒϖ - G M P %d ( ) *( - .. < = > m= | !! !--$db%#v%21%23%24%25%26%27%28%29%2A%2B%2C%2F%2b%2c%3A%3B%3D%3F%40%7E%8v%: %s %s,%s.%s ''''"'(.*(?:): * /*/**?[----->-0b-0x...../.eE.js///0 0x.1.11001252.620020420620m304386400404443500625: `:%d://::1:id=2C=3D?()???ACKADDAMPAnyAprAugCPUChiDD;DSADecDirEOFEOLETHEndEtaFDDFPEFebFriGETGNUGT;GetGg;GidGt;HDDHUPHanHexIDEILLINTIf-Im;InfIntJanJulJunKeyLT;LaoLl;Lt;MD5MarMayMonMroMu;NaNNkoNovNu;ODDOFFOctOffOp(Or;OrgPAXPC=PCIPTRPUTPWDPhiPi;Pr;PsiPutRAMREGRSARe;RhoSETSMPSOASRVSSDSUBSatSc;SepSumSunTAGTTLTXTTagTauThuTueURIURLUTCUidVaiViaWedXi;YESYes"'/") """" \22\26\27\28\29\2b\2f\3a\3b\3c\3e\7b\7d\x{ }    ‌‍‎‏]:<]: ]] _ida4babsac;acmaddadxaesaf;ageallaltampandanganyap;askavgavxawsb2bbcebelboxcapcbtccccgochichrcpicpscpucsrcubcudcufcupcurcuucvrdaxdaydchdd;degdevdimdirdl1dmsdnsdsldupeEpec2echecsee;eg;el1el;endenvetaetcethexpfamflnfmafmsforfslfsxftpgE;gaxgbkgc ge;getgg;gidgitgl;go1gp gt;hclhlshpahtshupiamic;ichidxii;il1in;indinfintio.iotip4ip6is1is2is3it;jiskDCkDLkICka1ka3kb2kbskc1kc3kedkelkeykf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kllkmsknpkppkrilE;le;lenlexlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lg;ll;lowlozlpilrmlt;mapmaxmc0mc4mc5mcsmgcmghminmirmlsmp;msgmu;n,,nanncvne;netnewni;nilnotnpcnu;oS;objoffoidor;orcorlpc=pfxphipi;pivplnpm;pr;psiptrrdsregrelreprevrfirhorinrlmrmmrmprs1rs2rs3rssrumrx;samsc;scpscssdbsepsetsgrshysimslmsmmsmssnssqssrcsshssmstssubsumsupswfsystabtagtartautbctcptoptrytsludpuidumluriurlviawafwp;wr;wslxhpxi;xmcxmlxsbyenyesymlzwj} }},µsμs–—‘’‚“”„†‡•…‰′″‹›‾⁄€ℑ℘ℜ™ℵ←↑→↓↔↵⇐⇑⇒⇓⇔∀∂∃∅∇∈∉∋∏∑−∗√∝∞∠∧∨∩∪∫∴∼≅≈≠≡≤≥⊂⊃⊄⊆⊇⊕⊗⊥⋅⌈⌉⌊⌋〈〉◊♠♣♥♦� *) ;; != %s && -> := <== @@ as at fp= in is lr: of on pc= sp: sp= to $cmd$err$max$min$oid$s2$$sum%.6f%02d%02s%02x%07o%TAG%s%s%s()%s: %s} %x ><'\''(.+)(?:)(?P<(?i:("'/) : ) = ) m=* %s*%#v***@*?[\+%s +Inf+inf, n ,opt,rep,req-%s --%s-Inf-bin-inf...`.INF.Inf.NAN.NaN.css.gif.git.htm.inf.jpg.log.nan.pdf.png.ssh.svg.wh..xml/set/tmp01770x%x1.121.191.241.251.351080204831253des9090: p=:443::/0:ext:int:key:pos :=fnrt MB in Value> := dying= flags= len=%d locks= m->g0= nmsys= record s=nil using #3aa3e3#ff0200%03d %s%d days%s %s%s%s %s; %s '%s'%s (%s)%s <%s>%s a %s%s%s { %s, %s.%s,p=%s%s.pack%s: %s %s://%s%s[-%d](%v) %v(?-m:$)(?-s:.)(PANIC=([\w]+)*******, goid=, sys: ,packed,proto3--force--prune/build_/events/nodes//nodes?/tasks//tasks?/update0.0.0.01.19.2219531252.5.4.32.5.4.52.5.4.62.5.4.72.5.4.82.5.4.99765625::1/128:method:mongo::scheme:status:string:taskid; Path=<%s %s> ABORTEDAacute;AbortedAbreve;ActionsAgrave;Assign;Atilde;AvestanBarwed;BengaliBinds: BrailleBumpeq;COMMENTCONNECTCacute;Ccaron;Ccedil;ChanDirCiphersColone;CommentConint;ConvertCookie2CreatedCupCap;CypriotDEBUG: DEFAULTDES-CBCDISCARDDagger;Dcaron;DeseretDotDot;Dstrok;ERROR: EVALSHAEacute;Ecaron;Egrave;ElbasanElementEnabledEntriesEpsilonError: Event: ExhaustExists;ExpiresFAILUREFATAL: ForAll;Found: GODEBUGGammad;Gbreve;Gcedil;GetItemGranthaHARDcy;HEADERSHEREDOCHanunooHstrok;ILLEGALIM UsedIO waitIacute;Igrave;Image: InstAltInstNopIntegerInvalidItilde;JanuaryJsercy;KannadaKcedil;KeyTypeLOG: Lacute;Lambda;Lcaron;Lcedil;Lmidot;Lstrok;MD2-RSAMD5-RSAMONITORManagerMandaicMarchenModTimeMultaniMyanmarNacute;Ncaron;Ncedil;Ntilde;OPTIONSOacute;OctoberOdblac;Ograve;OmicronOslash;OsmanyaOtilde;Otimes;PENDINGPartialPlannedPutItemRFC4122RSGhostRSOtherRacute;RadicalRarrtl;Rcaron;Rcedil;RefererRefreshSHCHcy;SOFTcy;STARTEDSUCCESSSacute;Scaron;Scedil;SharadaShardedShavianSiddhamSignal SinhalaSlaveOKSoyomboSquare;SubjectSubset;SuccessSupset;SwapperTagKeysTagalogTask IdTcaron;Tcedil;TibetanTirhutaTracingTrailerTstrok;TuesdayTypeUrlUNKNOWNUNWATCHUacute;Ubreve;Udblac;Ugrave;UnifiedUnknownUpgradeUpsilonUsage: Utilde;Vdashl;Verbar;VolumesVvdash;WARNINGWarningYacute;Zacute;Zcaron;[="%s"][]float[]int16[]int32[]int64[]uint8[flags]\ )\u%0.4X defer types value=[0;%dm_glitchaacute;abortedabreve;accept4acm-pcaaddressadduseragrave;alefsymalt -> andand;angmsd;angsph;answersany -> any:anyapacir;api.ecrapprox;appsyncarcfourarchiveas_jsonas_yamlatilde;author barvee;barwed;baseurlbdoUxXvbecaus;bernou;bigcap;bigcup;bigvee;bkarow;booleanbottom;bowtie;boxbox;bprime;brvbar;bucket(budgetsbullet;bumpeq;buttonscacute;capand;capcap;capcup;capdot;ccaron;ccedil;charsetcheckedchtimeschunkedcirceq;cirmid;classidclr_bolclr_eolclr_eoscmdlinecolone;colornmcolspancolumnscommandcommat;commentcompfn;complexconint;connectconsolecontentcoprod;copysr;cp51932createdcs cularr;cupcap;cupcup;cupdot;curarr;curren;currentcursorscylcty;dagger;daleth;dcaron;defaultdeletesdestroydevel +dfisht;dirnamedirsyncdiscorddivide;divonx;dlcorn;dlcrop;dollar;drcorn;drcrop;dstrok;eacute;easter;eax ebp ebx ecaron;ecolon;ecx edi edx efgEFGveflags egrave;egsdot;eip elapsedelsdot;emptyv;emsp13;emsp14;ena_acsenctypeeparsl;epsiloneqcirc;equals;equest;errcodeerrs<1herrs<1mesi esp ethtoolexpiresfailurefemale;ffilig;ffllig;fields.filtersfinallyfixed64float32float64forall;frac12;frac13;frac14;frac15;frac16;frac18;frac23;frac25;frac34;frac35;frac38;frac45;frac56;frac58;frac78;fs gacute;gammad;gatewaygbreve;gctracegesdot;gesles;getMoregit/1.0glaciergs gtlPar;gtrarr;gtrdot;gtrsim;hairsp;hamilt;hardcy;headershearts;hellip;hercon;homtht;horbar;hslash;hstrok;http://hybull;hyphen;iacute;igrave;iiiint;iinfin;illegalincare;indexesinodot;intcal;integerinvalidipSliceiquest;isinsv;iso8601itilde;jsercy;kappav;kcedil;key of key_begkey_eickey_endkey_eolkey_eoskey_f10key_f11key_f12key_f13key_f14key_f15key_f16key_f17key_f18key_f19key_f20key_f21key_f22key_f23key_f24key_f25key_f26key_f27key_f28key_f29key_f30key_f31key_f32key_f33key_f34key_f35key_f36key_f37key_f38key_f39key_f40key_f41key_f42key_f43key_f44key_f45key_f46key_f47key_f48key_f49key_f50key_f51key_f52key_f53key_f54key_f55key_f56key_f57key_f58key_f59key_f60key_f61key_f62key_f63key_sdckey_sdlkey_sickeytypekgreen;kinesiskthxbailAtail;lab_f10lacute;lagran;lambda;langle;larrfs;larrhk;larrlp;larrpl;larrtl;latail;lbrace;lbrack;lcaron;lcedil;ldquor;lesdot;lesges;lfisht;lfloor;lharul;libvirtliteralllhard;lmidot;lmoust;lookup loplus;lowast;lowbar;lparlt;lrhard;lsaquo;lsquor;lstrok;lthree;ltimes;ltlarr;ltrPar;managermapsto;marker;max keymax-agemaxScanmcomma;memlockmeta_onmidast;midcir;middot;min keyminsizeminusb;minusd;mnplus;models;modulesmonitormstpos;my_tasknVDash;nVdash;nacute;nbumpe;ncaron;ncedil;nearestnearhk;neptunenequiv;nesear;newlinenexist;nil cfgnil keynistp%dnltrie;no-donenoatimenode_idnop -> nosniffnotinE;nparsl;nprcue;nrarrc;nrarrw;nrtrie;nsccue;nsimeq;nsuµmhntilde;number numero;nvDash;nvHarr;nvdash;nvlArr;nvrArr;nwarhk;nwnear;oacute;objectsodblac;odsold;offlineograve;omicronominus;optimumorderedorigof;oslash;otilde;otimes;pack-%spanic: parsim;pathAllpathAnypatternpayloadpercnt;period;permil;phmmat;planck;plankv;plannedplusdo;plusdu;plusmn;preceq;preloadpricingprimaryprimes;printlnprivateprnsim;productprofileprojectpropto;prtr_onprurel;pty-reqpubdatepuncsp;qprime;rAtail;racute;rangle;rarrap;rarrfs;rarrhk;rarrlp;rarrpl;rarrtl;ratail;rbrace;rbrack;rcaron;rcedil;rdquor;recvmsgrefererrefreshrefs/%sremountreverserfisht;rfloor;rharul;rmoust;roplus;rounds=route53rowspanrpargt;rsaquo;rsharedrsquor;rthree;rtimes;rtracedrunningsacute;sandboxscaron;scedil;scnsim;searhk;sendmsgserial:sessionseswar;set_tabsfrown;shallowshchcy;sigmaf;sigmav;signal simdot;slengthsmashp;softcy;solbar;sort_byspades;span %ssqcaps;sqcups;sqsube;sqsupe;square;squarf;srclangssetmn;ssh-dssssh-rsasshtypessmile;sstarf;stoppedstoragestringssubdot;subset;subsim;subsub;subsup;succeq;successsupdot;supportsupset;supsim;supsub;supsup;swarhk;swnwar;symlinksyscalltaggingtar.bz2target;task_%vtcaron;tcedil;telrec;there4;thetav;thinsp;thksim;timeouttimesb;timesd;topbot;topcir;tprime;trailertridot;tstrok;type %quacute;ubreve;udblac;ufisht;ugrave;uintptrulcorn;ulcrop;ulimitsunavailunknownupdatesupgradeupsilonurcorn;urcrop;useraddusermodutilde;vagrantvangrt;varphi;varrho;veebar;vellip;verbar;versionvsubnE;vsubne;vsupnE;vsupne;waitingwarningweb.urlwedbar;wedgeq;weierp;weightswreath;writeatxoplus;xotime;xsqcup;xuplus;xwedge;yacute;zacute;zcaron;zeetrf;{%v %v}{{end}}|CREATE|REMOVE|RENAME *) ;; esac Error: [flags] data=%q etypes export goalΔ= helpgc= incr=%v is not mcount= minutes nalloc= newval= nfreed= ping=%q pointer stack=[ status xmlns="$HOME/%s$comment$maxScan$orderby%!Month(%.10q...%.20s...%=|%>|%<%c%c %s %d hours%d weeks%d years%d/%d %s%k.%n %v%s %s %s%s -> %s%s <%s> %s = %s %s in %q%s%s%s%s%s&#x%x;%s/v%s%s%s: %s %s:%d:%d%s|%s|%s�', got: (%d, %d)([0-9]+)(struct , idle: --target/(\d*)\z/* %v *//attach?/changes/commit?/connect/disable/enable?/etc/ssh/gid_map/history/images//plugins/resize?/uid_map/update?/version012345671 second2.5.4.102.5.4.112.5.4.172006-1-2201904043des-cbc48828125; SecureAMQPLAINAcceptedArmenianBalineseBecause;BopomofoBugineseCLICOLORCRITICALCall of CanceledCayleys;Cconint;Cedilla;CherokeeConfig: ConflictContinueCyrillicDEK-InfoDNS nameDSA-SHA1DataLossDataTypeDecemberDevmajorDevminorDiamond;DocumentDomain%dDownTee;DuployanDurationElement;Epsilon;EthiopicExtenderFebruaryGeorgianGujaratiGurmukhiHTTP/1.1HTTP/2.0HiraganaHostnameINTERNALIf-MatchIf-RangeImplies;InfinityInstFailInstRuneIntMode(InternalJavaneseKatakanaKayah_LiKeyGroupLC_CTYPELeftTee;Linear_ALinear_BLinknameLocationLogLevelMahajaniNO_ERRORNO_PROXYNewLine;NoBreak;NotFoundNotLess;NovemberOPTIONALOP_QUERYOP_REPLYOl_ChikiOmicron;OpenSSH_OverBar;PRIORITYParseIntPhags_PaPipelinePriorityProdFipsProduct;ProtocolQuestionQueueUrlRECEIVEDREQUIREDReadNullReceivedReservedSETTINGSSHA1-RSASHUTDOWNSaturdayScan: %vSendTaskStat: %vStatus: TERMINFOTagQueueTagbanwaTai_ThamTai_VietThursdayTifinaghTopLevelTrailer:UgariticUpArrow;Uparrow;Upsilon;ZgotmplZ[ INFO] [ WARN] [%d, %d][%s>%s] [::1]:53[:word:][ERROR] [FATAL] [TRACE] []string[]uint16[]uint32[]uint64[signal "%s": %v\n\r?\n$ ----- 

 gpgsig --%s stack=[^(\d{3})_%s() { _filediracs_bteeacs_lteeacs_plusacs_rteeacs_tteeaddress alefsym;all timeangrtvb;angzarr;artefactasympeq;autoplayback_tabbacksim;bad instbeEfFgGvbecause;bemptyv;between;bigcirc;bigodot;bigstar;bnequiv;boundaryboxplus;bytesHexccupssm;cemptyv;cgocheckchardatacirscir;cloudhsmcodebasecodestarcoloneq;congdot;consumercontainscontinuecontrolscudarrl;cudarrr;cularrp;curarrm;danglingdatasyncdatetimedbkarow;ddagger;ddotseq;debugcpudefault:defaultsdemptyv;diamond;digamma;diratimedisableddistTmpldistinctdotplus;dropzonedurationdwangle;dynamodbelement(encodingend_timeepsilon;eqcolon;equivDD;errs<10herrs<10merrs<10sfc00::/7filenamefirehosefont/otffont/ttffrom: %sgameliftgesdoto;getnoncego1.11.5gtquest;gtrless;harrcir;have %s hijackedhost keyhostnamehreflanghttp/1.1https://identityif-matchif-rangeinfinityintSliceinternalintprod;invalid isMasterisindot;key_btabkey_copykey_ctabkey_downkey_exitkey_findkey_helpkey_homekey_leftkey_markkey_movekey_nextkey_openkey_redokey_savekey_sbegkey_sendkey_seolkey_stabkey_undolabel_onlanguagelarrbfs;larrsim;lbrksld;lbrkslu;ldrdhar;lesdoto;lessdot;lessgtr;lesssim;linkpathlocationlongdescloopbacklotimes;lozenge;ltquest;luruhar;majoritymaltese;manifestmemstatsmeta_offmethod 'micro_upminusdu;msgqueuemultiplenameOnlynapprox;natural;nearrow;nexists;nistp256nistp384nistp521no anodeno errorno-cacheno_proxynot_nullnotinva;notinvb;notinvc;notniva;notnivb;notnivc;npolint;npreceq;nsqsube;nsqsupe;nsubset;nsucceq;nsupset;nvinfin;nvltrie;nvrtrie;nwarrow;objectIDolcross;omicron;opPseudoopsworksorderof;orslope;owner_idpad_charparm_dchparm_ichpasswordpathListpertenk;pinpointpipelinepkey_keyplanckh;pluscir;plussim;plustwo;precsim;producerprofilesprotobufprtr_nonprtr_offquatint;questeq;rarrbfs;rarrsim;raw-readrbrksld;rbrkslu;rdldhar;readfromreadlinkreadonlyrealine;recv: %vrecvfromredshiftref: %s registerrelatimerequiredresourcereversedrotimes;rprivateruluhar;runnableruntime.scavengeseamlesssearrow;selectedsendfilesent: %vsetcolorshow_allshutdownsignal: simplus;simrarr;snapshotsnowballstrconv.strengthsubedot;submult;subplus;subrarr;succsim;supdsub;supedot;suphsol;suphsub;suplarr;supmult;supplus;swarrow;tabindextailabletask_logtemplatetextareathetasymtimeout:tmp_obj_to_arraytopfork;trailerstransfertree %s triplus;tritime;truncateunixgramunknown(uparrow;upsertedupsilon;urlPart(urlqueryusernameuwangle;vzigzag;want %s warning:web.portworkdocsworkmailworktreewtimeoutxon_xoffzigrarr;{region}{{else}} (forced) as type blocked= defersc= in use) lockedg= lockedm= m->curg= ms cpu, not in [ of type runtime= s.limit= s.state= sigcode= threads= u_a/u_g=#ZgotmplZ$argon2i$$external$snapshot%!(EXTRA %5d:%3d: %P([A-z])%\?(.*?);%c%s %s%s%d months%g([A-z])%s %s%s %s %s^{} %s%d.%09d%s:%d: %s(MISSING)(unknown)+infinity, newval=, oldval=-%s, --%s--master -07:00:00-Infinity-infinity./storage.terminfo/* %v */ /* nil *//bin/bash/build?%s/configs//configs?/dev/null/networks/plugins//secrets//secrets?/vagrant//volumes//volumes?0.0000001127.0.0.12001::/322002::/162441406253ffe::/16: inuse: : status=; Domain=side-bandsignal 32signal 33signal 34signal 35signal 36signal 37signal 38signal 39signal 40signal 41signal 42signal 43signal 44signal 45signal 46signal 47signal 48signal 49signal 50signal 51signal 52signal 53signal 54signal 55signal 56signal 57signal 58signal 59signal 60signal 61signal 62signal 63signal 64slack: %sslack: %vsmeparsl;span.kindsqsubset;sqsupset;stop iterstorageidstructuresubmodulesubseteq;subsystemsucceededsuccneqq;succnsim;supseteq;thetasym;thicksim;thin-packtime.Timetimesbar;timestamptmp_pack_to_numberto_stringtranslatetriangle;trimSpacetriminus;trpezium;two_word_txnNumberuintSliceulcorner;undefinedunderflowunhandledunix.sockurcorner;urn:uuid:us-east-1us-east-2us-west-1us-west-2varkappa;varsigma;vartheta;video/avivideo/mp4wait_tonewarnings:x-expires{"$code":{service}} stack=[ %s) --%s (virtual) MB goal, actualΔ= but have gfreecnt= pages at returned runqsize= runqueue= s.base()= spinning= stopwait= stream=%d sweepgen sweepgen= targetpc= throwing= until pc=!! Error: $maxTimeMS$returnKey%!(NOVERB)%!Weekday(%&|%\||%\^%d minutes%d seconds%d.%d.%d%s%s - %s:%s%s%s = %s ¶
(BADINDEX)(from %s) - AMQP: %s--profile --provider./artefact.gitignore.localhost.mottainai/api/nodes/api/stats/api/tasks/api/token/artefact//dev/stdin/etc/group/etc/hosts/info/refs/networks//networks?/rename?%s/services//services?/setgroups/system/df012345678912207031252006 -07002006-01-026103515625: parsing :authority; Expires=; HttpOnly; Max-Age=; SameSite>> NODE <runtime: gs3-controlschedtracesemacquireset-cookieset_windowsetsockoptshort readshow_taskssigpendingskipping: socks bindspadesuit;span %s %qspellcheckssh-configssh_configstart_timestream endsubseteqq;subsetneq;supseteqq;supsetneq;task show terminatedtext/plaintherefore;topic.nametracefree(tracegc() triangleq;unbindableunixpacketunknown pcunpack %s unpacking unusedKeysupdateUseruser-agentvalue for varpropto;video/webmvirtualboxvisibilityvol-deletewill retryworkspaces{"$%s":%s} '%d: :%s' -%s, --%s level%d) of size (targetpc= ErrCode=%v bytes ... gcwaiting= gp.status= heap_live= idleprocs= in status m->mcache= mallocing= ms clock, p->mcache= p->status= s.nelems= schedtick= span.list=%!(BADPREC)%d.%d.%d.%d%s:%s:%d:%s%{([0-9]+)}, known: %v, settings:,"$scope":{--exec-path./namespace.gitmodules/debug/vars/dev/stderr/dev/stdout/disconnect/etc/passwd/index.html/swarm/init/swarm/join0123456789.02 Jan 200630517578125: frame.sp=; Max-Age=0> in space ?ps_args=%s@cjk_narrowAES-128-CBCAES-192-CBCAES-256-CBCBad GatewayBad RequestBernoullis;BinaryHeap CERTIFICATECheckHostIPCirclePlus;CompressionContent-Md5Cookie.PathCreateQueueCreateTableDeleteQueueDeleteTableENABLE_PUSHEND_HEADERSEU (London)Edit a userElementModeEqualTilde;Etcd Path: Fouriertrf;GNU.sparse.GODEBUGCPU=GOTRACEBACKGetQueueUrlHOSTALIASESHTTPS_PROXYIdeographicImaginaryI;In-Reply-ToInformationInstCaptureInstRuneAnyInstructionLOCALDOMAINLaplacetrf;LeftVector;List tokensListBackupsLleftarrow;MACARON_ENVMarshalBSONMessageBodyNew_Tai_LueNotElement;NotGreater;OP_GET_MOREOUTPUT_ONLYOld_PersianOplogReplayPRIVATE KEYPau_Cin_HauProcessed: Proportion;QueryFilterRES_OPTIONSRSSecondaryRaw contentReadBooleanReadElementResourceArnRetry-AfterReturn-PathRightArrow;RightFloor;Rightarrow;SCRAM-SHA-1SendMessageShow a nodeShow a planShow a taskSignWritingSlackConfigSoft_DottedStop a taskTTL expiredTYPE_DOUBLETYPE_SINT32TYPE_SINT64TYPE_STRINGTYPE_UINT32TYPE_UINT64TagResourceTargetValueThickSpace;TildeEqual;TildeTilde;UNAVAILABLEUNSUPPORTEDUnavailableUnderBrace;UnknownModeUpArrowBar;UpTeeArrow;UpdateTableUseKeychainVagrantfileWarang_CitiWhite_SpaceWriteDoubleWriteMaxKeyWriteMinKeyWriteStringWriteSymbolX-Amz-Crc32[%s:%d %s] [:^xdigit:][Download] "CANCELLED""DATA_LOSS""NOT_FOUND" committer 

^([^:]+)://^\r?\n\r?\n_MSpanInUse__anonymous_eval_args__filedir -daccess_typeadditionalsalarm clockapi.pricingapplicationaudio/basicauthoritiesautoscalingbad addressbad messagebad timedivbad verb '%box_chars_1broken pipebroker.passbroker.typebroker.userbson.Array[bytesBase64cache_cleancache_imagecall of nilcgocall nilcircledast;cloudsearchclusterTimecognito-idpcolor_namescommentCharcomplement;compressionconf is nilcontextmenucreate_plancreated by crossorigincurlywedge;cursor_downcursor_homecursor_leftcustomtype=define_chardelete-refsdelete_linedelete_taskdevelopmentdevice_typedropIndexesec2metadataecdsa-sha2-elasticacheelement of empty fieldempty inputen_US.UTF-8endSessionsenvironmenteqslantgtr;erase_charserrorLabelsetcd-configexecute-apiexit-signalexit-statusexit_statusexpected :=file existsfinal tokenfixed_pausefloat32nan2float64nan2float64nan3formenctypegccheckmarkgeneralizedgitdir: %s goto_windowgroup.tasksgrpc-statusgtreqqless;hard_cursorhash type: http-serverhttp.methodhttp.statushttps_proxyi/o timeoutin array %sinclude-taginsert_linejson.Numberkey_commandkey_messagekey_optionskey_refreshkey_replacekey_restartkey_scancelkey_screatekey_suspendkeypad_xmitkillCursorslabel_widthlast minutelessapprox;lesseqqgtr;listIndexeslmoustache;local errorlongmapsto;lost mcachemapping endmapstodown;mapstoleft;maxVariablememory_lockmethodargs(micro_rightnLeftarrow;nil contextnleftarrow;no-progressno_esc_ctlcno_pad_charnot allowednot reachednot_creatednsubseteqq;nsupseteqq;oplogReplayopsworks-cmorig_colorsout of syncover_strikepacked-refsparm_rindexpassthroughplaceholderplan_deleteprecapprox;projects/%sprtr_silentpush_configraw-controlreadConcernreflect.Setrefs/heads/refs/notes/rekognitionremove_pathrepeat_charresumeAfterretry-afterrightarrow;rmoustache;round_robinrow_addressrunbindableruntime.lexsave_cursorscheddetailsecurityhubset_managersetnonblockshallow %s short writesingleBatchsqsubseteq;sqsupseteq;ssh-ed25519stack faultstack tracestarts_withstddurationstrictatimestringArraystringSlicestringToIntsubsetneqq;succapprox;supsetneqq;tail_outputtarget_repotime: file tls: alert(tokType(%d)tracealloc(treeNoder gsignal= minTrigger= pages/byte preemptoff= s.elemsize= s.sweepgen= span.limit= span.state= sysmonwait=$clusterTime$showDiskLoc%!(BADWIDTH)%s/%s/%s.yml%svalue: %s %v is not %v' in struct ) p->status=, consumed: , received: , released: , variable ","options":"- Broker: %s-%s %d-%d %s-byte limit .wh..wh..opq/api/webhook/containers//dev/urandom/images/get?/images/load100-continue127.0.0.1:53152587890625762939453125> Removing: > but have anynotnl -> array is nilarrayFiltersauthenticateautocompletebackepsilon;bad Pq valuebad Ta valuebad Tc valuebad Td valuebad Th valuebad Tq valuebad g statusbad recoveryblacksquare;block clauseboolca-central-1caller errorcan't happencannot find capabilitiescas64 failedchan receivechar_paddingchild exitedcircledcirc;circleddash;clear_screenclone a taskclose notifyclosed by float64font/collectionforce gc (idle)forwarded-tcpipgeneral.logfilegeneral.tls_keygit-upload-packgo-dockerclientgoogle.api.Httpgoogle.api.httphas_print_wheelhas_status_linehash function: hookrightarrow;html/template: http-basic-authinitialize_pairinvalid booleaninvalid cstringinvalid key: %sinvalid paddinginvalid pointerinvalid requestkey has expiredlastErrorObjectleftleftarrows;leftrightarrow;leftthreetimes;libvirt_executelibvirt_vagrantlicense-managerlines_of_memorylistCollectionslocationNameKeylongrightarrow;looparrowright;lpi_changes_resmachinelearningmalloc deadlockmaximum_windowsmicro_line_sizemissing addressmissing mcache?mobileanalyticsmobiletargetingms: gomaxprocs=mturk-requestermultipart/mixedmust-revalidatenegative offsetnegative updatenetwork is downno dot in fieldno medium foundno such processnoCursorTimeoutnon-minimal tagnot a directorynot implementednshortparallel;ntriangleright;numericOrderingoutput_res_charoutput_res_lineparm_down_microparm_left_micropc_term_optionspipeline_deletepkt-line %d: %spremature flushreader is emptyrecord overflowrecovery failedrefs/remotes/%sremote-config: resource-groupsrightarrowtail;rightharpoonup;route53resolverrow_addr_glitchruntime error: runtime.gopanicruntime: frame scan missed a gscancode_escapeselect_char_setserver finishedset_left_marginset_page_lengthssh: short readstart_bit_imagestartm: m has pstopm holding ptemplate clausetext/ecmascripttext/javascripttext/livescripttimestampFormattrianglelefteq;unclosed actionunclosed stringunexpected typeunknown Go typeunknown versionunmarshal errorupdate_pipelineupdatedExistingupharpoonright;windowAdjustMsgwrite error: %vwrite errors: [{{template %q}}~/.ssh/identity commands=() - Exchange: %s already; errno= artefacts from has nil element mheap.sweepgen= not in ranges: untyped locals !! Task timeout!$%s$rounds=%d$%s$bcrypt-sha256$2$rounds=%d$%s$%s%\+|%-|%\*|%/|%m%d overflows int%s %s HTTP/1.1 %s %s%chost=%s%c%s overflows int%s caused by: %s+-/0123456789.eE, Last error: %s, not a function. Reason was: %v/api/user/create/api/webhook/set/configs/create?/etc/resolv.conf/networks/create/networks/prune?/plugins/create?/secrets/create?0123456789ABCDEF0123456789abcdef2384185791015625: value of type :VerifyDNSLength> in name space >>> WARNING! <<elasticbeanstalkelasticmapreduceenter_blink_modeenter_micro_modeerase_overstrikeexit_delete_modeexit_insert_modeexit_shadow_modeexit_upward_modeexpected integerexpected newlinefb4h3bhgv4421355from_status_linegc: unswept spangcshrinkstackoffgeneral.loglevelgeneral.tls_certgit-receive-packglobalRequestMsggnu_has_meta_keyhash function %vhost unreachablehostLookupOrder=http_client_hosthttp_client_pathindex %s..%s %o initialize_colorinsert_characterinteger overflowinvalid Order=%vinvalid URL pathinvalid argumentinvalid checksuminvalid code: %qinvalid encodinginvalid endpointinvalid exchangeinvalid hash: %sinvalid passwordinvalid rune %#Uinvalid spdelta kinesisanalyticslast_update_timeleftharpoondown;leftrightarrows;length too largelocationNameListmalformed ACK %qmalformed changemessage too longmissing stackmapmove_insert_modenLeftrightarrow;nil *http.Servernleftrightarrow;no colon on lineno renegotiationno route to hostno such flag -%vnon-Go function non-IPv4 addressnon-IPv6 addressnot seek supportntrianglelefteq;object is remoteobject not foundopencensus-go/%spacer: H_m_prev=parm_delete_lineparm_down_cursorparm_insert_lineparm_left_cursorparm_right_micropipeline_as_yamlprimaryPreferredproto: bad UTF-8proxy-connectionquoted-printablereflect mismatchregexp: Compile(remote I/O errorremote not foundrightleftarrows;rightsquigarrow;rightthreetimes;round trip errorruntime.sigpanicruntime: g: g=runtime: gp: gp=runtime: nelems=s3.amazonaws.comschedule: in cgoserver error: %sserver is closedserviceAcceptMsgservicediscoveryset_a_attributesset_a_backgroundset_a_foregroundset_right_marginsha256-crypt(%d)sha512-crypt(%d)short response: shouldn't happensigaction failedssh: MAC failurestartTransactionstopped (signal)straightepsilon;streams.dynamodbtemplate: %s: %stextIndexVersiontime: bad [0-9]*timeout exceededtoo many symbolstrianglerighteq;unclosed commentunexpected flushunexpected tokenunexpected type unknown cipher: unknown event %dunknown network unknown node: %sunmarshall errorunpack error: %sunpacking headerunsupported modeunsupported typevalue size wrongvartriangleleft;virtual_terminalweb.access_tokenweb.github_tokenworkbuf is emptywww-authenticateyaml_ALIAS_TOKENyaml_VALUE_TOKEN flags+=("--%s (DEPRECATED: %s) after object key has been created initialHeapLive= is unimplemented spinningthreads=%%!%c(big.Int=%s)%3d: t=%3d start %d overflows int8%d overflows uint%s with parent %s%s: executing: %v(.+)\[(-?\d+)?\]$, Average RTT: %d- CustomQueue: %s.config/mottainai/.ssh/known_hosts/api/storage/list/api/tasks/append/api/tasks/update/api/token/create/containers/json?/services/create?0123456789ABCDEFX0123456789abcdefx060102150405Z07001192092895507812559604644775390625: missing method ; SameSite=Strict> Build started! > Pre-Executing: AWS GovCloud (US)BatchGetItemInputBinaryDecodeValueBinaryEncodeValueCOMPRESSION_ERRORCleanup containerCodeWithScopeModeCreate a new nodeCreate a new taskCreateBackupInputCreateGlobalTableDEADLINE_EXCEEDEDDeleteBackupInputDescribeEndpointsDiacriticalAcute;DiacriticalGrave;DiacriticalTilde;DoubleRightArrow;DownArrowUpArrow;ENHANCE_YOUR_CALMERR access deniedEVENT_TYPE_CANCELEmail of the userEmptySmallSquare;Entrypoint scriptEnvSecretNotFoundError code %d: %sExclusiveStartKeyFailed DependencyForwardX11TimeoutForwardX11TrustedGC assist markingGreaterEqualLess;GreaterFullEqual;HEADER_TABLE_SIZEHTTP_1_1_REQUIREDHostKeyAlgorithmsHostbasedKeyTypesIf-Modified-SinceKeysAndAttributesLeftAngleBracket;LeftUpDownVector;LessEqualGreater;Manage namespacesMaxKeyDecodeValueMaxKeyEncodeValueMessageAttributesMinKeyDecodeValueMinKeyEncodeValueMottainai API keyMoved PermanentlyNo such service: No termname givenNonBreakingSpace;NotPrecedesEqual;NotRightTriangle;NotSucceedsEqual;NotSucceedsTilde;NotSupersetEqual;Old_North_ArabianOld_South_ArabianOpenFile '%s': %vOther_ID_ContinuePERMISSION_DENIEDRSAAuthenticationReadCapacityUnitsReadCodeWithScopeReadFile '%s': %vRemove a pipelineResourceExhaustedRightTriangleBar;RightUpTeeVector;RightUpVectorBar;SIGBUS: bus errorSIGCONT: continueSIGINT: interruptSentence_TerminalStringDecodeValueStringEncodeValueSymbolEncodeValueTLS_FALLBACK_SCSVTRANSIENT_FAILURETable.TableStatusToo Many RequestsTransactWriteItemTransfer-EncodingUnderParenthesis;Unified_IdeographUnknown state: %sUpArrowDownArrow;UpdateGlobalTableUsePrivilegedPortValidate ResponseVisibilityTimeoutWriteArrayElementX-Amz-Copy-SourceX-Amz-Grant-WriteX-Registry-Config","$id":{"$oid":""UNAUTHENTICATED"agent.concurrencyagent.docker_capsall_artefact_listallocator[%d..%d]application/grpc+auto_right_marginautoscaling-plansaws-us-gov-globalbad TinySizeClassbad character %#Ubad snapshot namebcrypt-sha256(%d)bit_image_newlinebogus greeting %qbson.Value.Binarybson.Value.Doublebson.Value.MaxKeybson.Value.MinKeybson.Value.Symbolcan't scan type: change_char_pitchchange_line_pitchchannelRequestMsgcirclearrowright;clone a namespaceclosing input: %scommand_charactercommitTransactioncomprehendmedicalconfig.vm.box = "connection closedconnection(%s) %scorrupt zip file decryption faileddownharpoonright;duplicated tableselasticfilesystemelastictranscoderelement not foundembedded documententer_delete_modeenter_insert_modeenter_low_hl_modeenter_secure_modeenter_shadow_modeenter_top_hl_modeenter_upward_modeentersyscallblockexec format errorexec: not startedexit_italics_modeexpecting a valueexponent overflowfractional secondframe %d is emptyfutexwakeup addr=google.rpc.Statusgp.waiting != nilgroup.concurrencygrpc-message-typehandshake failurehas_hardware_tabshttp: nil handlerhttp_server_routeiam.amazonaws.comif-modified-sinceillegal Pos valueillegal characterillegal hex digitillegal parameterin string literalindex > windowEndinteger too largeinvalid .pem fileinvalid bit size invalid stream IDinvalid-referencekey align too biglanguage_overridelocationNameValuelocked m0 woke upmalformed commandmark - bad statusmarkBits overflowmax_micro_addressmicro_row_addressmissing closing )missing closing ]missing end quotemissing form bodynew file mode %o nextId too large:nil resource bodyno data availableno rune to unwindnotetsleepg on g0ntrianglerighteq;padding_baud_rateparm_right_cursorparsing error: %spermission deniedpool is connectedpublic key type: queue.{dnsSuffix}reflect.Value.Capreflect.Value.Intreflect.Value.Lenreflect: New(nil)reflect: call of refs/heads/masterresource shortagerightharpoondown;rightrightarrows;rotateWorkerTokenruntime.panicwrapruntime.sagemakerruntime: nameOff runtime: next_gc=runtime: pointer runtime: textOff runtime: typeOff scanobject n == 0sdb.amazonaws.comseeker can't seekselect (no cases)serviceRequestMsgsetParent to selfset_bottom_marginstack: frame={sp:stop_char_set_defsts.amazonaws.comsubscription.namesystem.namespacestable field %q %stext/x-ecmascripttext/x-javascriptthread exhaustiontimestamptk="", tgt[%s]=%vtoo many operandstoo many requeststransfer-encodingtruncated headerstwoheadleftarrow;unexpected state unknown caller pcunknown error: %sunknown extensionunknown reason %dunknown type: %T vartriangleright;version-installedwaf.amazonaws.comwait for GC cycleweb.github_secretweb.listenaddressweb.node_deadlineweb.task_deadlineweb.template_pathweb.webhook_tokenwidth_status_linewriteConcernErrorwrong medium typex-goog-api-clientyaml_ANCHOR_TOKENyaml_SCALAR_TOKEN - BindingKey: %s but memory size dev: %d ino: %d uid: %d gid: %d because dotdotdot to non-Go memory unknown type: %T $s2$%d$%d$%d$%s$%s%d overflows int16%d overflows int32%d overflows int64%d overflows uint8%d, %f, %d, %d, %v%g overflows int64%s_chord_triggered, locked to thread- DefaultQueue: %s--machine-readable/api/tasks/planned/api/user/edit/:id/api/user/show/:id/containers/prune?/etc/nsswitch.conf/etc/openssl/certs/etc/pki/tls/certs/exec/%s/resize?%s298023223876953125404 page not found: day out of range> Box in machine: >> Pulling image: ACTION_UNSPECIFIEDAPI error (%d): %sAborting executionAddPermissionInputAutoScalingRoleArnBooleanDecodeValueBooleanEncodeValueCNAMEResource bodyCaucasian_AlbanianClientRequestTokenComparisonOperatorConnectionAttemptsContext BuildDir: Create a namespaceCreate a new tokenDelete a namespaceDeleteMessageBatchDeleteMessageInputDescribeTableInputDescribeTimeToLiveDoubleUpDownArrow;DoubleVerticalBar;DownLeftTeeVector;DownLeftVectorBar;EVENT_TYPE_UNKNOWNEnd-to-end latencyExited (%d) %s agoExpectation FailedFLOW_CONTROL_ERRORFailedPreconditionFieldOptions_CTypeFilledSmallSquare;GetQueueAttributesGo-http-client/1.1Go-http-client/2.0GreaterSlantEqual;Invalid master urlInvalidEndpointURLLeftDoubleBracket;LeftDownTeeVector;LeftDownVectorBar;LeftTriangleEqual;Less than a secondListQueueTagsInputListTagsOfResourceMalformed IDX fileMethod Not AllowedNegativeThinSpace;NotGreaterGreater;NotLessSlantEqual;NotNestedLessLess;NotReverseElement;NotSquareSuperset;NotTildeFullEqual;ParamMinValueErrorParamRequiredErrorPermanent RedirectPermitLocalCommandProviderNotExpirerProxy-AuthenticateRESOURCE_EXHAUSTEDRFS specific errorRegional_IndicatorRightAngleBracket;RightUpDownVector;SRVResource.TargetSerializationErrorSetQueueAttributesShow log of a taskSquareSubsetEqual;Subchannel CreatedSubchannel DeletedTemporary RedirectTransactWriteItemsType: %s Servers: UNKNOWN_SETTING_%dUnexpected token: Unknown AST node: Unknown token: %+vUnmarshal ResponseUnmarshalBSONValueUnsuported versionUntagResourceInputUserKnownHostsFileVariation_SelectorVerticalSeparator;WriteCapacityUnitsWriteCodeWithScope[Download] Error: [^\x00-\x{10FFFF}]"INVALID_ARGUMENT"agent.lxd_endpointagent.lxd_profilesalready up-to-dateappendIfNotPresentapplication/x-gziparguments requiredbackspaces_with_bsbad Content-Lengthbad manualFreeListblacktriangledown;blacktriangleleft;box already existsbroker.binding_keybson.Value.Booleanbufio: buffer fullchain.tasks.lengthcircular referenceconnection is deadconnection is idleconnection refusedconnection(%s): %sconnection.blockedcontext.Backgroundcursor_mem_addressdecoding error: %vdestination existseat_newline_glitchecdh-sha2-nistp256ecdh-sha2-nistp384ecdh-sha2-nistp521empty Huffman treeempty key providedenter_italics_modeenter_left_hl_modeenter_reverse_modeexit_leftward_modeexit_scancode_modeexit_standout_modeexpansion too deepexpected element atomicstatus=, gp->atomicstatus=- ResultBackend: %s-r -s /bin/false %s/api/namespace/list/api/nodes/register/api/nodes/show/:id/api/storage/upload/api/tasks/:id.yaml/api/tasks/pipeline/api/tasks/plan/:id/api/tasks/stop/:id/containers/%s/copy/containers/%s/exec/containers/create?/srv/mottainai/lock/srv/mottainai/lxc//usr/lib/locale/TZ/02 Jan 06 15:04 MST14901161193847656252006-01-02 15:04:052006-01-02T15:04:0520060102150405Z07007450580596923828125AttributeDefinitionBad hex digit in %qBatchWriteItemInputCanadian_AboriginalCanonicalizeMaxDotsCiphertext is emptyClearAllForwardingsCodeWithScopeSpacerConditionExpressionConnection: close Content-DescriptionContent-DispositionContent-Length: 0 Context SourceDir: CreateReplicaActionDateTimeDecodeValueDateTimeEncodeValueDeleteReplicaActionDescribeBackupInputDescribeGlobalTableDocumentDecodeValueDocumentEncodeValueDownRightTeeVector;DownRightVectorBar;ExtensionRangeArrayFAILED_PRECONDITIONFieldOptions_JSTypeIDEMPOTENCY_UNKNOWNIDS_Binary_OperatorINADEQUATE_SECURITYINITIAL_WINDOW_SIZEIf-Unmodified-SinceJan _2 15:04:05.000LOGIN:%sPASSWORD:%sLocalSecondaryIndexLongLeftRightArrow;Longleftrightarrow;MSpan_Sweep: state=Manage CLI ProfilesMisdirected RequestNegativeThickSpace;No such container: No such network: %sNotLeftTriangleBar;ObjectIDDecodeValueObjectIDEncodeValuePattern_White_SpacePrecedesSlantEqual;Precondition FailedProxy-AuthorizationRUNEWIDTH_EASTASIANRawValueDecodeValueRawValueEncodeValueReceiveMessageInputRemoval In ProgressReplicaSetNoPrimaryReverseEquilibrium;Revision invalid : RightDoubleBracket;RightDownTeeVector;RightDownVectorBar;RightTriangleEqual;SIGTRAP: trace trapScalingPolicyUpdateServerAliveCountMaxServerAliveIntervalService UnavailableSetup phase error: Signal received: %vSquareIntersection;StreamLocalBindMaskSucceedsSlantEqual;Switching ProtocolsTLS version too lowThrottlingExceptionTry to pull cache (URL cannot be emptyUnknownServiceErrorX-Amz-Request-PayerX-Amz-Storage-Class"DEADLINE_EXCEEDED""PERMISSION_DENIED"^(nvme\d+n\d+)p\d+$^us\-gov\-\w+\-\d+$_cgo_setenv missingafter array elementagent.private_queueagent: empty packetallowPartialResultsargon2(%d,%d,%d,%d)backspace_if_not_bsbad file descriptorbad flag syntax: %sbad kind in runfinqbad notifyList sizebad runtime·mstartbad unicode format bad value for fieldbinary.LittleEndianbit_image_entwiningblacktriangleright;bson.Value.DateTimebson.Value.Documentbson.Value.ObjectIDbsoncore.Value.Timebulk write error: [cgocall unavailablechord.callback.uuidclient disconnectedcontent-dispositioncriterion too shortdevice not a streamdevices/virtual/netdirectory not emptydirectory not founddisk quota exceededecdsa-sha2-nistp256ecdsa-sha2-nistp384ecdsa-sha2-nistp521empty option stringenter_draft_qualityenter_leftward_modeenter_right_hl_modeenter_scancode_modeenter_standout_modeerr must be non-nilevictCount overflowexit_attribute_modeexit_subscript_modeexit_underline_modeexpired certificatefile already closedfile already existsfile does not existgoogle.api.HttpRulegoogle.api.Resourcegoogle.api.resourcegoogle.protobuf.Anyhttp: Server closedif-unmodified-sinceillegal char escapeillegal file offsetillegal instructioninvalid Trailer keyinvalid URL escape invalid URL port %qinvalid UUID formatinvalid auth methodinvalid box versioninvalid header nameinvalid index valueinvalid object typekey:%q value:%q: %vlinefeed_is_newlinelongleftrightarrow;m not found in allmmagic_cookie_glitchmalformed mode (%s)malformed patch: %smarking free objectmarkroot: bad indexmaxStalenessSecondsmime: no media typemissing ']' in hostmultipart/form-datanested_section_stmtnetwork unreachableno space after hashno such template %qno symbols in inputnotesleep not on g0nwait > work.nprocspanic during mallocpanic during panic panic holding lockspanicwrap: no ( in panicwrap: no ) in parsenetlinkmessagepayload is too longprotobuf_messagesetproxy-authorizationreference not foundreflect.AppendSlicereflect.Value.Fieldreflect.Value.Floatreflect.Value.Indexreflect.Value.IsNilreflect.Value.Slicereturn_does_clr_eolrevoked certificatersa: internal errorruntime: insert t= runtime: pcdata is runtime: preempt g0security.capabilitysemaRoot rotateLeftserver is connectedservice unavailableset_top_margin_parmskip this directoryssh: pty-req failedstopm holding locksstopped (tty input)submodule not foundsubpacket truncatedsync.Cond is copiedtemplate: %s:%d: %stime: unknown unit too many open filesunaligned sysUnusedunclosed left parenunexpected %s in %sunexpected InstFailunexpected token %sunknown Go type: %vunknown XXX field: unknown branch typeunknown certificateunknown cipher typeunknown status codeunknown wait reasonunsupported oid: %xunsupported type %sunsupported versionuserAuthPubKeyOkMsgvalue align too bigwant can't be emptyweb.application_urlwhile parsing a tagwrong delta commandx509: unknown errorzero length segment{"$numberInt":"%d"}{"$timestamp":{"t":{"$undefined":true} last_command=%q noun_aliases=() '%d: :->level%d' \ - ExchangeType: %s after array element gcBlackenPromptly= markroot jobs done to unallocated span%%!%c(*big.Float=%s)%3d: t=%3d fix32 %d %3d: t=%3d fix64 %d /api/settings/update/api/tasks/clone/:id/api/tasks/pipelines/api/tasks/start/:id/api/user/delete/:id/containers/%s/pause/containers/%s/top%s/images/search?term=/srv/mottainai/build/usr/X11R6/bin/xauth/usr/share/terminfo//usr/share/zoneinfo//var/run/docker.sock2006-01-02T15:04:05Z2dsphereIndexVersion37252902984619140625: leftover defer sp=%s > Cloning git repo: Already consumed: %vAsia Pacific (Seoul)Asia Pacific (Tokyo)AttributeDefinitionsAvailable storages: ByteSliceDecodeValueByteSliceEncodeValueCLIENT_RANDOM %x %x CanonicalizeHostnameContext StorageDir: Create a new profileCreate a new settingCreate a new webhookDBPointerDecodeValueDBPointerEncodeValueDHT has wrong lengthDQT has wrong lengthDRI has wrong lengthDebugFlags called onDoubleLongLeftArrow;DownLeftRightVector;Egyptian_HieroglyphsEnvAccessKeyNotFoundExitOnForwardFailureFailed creating taskFormat specifies GNUFormat specifies PAXGHW_DISABLE_WARNINGSGSSAPIAuthenticationGlobalKnownHostsFileGlobalSecondaryIndexHTTP/%d.%d %03d %s IDS_Trinary_OperatorInsufficient StorageInvalid patch mode 'LeftArrowRightArrow;MAX_HEADER_LIST_SIZEMDC packet not foundMSpanList_InsertBackMarshalerEncodeValueMeroitic_HieroglyphsNegativeMediumSpace;No space found in %qNode matched regex: NotGreaterFullEqual;NotRightTriangleBar;PGP PUBLIC KEY BLOCKPassword of the userPubkeyAuthenticationQueue bind error: %sRemove a setting keyRequest URI Too LongRequestLimitExceededRightArrowLeftArrow;SIGALRM: alarm clockSIGTERM: terminationSOF has wrong lengthSOS has wrong lengthSaving container to Seek: invalid offsetSeek: invalid whenceSquareSupersetEqual;Task picked up twiceTerminal_PunctuationTimestampDecodeValueTimestampEncodeValueURL must have a hostUnclosed delimiter: UndefinedDecodeValueUndefinedEncodeValueUnknownEndpointErrorUnprocessable EntityWaitUntilTableExistsWorker quit abruptlyWriteDocumentElementX-Amz-Content-Sha256X-Amz-Grant-Read-AcpXXX_NoUnkeyedLiteral[Download] failed : [invalid char class]"RESOURCE_EXHAUSTED" libvirt.memory = [%dm%s%s %-44s ^[[:space:]]*%s\r*\z__vdso_clock_gettimeack_deadline_secondsagent.cache_registryagent.docker_keepimgagent.lxd_config_dirallChangesForClusterasn1: syntax error: authorization failedbad defer size classbad font file formatbad system page sizebad use of bucket.bpbad use of bucket.mpbox is not availablebroker.default_queuebroker.exchange_typebroker.handle_signalbson.Value.DBPointerbson.Value.MDocumentbson.Value.Timestampbson.Value.Undefinedbsoncore.Value.Arraybsoncore.Value.Int32bsoncore.Value.Int64bsoncore.Value.Regexbzip2 data invalid: can not add field %qcancel-tcpip-forwardceol_standout_glitchchan send (nil chan)change_scroll_regionclient to server MACclose of nil channelconnection error: %sconnection is closedconnection timed outcreate cursor not found errdest_tabs_magic_smsoelasticloadbalancingempty wants providedencoding want %q: %send_bit_image_regionenter_normal_qualityenter_protected_modeenter_subscript_modeenter_underline_modeerror calling %s: %serror during readingexit_doublewide_modeexit_pc_charset_modeextra data in bufferfailed to update refflag: help requestedfloating point errorforcegc: phase errorform-data; name="%s"gc_trigger underflowgo of nil func valuegoogle.iam.v1.Policygopark: bad g statusgzip: invalid headerhash not available: header line too longhorizontal_tab_delayhtml/template:%s: %shttp2: stream closedhttp: POST too largeif/with can't use %villegal base or sizeillegal char literalillegal octal numberindex of nil pointerindex of untyped nilinteger overflow: %qinvalid > Started Container Anatolian_HieroglyphsAsia Pacific (Mumbai)Asia Pacific (Sydney)CONFIGURATION PARAMS:CapitalDifferentialD;Context ArtefactDir: Context RealRootDir: Context RootTaskDir: Create a new pipelineCreate a new planningDecimal128DecodeValueDecimal128EncodeValueDoubleLeftRightArrow;DoubleLongRightArrow;EmptyVerySmallSquare;Error matching %s: %vExpiredTokenExceptionFloat.SetFloat64(NaN)Incomplete expressionInscriptional_PahlaviInternal Server ErrorJSONNumberDecodeValueJSONNumberEncodeValueJavaScriptEncodeValueKey/Value Store: %#v ListGlobalTablesInputLocalSecondaryIndexesMessageAttributeValueMonitoring task stateMottainaiCI webUI URLNestedGreaterGreater;NoCredentialProvidersNotDoubleVerticalBar;NotGreaterSlantEqual;NotLeftTriangleEqual;NotSquareSubsetEqual;OpenCurlyDoubleQuote;Other_Grapheme_ExtendPGP PRIVATE KEY BLOCKPrecondition RequiredProvisionedThroughputRemovePermissionInputReplicaSetWithPrimaryReplicaSettingsUpdateReverseUpEquilibrium;RoundTrip failure: %vSendMessageBatchInputStreamLocalBindUnlinkStrictHostKeyCheckingSunMonTueWedThuFriSatTransactGetItemsInputUNKNOWN_FRAME_TYPE_%dURL field is requiredUS East (N. Virginia)Unclosed delimiter: 'Unhandled Setting: %vUpdateTimeToLiveInputX-Amz-Grant-Write-Acp[Download] succeeded ","subType":"%02x"}},"FAILED_PRECONDITION" Did you mean this? _%s_root_command() { _cgo_unsetenv missingafter top-level valueagent.docker_endpointarguments not allowedattachment; filename=bad magic value foundbad number syntax: %qbad subscription nameblock device requiredbranch already existsbroker.result_backendbson.Value.Decimal128bson.Value.JavaScriptbsoncore.Value.Binarybsoncore.Value.Doublebsoncore.Value.Symbolbudgets.amazonaws.combufio: negative countcannot end with .lockcannot marshal type: carriage_return_delaychannelOpenConfirmMsgchannelOpenFailureMsgcheckdead: runnable gcommand not supportedconcurrent map writesconfig file not foundconfig.vm.box_url = "connection(%s) %s: %scontext cannot be nilcr_cancels_micro_modecrr.endpointdiscoverydecompression failuredefer on system stackdeleted file mode %o diff --git a/%s b/%s empty subsection nameencoding depth %d: %sencoding depth %s: %senter_doublewide_modeenter_pc_charset_modeexec: already startedexit_alt_charset_modeexit_superscript_modeexpected DOCUMENT-ENDexpected STREAM-STARTexpected section namefeature not supportedfindrunnable: wrong pgcprocs inconsistencygoogle.iam.v1.Bindinggoogle.protobuf.Emptygoogle/api/http.protohttp: Handler timeouthttp: invalid patternhttp: nil Request.URLhttp://127.0.0.1:9090http://localhost:8080illegal character %#Uillegal character NULimage: unknown formatin string escape codeinvalid ALPN protocolinvalid JPEG format: invalid emitter stateinvalid hash text: %sinvalid named captureinvalid pkt-len foundkey is not comparableknownhosts: %s:%d: %vlarge public exponentlink has been severedlistening on %s (%s) localhost.localdomainmalformed Host headermalformed command: %smalformed duration %qmalformed request: %smalformed zero-id refmissing capability %smissing output streammust not end with "."must not end with "/"no armored data foundno decoder found for no encoder found for no object keys found!no such key to deleteorigPtr out of boundspackage not installedpanic on system stackparsenetlinkrouteattrpasslib.ctx.hashCallspflag: help requestedprojects/%s/topics/%spublic key algorithm read-only file systemrecord on line %d: %vreflect.Value.Complexreflect.Value.Pointerreflect.Value.SetUintreleasep: invalid argremote already existsretain_acked_messagesroute53.amazonaws.comruntime: confused by runtime: newstack at runtime: newstack sp=runtime: work.nwait= sequence tag mismatchset bit is not 0 or 1set_right_margin_parmshallow not supportedsnappy: corrupt inputssh: cert has expiredssh: cert has type %dssh: packet too largessh: packet too smallstale NFS file handlestartlockedm: m has pstartm: m is spinningstate not recoverablestopg: invalid statusstorage.artefact_pathstring not terminatedtag is not an integertag:yaml.org,2002:inttag:yaml.org,2002:maptag:yaml.org,2002:seqtag:yaml.org,2002:strthe opcode is unknowntoo many Host headerstoo many coefficientstoo short zero-id reftrace/breakpoint traptransparent_underlineundefined variable %qunexpected content %qunexpected end of keyunexpected frame typeunexpected value typeunknown HTTP method: unknown address type unknown config formatunknown empty Contextunrecognized option: unsupported scheme %quser defined signal 1user defined signal 2user: invalid userid user: unknown userid virtual timer expiredweb.github_token_userworktree is not cleanwrite handler not setx-goog-request-paramsx509: invalid paddingyaml_FLOW_ENTRY_TOKENyaml_STREAM_END_TOKEN{service}.{dnsSuffix} into Go struct field received during fork %v.WithValue(%#v, %#v)(^|[/\\])\.\.([/\\]|$)) multiple inline maps.localhost.localdomain/api/tasks/update/node/api/tasks/updatefield/containers/%s/unpause/etc/apache/mime.types/etc/ssl/ca-bundle.pem/lib/time/zoneinfo.zip/usr/local/share/certs0123456789aAbBcCdDeEfF0123456789abcdefABCDEF169.254.169.254/latest4656612873077392578125AWS GovCloud (US-East)BSON Type %s is not %sCloseCurlyDoubleQuote;Context NamespaceDir: CreateGlobalTableInputCreated container ID: DEBUG_HTTP2_GOROUTINESDoubleContourIntegral;ERR no such repositoryFilledVerySmallSquare;Format specifies USTARGRPC_BINARY_LOG_FILTERGlobalSecondaryIndexesHelp about any commandInscriptional_ParthianInt.Scan: invalid verbInvalid patch string: JSON marshal error: %sJan _2 15:04:05.000000LastEvaluatedTableNameMAX_CONCURRENT_STREAMSMemory:\s+\d+K\/(\d+)KNegativeVeryThinSpace;No profiles available.No task handler found!NotPrecedesSlantEqual;NotRightTriangleEqual;NotSucceedsSlantEqual;Open channel error: %sPasswordAuthenticationPubkeyAcceptedKeyTypesRat.Scan: invalid verbRegistry cannot be nilRestarting (%d) %s agoRestoreTableFromBackupSIGSTKFLT: stack faultSIGTSTP: keyboard stopSimulate Agent CommandToken{%+v, %s, %d, %d}UnmarshalerDecodeValueUnsupported Media TypeUpdateGlobalTableInputWorker quit gracefullyWriteBinaryWithSubtypeX-Content-Type-OptionsXXX_InternalExtensionsYCbCrSubsampleRatio410YCbCrSubsampleRatio411YCbCrSubsampleRatio420YCbCrSubsampleRatio422YCbCrSubsampleRatio440YCbCrSubsampleRatio444address already in useadjustPriority on rootaes128-gcm@openssh.comagent.docker_caps_dropagent.docker_in_dockerallow-tip-sha1-in-wantapplication/ecmascriptapplication/javascriptapplication/postscriptargument list too longassembly checks failedawssdk.query.Unmarshalbad g->status in readybody closed by handlerbson.Element{"%s": %v}bson.Value.StringValuebsoncore.Value.Booleancannot allocate memorycannot unmarshal into client is disconnectedcomment not terminatedconsumer_cancel_notifydriver: bad connectionduration: nil Durationelement is missing keyencoding flush-pkt: %sended session was usedenter_alt_charset_modeenter_superscript_modeenter_vertical_hl_modeerror decoding messageerror parsing regexp: exceeded wait attemptsexcessive DC componentexpected /> in elementexpected end; found %sexpected quoted stringexpected right bracketfailed to get usernamefailed to parse %s %#qfailed to parse IP: %qfile checksum mismatchflag %q does not existfreeIndex is not validgeneral.client_timeoutgetenv before env initgoogle.pubsub.v1.Topicgrpc-retry-pushback-msgzip: invalid checksumhash tag doesn't matchheader field %q = %q%sheredoc not terminatedhpack: string too longhttp2: frame too largeidna: invalid label %qillegal UTF-8 encodingillegal number base %dinappropriate fallbackindex out of range: %dinteger divide by zerointerface conversion: internal inconsistencyinvalid PAX record: %qinvalid address familyinvalid config: %q, %vinvalid message lengthinvalid urn prefix: %qjson: unknown field %qkey "%s" was not foundliteral not terminatedlog [OPTIONS]magic_cookie_glitch_ulmalformed HTTP requestmalformed HTTP versionmemcache: server errormessage_storage_policyminpc or maxpc invalidmissing ']' in addressmissing 'want ' prefixmissing required fieldmust not contains "%s"must not contains ".."must not contains "/."name field is requirednetwork already existsnetwork is unreachableno forward for addressno transaction startednode is not in a Swarmnon-Go function at pc=non_dest_scroll_regionoldoverflow is not nilopenpgp: incorrect keyoperation was canceledparenthesized pipelineproto: nil destinationproto: repeated field protocol not availableprotocol not supportedpublic key algorithm: reflect.Value.MapIndexreflect.Value.SetFloatremote address changedrepeat count too largeruntime.main not on m0runtime: out of memoryruntime: work.nwait = runtime:scanstack: gp=s.freeindex > s.nelemsscanstack - bad statussemi_auto_right_marginsend on closed channelservice config updatedset_bottom_margin_parmskipping Question Nameskipping Question Typeslice length too largespan has no free spacessh: Stdin already setssh: command %v failedssh: rejected: %s (%s)ssh: unsupported curvestack not a power of 2storage.namespace_pathsuperscript_characterstag:yaml.org,2002:booltag:yaml.org,2002:nulltimer goroutine (idle)trace reader (blocked)trace: alloc too largetrusted.overlay.opaqueundefined variable: %sunexpected empty hpackunexpected length codeunknown cert algorithmunknown cert key type unknown slice type: %Tunsupported action: %dunsupported depth typevagrant: path is emptyvalue %t not supportedwrite on closed bufferwrong number of fieldsyaml_BLOCK_ENTRY_TOKENzero length BIT STRINGzlib: invalid checksum{%v %v %v %v %v %v %v}{"$binary":{"base64":"{"$numberDouble":"%s"} case $words[%d] in command_aliases=() noun_aliases+=(%q) into Go value of type %q in unquoted attr: %q%s (and %d more errors)%s: HTTP status code %d) must be a power of 2 , received remote type /* %d unknown bytes */ /api/storage/:id/delete/api/tasks/pipeline/:id/api/user/set/admin/:id/api/webhook/delete/:id/containers/%s/archive?/etc/apache2/mime.types/etc/pki/tls/cacert.pem/var/lib/libvirt/images23283064365386962890625>> Cached image found: >> Creating container..>> Pulling image: DONE!Attaching to container AutoScalingPolicyUpdateCPU time limit exceededChangeMessageVisibilityClose channel error: %sContainer not running: Container working dir: CoreDocumentDecodeValueCoreDocumentEncodeValueDeleteMessageBatchInputDescribeTimeToLiveInputDiacriticalDoubleAcute;Download task artefactsElementSliceDecodeValueElementSliceEncodeValueErorr finding attributeError reading directoryExclusiveStartBackupArnExclusiveStartTableNameGNU cannot encode %s=%dGNU cannot encode %s=%qGNU cannot encode %s=%vGetQueueAttributesInputHostbasedAuthenticationListTagsOfResourceInputLogical_Order_ExceptionMB during sweep; swept Manage Pipeline of TaskManage Planning of TaskNo such exec instance: Noncharacter_Code_PointNotSquareSupersetEqual;NumberOfPasswordPromptsPAX cannot encode %s=%dPAX cannot encode %s=%qPAX cannot encode %s=%vPriorRequestNotCompleteQueue consume error: %sQueue declare error: %sQueue inspect error: %sRequestTimeoutExceptionResult backend requiredRhostsRSAAuthenticationSIGIO: i/o now possibleSIGSYS: bad system callSetQueueAttributesInputSplit called after ScanStructCodec.DecodeValueStructCodec.EncodeValueTimeToLiveSpecificationTransactWriteItemsInputUS West (N. California)Unknown help topic %#q Update a system settingUpdateContinuousBackupsVariant Also NegotiatesWaitUntilTableNotExistsX-Amz-Copy-Source-Rangeacquirep: already in goagent.docker_privilegedagent.health_check_execagent.upload_chunk_sizeagent: client error: %vapplication-autoscalingapplication/x-%s-resultasn1: structure error: attach to a task outputauthentication requiredbad %s slice length: %dblock checksum mismatchbsoncore.Value.DateTimebsoncore.Value.Documentbsoncore.Value.ObjectIDbytes.Buffer: too largecannot assign nil to %schallenge proof invalidchan receive (nil chan)chroot boundary crossedclient to server cipherclose of closed channelcommand error on %s: %scommand not implementedcommit parent not founddata exceeds block sizedefine_bit_image_regiondevice or resource busyedit element is missing typeencoding shallow %q: %sentitlement.marketplaceerror decoding '%s': %sexec: Stdin already setexpected bool; found %sexpected element type lockedInt = invalid resource type: invalid response code: invalid unicode literaljson: cannot unmarshal left over markroot jobsmakechan: bad alignmentmalformed HTTP responsemissing 0xff00 sequencemissing port in addressmissing protocol schememissing required key %smissing type in runfinqmisuse of profBuf.writemonitor id1 id2 id3 ...multipart: NextPart: %vnanotime returning zeronet/http context value net/http: abort Handlernetwork not implementedno SubConn is availableno access to this vhostno application protocolno digit in that numberno space left on deviceno tree selectors givenno_correctly_working_crnode already in a Swarmnon-fast-forward updatenon-function of type %snon-zero reserved fieldnorm: negative positionnumber_of_function_keysobjfile: already closedobjfile: invalid headeropenpgp: invalid data: operation not permittedoperation not supportedother_non_function_keyspanic during preemptoffpartialFilterExpressionpasslib.ctx.verifyCallsprocresize: invalid argprofiling timer expiredproperties: Line %d: %sproto.NewExtension(%#v)proto: integer overflowreflect.Value.Interfacereflect.Value.NumMethodreflect.methodValueCallremote config not foundruntime: internal errorruntime: invalid type runtime: netpoll failedruntime: s.allocCount= s.allocCount > s.nelemssasl conversation errorschedule: holding locksscrypt-sha256(%d,%d,%d)segment length too longserver to client ciphershow [OPTIONS]skipping Question Classspan has no free stacksssh-public-key-callbackssh: Stderr already setssh: Stdout already setssh: exponent too largessh: illegal padding %dssh: incorrect exponentssh: invalid channel %dssh: no auth passed yetssh: zero length packetstack growth after forkstop [OPTIONS]syntax error in patterntag:yaml.org,2002:floattag:yaml.org,2002:mergetemplate %q not definedtext/css; charset=utf-8text/xml; charset=utf-8time: invalid duration timeseries: num < 0, %vtoo many pointers (>10)trimTrailingWhitespacestruncated tag or lengthunable to decode OP_MSGunable to decode headerunable to decode varintunexpected Huffman codeunexpected address typeunexpected map key typeunexpected signal valueunknown character widthunknown command failureunknown empty width argunknown error code 0x%xunknown escape sequenceunknown type in isZero unlock of unlocked lockunpacking Question.Nameunpacking Question.Typeunsupported certificateunsupported encoding %vunsupported object typevarint integer overflowwaiter context canceledwatcher has been closedweb.embed_webhookserverwhile scanning an aliaswork.nwait > work.nprocx509: incorrect IV sizexml: unsupported type: yaml_DOCUMENT_END_TOKENyaml_STREAM_START_TOKEN{"$dbPointer":{"$ref":"{"$numberDecimal":"%s"}%3d: fetching op err %v %3d: t=%3d fix32 err %v %3d: t=%3d fix64 err %v %s while positioned on a%s: unsupported type: %s%v(%T) would overflow %v%v.WithDeadline(%s [%s])+refs/tags/*:refs/tags/*.gitmodules is a symlink/api/tasks/:id/artefacts/containers/%s/stop?t=%d/etc/ssh/ssh_known_hosts/usr/share/lib/zoneinfo/1164153218269348144531252006-01-02 15:04:05Z07002006-01-02T15:04:05-0700582076609134674072265625>> Using pulled image: Asia Pacific (Hong Kong)Asia Pacific (Singapore)Buffer called after ScanCodeWithScopeDecodeValueCodeWithScopeEncodeValueCodeWithScopeSpacerFrameDSA verification failureDescribeGlobalTableInputDisplay user informationEVENT_TYPE_CLIENT_HEADEREVENT_TYPE_SERVER_HEADERErrorHandler should exitFailed to fire hook: %v FileOptions_OptimizeModeInvalid host pattern: %vMon Jan _2 15:04:05 2006NotNestedGreaterGreater;PointerCodec.DecodeValuePointerCodec.EncodeValuePreferredAuthenticationsRSA verification failureRat.Scan: invalid syntaxRawSockaddrAny too smallRequest Entity Too LargeSearching for config in Show artefacts of a taskSubchanel(id:%d) deletedTLS_RSA_WITH_RC4_128_SHATask must be a func typeTooManyRequestsExceptionUnknown object %X %s %T Upload file to a storageWhile parsing config: %sX-Amz-Grant-Full-controlX-Amz-Metadata-Directive[%dm%s[%s]%s %-44s _html_template_urlfilter_vagrant_box_image_0.imgagent.lxd_cache_registryagent.pre_task_hook_execagent.upload_speed_limitapplication/octet-streamapplication/x-%s-requestapplication/x-ecmascriptapplication/x-javascriptauthor field is requiredawssdk.client.LogRequestawssdk.jsonrpc.Unmarshalbad defer entry in panicbad defer size class: i=bad public-key algorithmblock index out of rangebroker.results_expire_inbson.Value.CodeWithScopebsoncore.Value.DBPointerbsoncore.Value.TimestampbyapssDocumentValidationbypassDocumentValidationcan't scan our own stackchannelRequestFailureMsgchannelRequestSuccessMsgclone [OPTIONS]cloudfront.amazonaws.comcommands cannot be emptyconnection reset by peercontainer already existsdelivery not initializeddiscord: postMessage: %vdouble traceGCSweepStartduplicate %TAG directiveencodeArray: nil elemententer_horizontal_hl_modeerror decrypting messageexec: Stderr already setexec: Stdout already setexpected '/' for commentexpected float; found %sexpected: STRING got: %sfailed to close net.Connfailed to parse EC pointfile size limit exceededflate: maxBits too largefloating point exceptionfunction not implementedgcDrainN phase incorrectgoogle.api.FieldBehaviorgoogle.protobuf.Durationgrpc: balancer is closedhash of unhashable type http2: canceling requesthttp: nil Request.Headerhue_lightness_saturationiam.us-gov.amazonaws.comidna: disallowed rune %Uimage/vnd.microsoft.iconincorrect number of argsinitSpan: unaligned baseinvalid argument to Intninvalid capabilities: %sinvalid number of roundsinvalid pseudo-header %qinvalid request :path %qjson: unsupported type: knownhosts: key mismatchlevel 2 not synchronizedlink number out of rangeminimum field size of %vmodule config: empty URLmultiple errors occurredmultiple write errors: [must not start with "%s"node [command] [OPTIONS]non-empty decoder buffernot a global message %#vold mode %o new mode %o on range loop re-entry: only PAX supports Xattrsout of streams resourcesplan [command] [OPTIONS]projects/%s/snapshots/%sproto: missing extensionqueuefinalizer during GCread handler must be setreflect.Value.SetComplexreflect.Value.UnsafeAddrremote config: empty URLresource length too longresult must be a pointerrunqsteal: runq overflowruntime: found obj at *(sending done message: %ssending haves for %q: %sserver selection timeoutserver validation failedshow [OPTIONS]show [OPTIONS]signing key is encryptedsnappy: Writer is closedspan has no free objectsssh: invalid curve pointssh: session not startedssh: wrong packet lengthstack trace unavailable start [OPTIONS]stream %d already openedstreamSafe was not resetstructure needs cleaningtabwriter: panic during tag:yaml.org,2002:binarytagger field is requiredtask [command] [OPTIONS]text/html; charset=utf-8timestamp: nil Timestampunable to fetch packfileunable to parse date: %sunable to resolve commitunclosed table array keyunexpected %s in operandunexpected buffer len=%vunexpected exponent baseunexpected mantissa baseunknown channel type: %vunknown private key typeunpacking Question.Classuser [command] [OPTIONS]validation loop completeweb.healthcheck_intervalwhile scanning an anchoryaml_TAG_DIRECTIVE_TOKENzlib: invalid dictionary{"$code":%s,"$scope":%s} aliashash[%q]=%q to unused region of span%3d: t=%3d varint err %v %d error(s) decoding: %s'%s' has invalid keys: %s-------------------------/api/namespace/:name/list/api/settings/remove/:key/api/storage/:name/create/api/tasks/status/:status/api/user/set/manager/:id/api/user/unset/admin/:id/api/webhook/create/:type/proc/sys/kernel/hostname2006-01-02 15:04:05 -07002006-01-02 15:04:05Z07:002006-01-02T15:04:05Z07:002006-1-2 15:4:5.9999999992910383045673370361328125500 Internal Server Error; defined templates are: >>>>> Execution completedAutoScalingSettingsUpdateCanonicalizeFallbackLocalClockwiseContourIntegral;Container cleanup error: Content-Transfer-EncodingContext TaskRelativeDir: DescribeContinuousBackupsDoubleLongLeftRightArrow;EVENT_TYPE_CLIENT_MESSAGEEVENT_TYPE_SERVER_MESSAGEEVENT_TYPE_SERVER_TRAILEREmptyInterfaceDecodeValueEmptyInterfaceEncodeValueError on upload file %s: Exception (%d) Reason: %qFieldDescriptorProto_TypeGRPC_GO_REQUIRE_HANDSHAKEGSSAPIDelegateCredentialsHTTP/1.1 100 Continue InvalidPresignExpireErrorJan _2 15:04:05.000000000Origin namespace to clonePublish message error: %sRequestThrottledExceptionResourceNotFoundExceptionRestoreTableToPointInTimeShow configuration paramsSouth America (Sao Paulo)Subchannel(id:%d) createdTransientTransactionErrorUSTAR cannot encode %s=%dUSTAR cannot encode %s=%qUSTAR cannot encode %s=%vUpdateGlobalTableSettingsValueMarshalerEncodeValueWarn: (cleanup failed on XML syntax error on line _cgo_thread_start missing_html_template_cssescaper_html_template_urlescaperacquirep: invalid p stateagent: bad public key: %vallgadd: bad status Gidlearena already initializedarray of unsupported typeattach [OPTIONS]awssdk.client.LogResponsebad status in shrinkstackbit_image_carriage_returnblake2b: invalid key sizebootstrap type wrong id: branch config: empty namebsoncore.Value.Decimal128bsoncore.Value.JavaScriptcan't evaluate command %qcan't print %s of type %scan't scan gchelper stackcannot decode %v into a Dcannot read body, err: %vchansend: spurious wakeupcheckId: %d should be %d checkdead: no m for timercheckdead: no p for timercontext deadline exceededdid not find expected '!'did not find expected keyelgamal: decryption errorempty key flags subpacketenter_near_letter_qualityerror decoding []byte: %serror encrypting cookie: expected string; found %sexplicit tag has no childframe could not be parsedgoogle.api.field_behaviorgoogle.iam.v1.PolicyDeltagoogle.protobuf.FieldMaskgoogle.protobuf.Timestampgoogle.pubsub.v1.Snapshotgoogle/api/resource.protogoogle/protobuf/any.protogrpc.binarylog.v1.Addressgrpc.binarylog.v1.Messagegrpc.binarylog.v1.Trailerhttp2: Framer %p: read %vhttp2: invalid header: %vhttp2: unsupported schemeillegal character code %Uillegal number syntax: %qinconsistent poll.fdMutexinvalid Unicode characterinvalid character entity invalid compression levelinvalid cross-device linkinvalid key character: %cinvalid network interfaceinvalid new object id: %sinvalid object identifierinvalid old object id: %sinvalid proxy URL port %qinvalid string length: %dinvalid username/passwordjson: Unexpected key typejson: unsupported value: length of decrypted key (line too short after hashmalformed duration %q: %vmax. packed size exceededmemcache: item not storedmessage field is requiredminimum field value of %vmissing stack in newstackmissing traceGCSweepStartmodule config: empty pathnet/url: invalid userinfono answer from DNS serverno buffer space availableno call stack informationno hex data for %x stringno more items in iteratorno such device or addressno such file or directoryno such network interfaceno suitable address foundnot at beginning of valueopcode %s not implementedoperation now in progressport number out of range proto: bad byte length %dredigo: connection closedreference delta not foundreflect.Value.OverflowIntreflect.Value.SetMapIndexreflect: Bits of nil Typerefname "%s" is ambiguousrefs/heads/*:refs/heads/*releasep: invalid p stateremote config: empty nameremove [OPTIONS]repeats past end of blockrepository already existsrepository does not existresource deadlock avoidedruntime: t.spanKey= runtime: epollwait on fd runtime: program exceeds runtime·lock: lock countsending haves message: %ssignature packet version slice bounds out of rangeslice of unsupported typesnappy: unsupported inputsocket type not supportedssh: handshake failed: %vssh: padding %d too largessh_config: empty patternstartm: p has runnable gsstoplockedm: not runnablestrict-transport-securitysubmodule not initializedtext/plain; charset=utf-8tgt[%s] != ok, tgt[%s]=%vtls: protocol is shutdowntls: too many warn alertstoken [command] [OPTIONS]transport provided is nilunable to decode OP_REPLYunexpected '[' in addressunexpected ']' in addressunexpected end element [OPTIONS]execution of %v failed: %sexpected complex; found %sexpected integer; found %sfailed to find CERTIFICATEfailed to find PRIVATE KEYflag needs an argument: %sforEachP: P did not run fnfound undefined tag handlefreeSpan given cached spanfreedefer with d.fn != nilgob: local interface type google.iam.v1.BindingDeltagoogle/iam/v1/policy.protogrpc-previous-rpc-attemptsgrpc.binarylog.v1.Metadatahttp2: Framer %p: wrote %vid (%v) <= evictCount (%v)illegal hexadecimal numberimportexport.amazonaws.cominitSpan: unaligned lengthinteger overflow on token internal error: bad Writerinvalid argument to Int31ninvalid argument to Int63ninvalid character sequenceinvalid escape sequence: \invalid port %q after hostinvalid request descriptorinvalid sha2 password stubinvalid unicode escape: \Uinvalid unicode escape: \uinvalid use of _ in numberinvalid value; expected %sknownhosts: key is revokedknownhosts: key is unknownmalformed HTTP status codemalformed chunked encodingmessage_retention_durationname not unique on networknet/http: request canceledno CSI structure availableno encoder found for no message of desired typeno templates in name spaceno value can start with %cnon sequence tagged as setnon signature packet foundnotewakeup - double wakeupout of memory (stackalloc)partition: %q, service: %qpermanent client error: %spersistentalloc: size == 0properties: %s returned %dproto: descriptor conflictproto: illegal wireType %dread from empty dataBufferreadLoopPeekFailLocked: %vreflect.Value.CanInterfacereflect.Value.MethodByNamereflect.Value.OverflowUintremote repository is emptyremove [OPTIONS]remove [OPTIONS]remove [OPTIONS]rename %s %s rename %s %s required key not availableroute name cannot be emptyruntime: bad span s.state=s3.eu-west-1.amazonaws.coms3.sa-east-1.amazonaws.coms3.us-west-1.amazonaws.coms3.us-west-2.amazonaws.comsegment prefix is reservedshow [OPTIONS]some refs were not updatedssh: cert is not yet validssh: could not start shellssh: invalid packet lengthssh: signature parse errorstartlockedm: locked to mestopped after 10 redirectssubkey signature invalid: template escaped correctlytext/plain; charset=latin1the connection is drainingtoo many colons in addresstoo many layers of packetstree selector out of rangetruncated base 128 integertruncated private key datauid=([0-9]+).*gid=([0-9]+)unable to decode extensionunable to download the boxunable to parse version %qunclosed criterion bracketunclosed double-quoted keyunclosed single-quoted keyunexpected . after term %qunexpected right paren %#Uunknown component selectorunknown line break settingunsupported JPEG feature: unsupported capability: %sunsupported value: %v (%s)unterminated quoted stringwhile parsing a block nodewhile scanning a directiveyaml_PARSE_FLOW_NODE_STATEzero-length heredoc anchor{region}.queue.{dnsSuffix} _arguments '*: :_files' flags_completion+=(%q) is not assignable to type !#$%&()*+-./:<=>?@[]^_{|}~ %3d: t=%3d unknown wire=%d %q in attribute name: %.32q-----END PGP SIGNATURE-----/api/namespace/:name/create/api/namespace/:name/delete/api/user/unset/manager/:id/artefact/:id/build_:id.log/containers/%s/restart?t=%d/plugins/privileges?remote=363797880709171295166015625Can't close pipe writer: %sContainer already running: DATA frame with stream ID 0DecodeContext cannot be nilDescribeGlobalTableSettingsFailed to write to log, %v G waiting list is corruptedGRPC_GO_LOG_VERBOSITY_LEVELGlobalSecondaryIndexUpdatesHuffman length out of rangeLoose objects not supportedMSpan_Sweep: bad span stateMarshal can't handle %v(%v)Profile %s is not present. Reflect task args error: %sRestoreTableFromBackupInputReuse of exported var name:Run '%v --help' for usage. SIGILL: illegal instructionSIGXCPU: cpu limit exceededSet state pending error: %sThe parameter is incorrect.Value not found for type %vValueUnmarshalerDecodeValueWhile marshaling config: %s"2006-01-02T15:04:05Z07:00" config.vm.synced_folder "_html_template_jsstrescaper_html_template_jsvalescaperaccess-control-allow-originadd DATA on non-open streamadministratively prohibitedafter object key:value pairarchive/tar: write too longbad data: undefined type %sbinary.Write: invalid type can't index item of type %scannot register a nil Codecchannel number out of rangecipher: incorrect length IVcommunication error on sendconnection error: desc = %qcould not find expected ':'couldn't find remote ref %qcrypto/rsa: invalid modulusdecode can't handle type %sdeprecated randomized filesdiffie-hellman-group14-sha1empty git-upload-pack givenerror in sort_by comparisonerror unmarshaling JSON: %vexpected low surrogate areafailed to parse IP mask: %qfailed to set read deadlineflag needs an argument: -%sfloat cannot end with a dotgcstopm: not waiting for gcgoogle.api.method_signaturegoogle.protobuf.EnumOptionsgoogle.protobuf.FileOptionsgoogle.pubsub.v1.PushConfiggoogle/protobuf/empty.protogrowslice: cap out of rangehttp chunk length too largehttp2: response body closedhttp2: server read frame %vignoring invalid trailer %qincomplete UTF-16 characterindex name must be a stringinput does not match formatinsufficient security levelinternal lockOSThread errorinvalid HTTP header name %qinvalid UUID (got %d bytes)invalid WriteHeader code %vinvalid argument to Shuffleinvalid boolean flag %s: %vinvalid dependent stream IDinvalid leading UTF-8 octetinvalid profile bucket typeinvalid table array key: %sinvalid type for comparisoninvalid type name length %dkey was rejected by servicelarge span treap rotateLeftmakechan: size out of rangemakeslice: cap out of rangemakeslice: len out of rangemalformed unpack status: %smap has no entry for key %qmaximum tree depth exceededmerging maps (must convert)net/http: invalid method %qnet/http: use last responsenon-fast-forward update: %snot a XENIX named type filenot a pointer to struct: %snot a valid logrus level %dnumbers cannot start with 0openpgp: invalid argument: os: process not initializedos: unsupported signal typepasslib.sha2crypt.hashCallspath is not a directory: %spointer to unsupported typeprofile [command] [OPTIONS]progToPointerMask: overflowproto: not an extension maprange can't iterate over %vrds.eu-west-1.amazonaws.comrds.eu-west-2.amazonaws.comrds.us-east-1.amazonaws.comrds.us-east-2.amazonaws.comrds.us-west-2.amazonaws.comreflect.Value.OverflowFloatremove [OPTIONS]repeated component selectorrestartg: unexpected statusrunlock of unlocked rwmutexruntime: checkdead: find g runtime: checkdead: nmidle=runtime: corrupted polldescruntime: netpollinit failedruntime: thread ID overflowruntime·unlock: lock counts3-external-1.amazonaws.comsession already establishedsetting [command] [OPTIONS]show [OPTIONS]signal received during forksigsend: inconsistent statestack size not a power of 2startm: negative nmspinningstopTheWorld: holding locksstorage [command] [OPTIONS]sts.ap-east-1.amazonaws.comtag value must not be emptytag:yaml.org,2002:timestamptime: invalid location nametls: short read from Rand: too many declarations in %stoo many transfer encodingsunable to create request %vunable to read full messageunexpected client error: %sunexpected command receivedunexpected server challengeuninitialized Huffman tableunix:///var/run/docker.sockunknown command %q for %q%sunknown remaining value: %dunknown wktpointer type %#vunsupported JSON value (%v)unsupported metricdata.Typeunsupported protocol schemeuser: GroupIds requires cgowebhook [command] [OPTIONS]while scanning a simple keywork.nwait was > work.nprocworktree should be providedxml: opening charset %q: %vxml: start tag with no nameyaml_FLOW_MAPPING_END_TOKENyaml_PARSE_BLOCK_NODE_STATE{"code": "%s", "scope": %v} after object key:value pair args stack map entries for %q is not a defined function%s but is positioned on a %s-----END PGP SIGNATURE----- /api/tasks/pipeline/:id.yaml/api/webhook/delete/task/:id/api/webhook/update/task/:id/grpc.health.v1.Health/Watch/proc/sys/net/core/somaxconn/system/etc/security/cacerts18189894035458564758300781259094947017729282379150390625Broker failed with error: %sCAST5: keys must be 16 bytesCRC32 integrity check failedCan't add file %s to tar: %sChangeMessageVisibilityBatchChangeMessageVisibilityInputDownload namespace artefactsERR Repository not found.ERROR: Repository not found.EVENT_TYPE_CLIENT_HALF_CLOSEError on download namespace EvalSymlinks: too many linksFailed to obtain reader, %v FixedStack is not power-of-2Getting object %s failed: %vInvoking task caused a panicKbdInteractiveAuthenticationMHeap_FreeSpanLocked - span MSpan_Sweep: m is not lockedMon Jan _2 15:04:05 MST 2006Mon, 2 Jan 2006 15:04:05 GMTPacked objects not supportedPrepended_Concatenation_MarkProvisionedReadCapacityUnitsSIGHUP: terminal line hangupSIGWINCH: window size changeSendMessageBatchRequestEntrySet/unset admin flag to userTLS_RSA_WITH_AES_128_CBC_SHATLS_RSA_WITH_AES_256_CBC_SHATask Name ( default: empty )Transfer-Encoding: chunked UpdateContinuousBackupsInputVAGRANT_CHECKPOINT_DISABLE=1X-Amz-Server-Side-EncryptionYou need to define a node idYou need to define a plan idYou need to define a task idYou need to define a user id[originating from goroutine " config.vm.synced_folder "^(us|eu|ap|sa|ca)\-\w+\-\d+$_html_template_rcdataescaper_html_template_srcsetescaper_html_template_urlnormalizer_mheap_alloc not on g0 stackagent: extension unsupportedallow-reachable-sha1-in-wantamqp://guest@127.0.0.1:5672/application/x-rar-compressedarchive/tar: FileInfo is nilartefacts [OPTIONS]asn1: string not valid UTF-8batch cursor must not be nilbranch config: invalid mergebsoncore.Value.CodeWithScopebytes,1053,opt,name=resourcebytes,72295728,opt,name=httpbytes: negative Repeat countcan't happen: encode type %scan't preserve unlinked spancannot decode %v into a Nullcannot get ObjectToPack sizecannot parse '%s' as int: %scannot subscribe after closecannot unmarshal DNS messageclient to server compressioncomparing uncomparable type create [OPTIONS]crypto/rsa: decryption errorcurve25519-sha256@libssh.orgdelete [OPTIONS]destination address requiredempty advertised-ref messageempty update-request messageencoding first want line: %serror creating SSH agent: %qerror creating authenticatorerror encoding extension: %verror parsing field '%s': %vexpected %s event but got %sexpecting key part after dotfailed getting extension: %vfailed to convert %q to uintfailed to parse %q as %v: %vfailed to set write deadlinefatal: morestack on gsignal file descriptor in bad statefindrunnable: netpoll with pfound unknown directive namegchelperstart: bad m->helpgcgcstopm: negative nmspinninggeneral SOCKS server failuregob: cannot encode nil valuegob: duplicate type receivedgob: unknown size of uintptrgogo.protobuf.proto.durationgolang.org/x/net/trace.Tracegoogle.api.CustomHttpPatterngoogle.protobuf.FieldOptionsgoogle.protobuf.OneofOptionsgoogle.pubsub.v1.PullRequestgoogle.pubsub.v1.SeekRequestgoogle/api/annotations.protogrpc: the SubConn is closinggrpc: timed out when dialinghttp2: Transport received %shttp2: client conn is closedhttp: no Host in request URLhttp: request body too largeincompatible %YAML directiveinvalid argon2 password stubinvalid argument %q for %q%sinvalid byte for boolean, %binvalid byte in chunk lengthinvalid header field name %qinvalid proxy address %q: %vinvalid runtime symbol tableinvalid scrypt password stubinvalid trailing UTF-8 octetinvalid type, must be numberinvalid type, must be stringinvalid value type at %s: %Tjson: Unmarshal(non-pointer large span treap rotateRightmalformed MIME header line: malformed command status: %smarketplacecommerceanalyticsmax. recursion level reachedmerger not found for type:%smissing required Host headermissing stack in shrinkstackmultipart: boundary is emptymultipart: message too largeneed padding in bucket (key)negative n for ProbablyPrimenewproc1: new g is not Gdeadnewproc1: newg missing stacknil pointer evaluating %s.%sno command response documentno type map entry found for non-Huffman entropy encodingnot a valid logrus Level: %qnotewakeup - double wakeup (only PAX supports PAXRecordsopenpgp: invalid signature: os: process already finishedos: process already releasedoverflow on character value pair value cannot be empty: persistent connection closedpipeline [command] [OPTIONS]private key checksum failureprojects/%s/subscriptions/%sproto: unhandled def kind %vprotocol driver not attachedrds.ap-south-1.amazonaws.comreflect.MakeSlice: len > capreflect: In of non-func typereflect: Key of non-map typeregion exceeds uintptr rangeruntime: casgstatus: oldval=runtime: no module data for runtime: stat overflow: val server to client compressionservice.chime.aws.amazon.comshow [OPTIONS]simulate [command] [OPTIONS]size is larger than capacityslack: buildSlackPayload: %vssh-dss-cert-v01@openssh.comssh-rsa-cert-v01@openssh.comssh: public key not on curvessh: session already startedssh: unknown channel type %sssh: unsupported key type %Tstatic credentials are emptystrconv: ε > (den<}bufio.Scanner: token too longcan't handle Match directivescan't store data at section "cannot decode %s `%s` as a %scannot decode %v into a Regexcannot decode %v into a slicecannot parse '%s' as bool: %scannot parse '%s' as uint: %scannot start float with a dotchacha20-poly1305@openssh.comcommand returned no documentscrypto/aes: invalid key size crypto/des: invalid key size crypto/rc4: invalid key size crypto/rsa: invalid exponentsdatabase name cannot be emptydecode rate limit message: %vdelete [OPTIONS]did not find expected tag URIdid not find the expected '>'dns resolver: missing addressdup idle pconn %p in freeliste=channel-bindings-dont-matchempty buffer in io.CopyBufferentity without any identitiesequal symbols in Huffman treeerror adding derived templateexec: Wait was already calledexpected EOL, EOF, or commentexpected element name after [OPTIONS]remove [OPTIONS]rpc error: code = %s desc = %srunning on the wrong goroutinerunqputslow: queue is not fullruntime: bad pointer in frame runtime: found in object at *(runtime: impossible type kind s3.us-gov-east-1.amazonaws.coms3.us-gov-west-1.amazonaws.comsending upload-req message: %sshield.us-east-1.amazonaws.comsocket operation on non-socketsquare root of negative numberssh: DSA signature parse errorssh: disconnect, reason %d: %sssh: got bogus newkeys messagessh: unknown key algorithm: %vstream error: stream ID %d; %vstrings: negative Repeat countsync: inconsistent mutex statesync: unlock of unlocked mutextag byte does not have MSB settag handle must start with '!'text/plain; charset=iso-8859-1timeseries: bad num argument: too few operands for format '%transform: short source buffertype %s has no exported fieldsunable to decode OP_COMPRESSEDunaddressable value of type %sunescaped control character %Uunknown anchor '%s' referencedunknown connectivity state: %dunterminated raw quoted stringupdate [OPTIONS]user home directory not found.vvH5oXJCTwHNGcMe2EJWDUKg9yY6qxwhile parsing a %TAG directivewhile scanning a quoted scalarx509: DSA verification failureyaml_BLOCK_MAPPING_START_TOKENyaml_FLOW_SEQUENCE_START_TOKEN{"$date":{"$numberLong":"%d"}}{region}.{service}.{dnsSuffix}{service}.{region}.{dnsSuffix} _arguments '%d: :(%s)' _arguments '*: :_files' looking for beginning of value!! Error in destroying the box !! Error in halting the machine# ex: ts=4 sw=4 et filetype=sh %3d: start-end not balanced %d %s is not assignable to type %s%v, latest connection error: %v) not equal to cipher keysize () not in usable address space: +refs/heads/*:refs/remotes/%s/*...additional frames elided... .lib section in a.out corrupted/api/tasks/pipelines/delete/:id/api/tasks/tail_output/:id/:pos11368683772161602973937988281252006-1-2T15:4:5.999999999Z07:002006-1-2t15:4:5.999999999Z07:005684341886080801486968994140625Can't close compress writer: %sCan't convert %v(%T) to a sliceChallengeResponseAuthenticationCouldn't discover absolute pathEncryptedKey checksum incorrectInvalid slice, step cannot be 0ListDeadLetterSourceQueuesInputMon, 02 Jan 2006 15:04:05 -0700Network Authentication RequiredNumber of HTTP requests startedNumber of PubSub messages ackedPRIORITY frame with stream ID 0Processed task %s. Results = %sProfile %s is already present. Pruning unused docker resourcesQueue where to send the task toRemote Configurations Error: %sRequest Header Fields Too LargeRequested Range Not SatisfiableSIGSEGV: segmentation violationTLS: sequence number wraparoundTLS_RSA_WITH_AES_128_CBC_SHA256TLS_RSA_WITH_AES_128_GCM_SHA256TLS_RSA_WITH_AES_256_GCM_SHA384URI must not contain whitespaceUnknown table type for path: %sX-Amz-Copy-Source-If-None-MatchX-Amz-Website-Redirect-LocationYou need to define a storage idYou need to define a webhook id[Upload] Error while uploading agent.docker_in_docker_endpointagent: failed to sign challengeapi.ecr.ap-east-1.amazonaws.comapi.ecr.eu-west-1.amazonaws.comapi.ecr.eu-west-2.amazonaws.comapi.ecr.eu-west-3.amazonaws.comapi.ecr.sa-east-1.amazonaws.comapi.ecr.us-east-1.amazonaws.comapi.ecr.us-east-2.amazonaws.comapi.ecr.us-west-1.amazonaws.comapi.ecr.us-west-2.amazonaws.comapplication/json; charset=utf-8archive/tar: invalid tar headerbad status from double iteratorbad write barrier buffer boundsbundler: acquire: arg too smallcannot assign requested addresscannot decode %v into a booleancannot transform non-TreeNoderscannot unmarshal into nil Valuecasgstatus: bad incoming valuescheckmark found unmarked objectcollection name cannot be emptycore.SDKVersionUserAgentHandlercouldn't connect to any addresscreate [OPTIONS]crypto/rsa: invalid prime valueencodeReflectValue: nil elementencoding/hex: invalid byte: %#Uentersyscallblock inconsistent error from daemon in stream: %serror parsing '%s' for gs2 flages-fips.us-west-1.amazonaws.comexpected colon after object keyfmt: unknown base; can't happenfound duplicate %YAML directivegogo.protobuf.proto.DoubleValuegogo.protobuf.proto.StringValuegogo.protobuf.proto.UInt32Valuegogo.protobuf.proto.UInt64Valuegoogle.protobuf.DescriptorProtogoogle.pubsub.v1.PublishRequestgoogle/api/field_behavior.protogoogle/protobuf/timestamp.protogrpc.binarylog.v1.MetadataEntrygrpc: the connection is closinggrpc: the connection is drainedhash/crc32: tables do not matchheredoc doesn't contain newlinehttp2: connection error: %v: %viam.cn-north-1.amazonaws.com.cnin literal null (expecting 'l')in literal null (expecting 'u')in literal true (expecting 'e')in literal true (expecting 'r')in literal true (expecting 'u')incomplete UTF-8 octet sequenceincorrect mode to end array: %sinotify instance already closedinserting span already in treapinternal error - misuse of itabinvalid hashed material length invalid network interface indexinvalid number of Huffman treesjson: invalid number literal %qmalformed frame: missing methodmalformed time zone informationmap type in typeUnmarshaler in memory parameter (m) is missingmergeRuneSets odd length []runemissing argument for comparisonmultipart/byteranges; boundary=net/http: TLS handshake timeoutnewHuffmanTree: too few symbolsno permission to read from '%s'non in-use span in unswept listnon-pointer passed to Unmarshalnumber needs at least one digitonly valid as initial handshakeoversized encrypted session keypacer: sweep done at heap size proto: bad default int32 %q: %vproto: bad default int64 %q: %vproto: nil %T is not extendableredsync: failed to acquire lockreflect.MakeSlice: negative capreflect.MakeSlice: negative lenreflect: NumIn of non-func typeremove [OPTIONS]reporting error for %v: %s (%t)resetspinning: not a spinning mresolver returned new addressesruntime: cannot allocate memoryruntime: split stack overflow: s3.ap-northeast-1.amazonaws.coms3.ap-southeast-1.amazonaws.coms3.ap-southeast-2.amazonaws.comsignal_recv: inconsistent statesotypeToNet unknown socket typesquare root of negative operandssh: DH parameter out of boundsssh: cannot parse IP address %qssh: elliptic.Unmarshal failuressh: max packet length exceededssh: remote side wrote too muchssh: unsupported ecdsa key sizestatus code: %d, request id: %sstreamlocal-forward@openssh.comtime: missing unit in duration timestamp: %v after 10000-01-01timestamp: %v before 0001-01-01tls: ECDSA verification failuretls: no certificates configuredtls: unsupported public key: %Ttoo many authentication methodstransaction already in progressunable to compress wire messageunable to decode message lengthunable to parse output line: %sunexpected EOF in CDATA sectionunknown compression algorithm: unknown timestamp format name, unterminated character constantvalue has type %s; should be %swarnings.Collector already doneweb.access_control_allow_originwhile scanning a %TAG directivewriteBytes with unfinished bitsx509: certificate is valid for x509: malformed DEK-Info headeryaml_BLOCK_SEQUENCE_START_TOKENyaml_PARSE_DOCUMENT_START_STATEzero length signature subpacket flags_with_completion+=(%q) must_have_one_flag+=("-%s") (types from different packages)$argon2i$v=%d$m=%d,t=%d,p=%d$%s$%s %s Author: %s Date: %s %s %s %s (fetch) %[1]s %[3]s (push)%v is not one of supported types* not allowd in blacklist config/api/namespace/:name/clone/:from/api/namespace/:name/tag/:taskid/api/webhook/delete/pipeline/:id/api/webhook/update/pipeline/:id/etc/pki/tls/certs/ca-bundle.crt28421709430404007434844970703125Cannot copy unknown BSON type %sCannot read unknown BSON type %sCounterClockwiseContourIntegral;CreateGlobalSecondaryIndexActionDeleteGlobalSecondaryIndexActionDescribeGlobalTableSettingsInputMissing mandatory parameter nameMultiple ,inline maps in struct NoHostAuthenticationForLocalhostNumber of PubSub messages nackedNumber of PubSub messages pulledNumber of ack-deadlines modifiedOther tasks in the chain failed!PointInTimeRecoverySpecificationResolver state updated: %+v (%v)SIGFPE: floating-point exceptionSIGTTOU: background write to ttyTLS_ECDHE_ECDSA_WITH_RC4_128_SHATask error: %s Will retry in: %sUnsupported KDF reserved field: UpdateGlobalSecondaryIndexActionUpload with bandwidth limit of: Value %d for key %s out of rangeYou need to define a pipeline id__%s_handle_subdirs_in_dir_flag a branch named %q already existsagent: generic extension failureapi.ecr.ap-south-1.amazonaws.comapi.ecr.eu-north-1.amazonaws.combootstrap type already present: bufio: invalid use of UnreadBytebufio: invalid use of UnreadRunebufio: tried to fill full buffercannot create 'subscription' keycannot decode %v into a *url.URLcannot decode %v into a DateTimecannot represent time as UTCTimecapabilities delimiter not foundchacha20: invalid buffer overlapchacha20poly1305: bad key lengthclog: register duplicated mode 'conq: repository does not exist.crypto/aes: input not full blockcrypto/des: input not full blockdatabase name cannot contain ' 'database name cannot contain '.'delete [task|pipeline]did not find expected ',' or ']'did not find expected ',' or '}'did not find expected whitespacediscord: builddiscordPayload: %vduration: %v: nanos out of rangeed25519: bad public key length: error SASLprepping password '%s'error getting raw connection: %vexpected end of string, found %qexpected: IDENT | STRING got: %sfound incompatible YAML documentgchelper not running on g0 stackgo package net: hostLookupOrder(google.protobuf.EnumValueOptionsgoogle.pubsub.v1.GetTopicRequestgoogle.pubsub.v1.PublishResponsegoogle.pubsub.v1.ReceivedMessagegoogle/protobuf/descriptor.protogoogle/protobuf/field_mask.protogrpc.io/client/roundtrip_latencygrpc: error while marshaling: %vhttp2: invalid header field namehttp2: server ignoring frame: %vin literal false (expecting 'a')in literal false (expecting 'e')in literal false (expecting 'l')in literal false (expecting 's')inactivity time exceeded timeoutincomplete UTF-16 surrogate pairinvalid range: failed to overlapissuer subpacket with bad lengthkeys cannot contain %c characterknownhosts: missing host patternmalformed character constant: %smessage field %s without pointermime: expected token after slashmime: invalid boundary characterno keys were provided for lookupnode %s shared between templatesnon-Go code disabled sigaltstacknumerical argument out of domainobject %s type %s tag %s tagger panic while printing panic valuepasslib.scryptsha256.verifyCallsproto: bad default uint32 %q: %vproto: bad default uint64 %q: %vproto: don't know how to copy %vproto: oneof field has nil valueproto: required field %q not setquery failure - cursor not foundrds.ap-northeast-1.amazonaws.comrds.ap-southeast-1.amazonaws.comrds.ap-southeast-2.amazonaws.comread limit of %d bytes exhaustedreflect.MapOf: invalid key type reflect.nameFrom: tag too long: reflect: NumOut of non-func typeremovespecial on invalid pointerresource temporarily unavailableruntime: mcall function returnedruntime: newstack called from g=runtime: stack split at bad timeruntime: sudog with non-nil elemruntime: sudog with non-nil nextruntime: sudog with non-nil prevscanstack: goroutine not stoppedscrypt: parameters are too largesignature doesn't have an issuersoftware caused connection abortsqs-fips.us-east-1.amazonaws.comsqs-fips.us-east-2.amazonaws.comsqs-fips.us-west-1.amazonaws.comsqs-fips.us-west-2.amazonaws.comssh-ed25519-cert-v01@openssh.comssh: cancel-tcpip-forward failedssh: trailing junk in public keyssh: unsupported DSA key size %dstdtime is not time.Time, but %Tsts-fips.us-east-1.amazonaws.comsts-fips.us-east-2.amazonaws.comsts-fips.us-west-1.amazonaws.comsts-fips.us-west-2.amazonaws.comsts.ap-northeast-2.amazonaws.comsubkey signature with wrong typesweep increased allocation countsync: Unlock of unlocked RWMutexsync: negative WaitGroup countertimeseries: bad level argument: timestamp: %#v after 10000-01-01timestamp: %#v before 0001-01-01tls not supported by this clienttls: NextProtos values too largetls: failed to parse private keytls: unknown Renegotiation valuetls: unknown signature algorithmtoo many log files for yesterdaytotal sampling factors too largetransform: short internal bufferunable to parse %s as net.IPMaskunescaped < inside quoted stringunexpected multi-line response: unexpected null character (0x00)unfinished JS regexp charset: %qunimplemented Value for type: %sunsupported tag object target %quse of closed network connectionuser ID self-signature invalid: username or password not allowedversion parameter (v) is missingwhile parsing a block collectionwhile scanning a %YAML directivex509: ECDSA verification failurex509: cannot parse rfc822Name %qx509: invalid constraint value: x509: invalid private key lengthx509: unknown SignatureAlgorithmx509: unsupported elliptic curve Can't attach to any live stream. of method on nil interface value%s must be formatted as key=value'%s' expected type '%s', got '%s'/api/tasks/stream_output/:id/:pos142108547152020037174224853515625710542735760100185871124267578125Attempting to read in config fileCalled Execute() on a nil CommandChangeMessageVisibilityBatchInputChannel Connectivity change to %vCreating circular reference aliasError: Logrus exit handler error:If-clause cannot print statementsMissing mandatory parameter emailNo terminfo file(-location) foundRegisterMapType(%T, %q); want mapSIGCHLD: child status has changedSIGTTIN: background read from ttySIGXFSZ: file size limit exceededUnsupported compression format %sYou need to define a storage namean inserted document is too largeanchor '%s' value contains itselfapplication/x-www-form-urlencodedarchive/tar: cannot encode headerarchive/tar: unknown file mode %vbacktrack called for a RuneReaderbytes.Buffer.Grow: negative countbytes.Reader.Seek: invalid whencecannot connect to Docker endpointcannot decode %v into a DBPointercannot decode %v into a Timestampcannot decode %v into a time.Timecannot decode %v into an ObjectIDcannot have two dots in one floatcannot index slice/array with nilcannot unmarshal %#q into enum %sconcurrent map read and map writeconnection not allowed by rulesetcrypto/aes: output not full blockcrypto/des: output not full blockcrypto: requested hash function #delta could not be found in cachedid not receive OP_REPLY responsedocument end is missing null byteduration: %#v: nanos out of rangeed25519: bad private key length: empty revocation reason subpacketerror converting JSON to YAML: %serror converting YAML to JSON: %verror parsing '%s' for field '%s'error reading .dockerignore: '%s'expected nothing after STREAM-ENDfailed decoding JSON RPC responsefindrunnable: negative nmspinningflag accessed but not defined: %sflag needs an argument: %q in -%sforwarded-streamlocal@openssh.comfreeing stack not in a stack spangoogle.iam.v1.BindingDelta_Actiongoogle.iam.v1.GetIamPolicyRequestgoogle.iam.v1.SetIamPolicyRequestgoogle.protobuf.FileDescriptorSetgoogle.protobuf.GeneratedCodeInfogoogle.pubsub.v1.ExpirationPolicygrpc.io/client/sent_bytes_per_rpcgrpc.io/server/sent_bytes_per_rpcgrpc: error while compressing: %vgrpc: the server has been stoppedheapBitsSetType: unexpected shifthttp2: invalid header field valuehttp2: invalid pseudo headers: %vhttp2: recursive push not allowedhttp: CloseIdleConnections calledhttp: error reading directory: %vhttp: invalid Read on closed Bodyhttp: multiple registrations for https://github.com/streadway/amqpincompatible types for comparisonindefinite length found (not DER)invalid concurrent Body.Read callinvalid exponent (missing digits)invalid username/password versioninvalid value %q for flag -%s: %vjsCtxRegexpjsCtxDivOpjsCtxUnknownknownhosts: SplitHostPort(%s): %vleafCounts[maxBits][maxBits] != nmalformed change: nil from and tomeasurable cannot have empty namememcache: no statistics availablemisrounded allocation in sysAllocmultiple indexes would be droppednegative size on header-only typenet/http: skip alternate protocolno matching entries in group fileopencensus.io/http/client/latencyopencensus.io/http/server/latencyoperating system is not supportedpad size larger than data payloadpasslib.ctx.successfulVerifyCallsproperties: error fetching %q. %sproto.Merge(%T, %T) type mismatchproto: bad default float32 %q: %vproto: bad default float64 %q: %vproto: type must have kind structproxy is disabled for the addresspseudo header field after regularredigo: connection pool exhaustedreflect.nameFrom: name too long: reflect: ChanDir of non-chan typereflect: Field index out of rangereflect: Field of non-struct typereflect: array index out of rangereflect: slice index out of rangeregexp: unhandled case in compileruntime: castogscanstatus oldval=runtime: epollcreate failed with runtime: failed MSpanList_Insert runtime: goroutine stack exceeds runtime: memory allocated by OS [runtime: name offset out of rangeruntime: text offset out of rangeruntime: type offset out of rangesending flush-pkt after haves: %sssh: must specify HostKeyCallbackssh: port number out of range: %dstackalloc not on scheduler stackstoplockedm: inconsistent lockingstruct contains unexported fieldssync: RUnlock of unlocked RWMutextimeseries: start > finish, %v>%vtls: failed to write to key log: tls: unexpected ServerKeyExchangetls: unknown public key algorithmtoo many Answers to pack (>65535)too many levels of symbolic linkstransport: Error while dialing %vtransport: malformed time-out: %vtreap insert finds a broken treaptreap node with nil spanKey foundunexpected EOF before any commandunknown shorthand flag: %q in -%swaiting for unsupported file typewhile scanning for the next tokenx509: no DEK-Info header in blockyaml_PARSE_DOCUMENT_CONTENT_STATEyaml_PARSE_FLOW_MAPPING_KEY_STATE{"$regularExpression":{"pattern":!! Error in destroying the machine$argon2i$v=%d$m=%d,t=%d,p=%d$%s$%s%s %q is excluded by constraint %q%s %s Tagger: %s Date: %s %s %s%s: %s asked for 'key', impossible%s: unsupported type to struct: %s(^0x_)|([^\da-f]_|_[^\da-f])|_$|^_/etc/ssl/certs/ca-certificates.crt3552713678800500929355621337890625Attempting to merge in config fileBad method frame, unknown class %dCommand can't be a child of itselfDownload with bandwidth limit of: Error: No task associated with id ErrorCode %v is already registeredFailed to append %q to RootCAs: %vFailed to unmarshal task state: %sFlag --%s has been deprecated, %s Huffman table has excessive lengthMHeap_AllocLocked - MSpan not freeMSpan_EnsureSwept: m is not lockedNegative number in DiffFromDelta: Other_Default_Ignorable_Code_PointRemove a given path from a storageSIGURG: urgent condition on socketTLS_ECDHE_RSA_WITH_AES_128_CBC_SHATLS_ECDHE_RSA_WITH_AES_256_CBC_SHATar: Can't stat file %s to tar: %sTrying to resolve absolute path toUse specific profile for call API.adding nil Certificate to CertPoolapi.ecr.ca-central-1.amazonaws.comapi.ecr.eu-central-1.amazonaws.comarchive/tar: header field too longarchive/tar: sockets not supportedargon2: number of rounds too smallargon2: parallelism degree too lowarray of non-uint8 in field %d: %Tattempted to parse unknown event: autoscaling.{region}.amazonaws.comawssdk.shared.UnmarshalDiscardBodybad offset for OFS_DELTA entry: %dbad pointer in byte slice case in blank value not supported for typecan't evaluate field %s in type %scan't handle %s for arg of type %scannot call abortTransaction twicecannot decode %v into an Undefinedcannot squash non-struct type '%s'clog: unable to write message: %v control characters are not allowedcrypto/aes: invalid buffer overlapcrypto/blowfish: invalid key size crypto/des: invalid buffer overlapcrypto/rsa: missing public modulusdid not find expected node contentdriver: remove argument from queryduration: %v: seconds out of rangeerror setting option on socket: %vexecutable file not found in $PATHexecution of %v was successful: %sexpected attribute name in elementexpected comma after array elementexpected exactly %d bits of resultflag provided but not defined: -%sflowrate: flow rate limit exceededforEachP: sched.safePointWait != 0google.protobuf.FieldOptions_CTypegoogle.pubsub.v1.ListTopicsRequestgoogle.pubsub.v1.Topic.LabelsEntrygot nil pointer for service configgrpc: message too large (%d bytes)http2: aborting request body writehttp: MultipartReader called twicehttp: connection has been hijackedhttp: invalid Content-Length of %qhttp: persistConn.readLoop exitinghttp: read on closed response bodyi/o operation on closed connectionillegal base64 data at input byte in \u hexadecimal character escapeincorrect mode to end document: %sinvalid OP_REPLY: []byte too smallinvalid length of a UTF-8 sequenceinvalid nested repetition operatorinvalid or unsupported Perl syntaxinvalid padding bits in BIT STRINGmalformed OP_MSG: invalid documentname too long (%d bytes): %.20q...newWriterAndRequestNoBody(%+v): %vno corresponding route to be namedno matching entries in passwd filenotify: short read in readEvents()one-pass-signature packet version properties: %s not found. skippingproto: duplicate enum registered: proto: tag has too few fields: %q proto: unexpected type %T in oneofprotobuf tag not enough fields in pubsub: error creating tag map: %vreference has changed concurrentlyreflect.FuncOf: too many argumentsreflect: Field index out of boundsreflect: Method index out of rangereflect: recv on send-only channelreflect: send on recv-only channelreflect: string index out of rangeremote names don't match: %s != %sruntime.SetFinalizer: cannot pass runtime: g is running but p is notruntime: unexpected return pc for s3-control.eu-west-1.amazonaws.coms3-control.eu-west-2.amazonaws.coms3-control.eu-west-3.amazonaws.coms3-control.sa-east-1.amazonaws.coms3-control.us-east-1.amazonaws.coms3-control.us-east-2.amazonaws.coms3-control.us-west-1.amazonaws.coms3-control.us-west-2.amazonaws.comschedule: spinning with local worksemaphore: released more than heldsnappy: decoded block is too largesnappy: unsupported literal lengthspan and treap sizes do not match?sqrtDirect: only for z.prec <= 128ssh: certificate serial %d revokedssh: must Accept or Reject channelssh: normal key pairs not acceptedstream error: stream ID %d; %v; %vtable array key cannot contain ']'timeout waiting for client prefacetls: unknown record type requestedtoo many references: cannot splicetransport: error while dialing: %vunescaped ]]> not in CDATA sectionunsupported authentication method v3 public key modulus is too shortvalue is nil; should be of type %sworktree contains unstaged changesx509: unhandled critical extensionyaml_PARSE_BLOCK_MAPPING_KEY_STATE{"$timestamp":{"t":"%s","i":"%s"}}{"pattern": "%s", "options": "%s"}%\?(.*)%t(.*)%e(.*);|%\?(.*)%t(.*);%d response missing Location header%s: not an object type for map (%T)%s: unknown kind to decode into: %s%s: unsupported type for squash: %s/api/namespace/:name/append/:taskid177635683940025046467781066894531252006-01-02T15:04:05.000000000Z07:002006-01-02T15:04:05.999999999Z07:0088817841970012523233890533447265625===================================CONTINUATION frame with stream ID 0Client request count by HTTP methodClientConn switching balancer to %qCount of RPCs by method and status.Error SASLprepping authzID '%s': %vError parsing Include directive: %vError while reading from Writer: %sErrorValue %q is already registeredFailed delivery of delivery tag: %dFailed delivery of delivery tag: %vInvalid type for: %v, expected: %#vJSON value is not a structure (%#v)MHeap_FreeSpanLocked - invalid freeNo cached image found locally for 'Not enough parameters to increment.Prohibited TLS 1.2 Cipher Suite: %xReplicaProvisionedReadCapacityUnitsServer request count by HTTP methodTLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHAUnsupported Remote Provider Type %qWrite called after Handler finishedX-Amz-Copy-Source-If-Modified-SinceYou need to define a namespace nameagent: too many keys in agent replyapi.ecr.cn-north-1.amazonaws.com.cnapi.ecr.us-gov-east-1.amazonaws.comapi.ecr.us-gov-west-1.amazonaws.comattribute name without = in elementbad successive approximation valuesbad type for XXX_extensions field: bson.Element{[%s]"%s": }bundler reached buffered byte limitbytes: Repeat count causes overflowcannot decode %v into a json.Numbercannot decode %v into a string typecannot start number with underscorechacha20: output smaller than inputcommand returned multiple documentscould not find region configurationcrypto/blake2b: cannot marshal MACscrypto/md5: invalid hash state sizedid not find expected '-' indicatorduration: %#v: seconds out of rangedynamic table size update too largeed25519: cannot sign hashed messageencoding/hex: odd length hex stringes-fips.us-gov-west-1.amazonaws.comexpected unsigned integer; found %sfail to rename rotate file '%s': %vfailed to compute request body sizefile type does not support deadlinefindfunc: bad findfunctab entry idxfindrunnable: netpoll with spinningflate: corrupt input before offset form-data; name="%s"; filename="%s"found extremely long version numberfound unexpected document indicatorgoogle.protobuf.EnumDescriptorProtogoogle.protobuf.FieldOptions_JSTypegoogle.protobuf.FileDescriptorProtogoogle.protobuf.UninterpretedOptiongoogle.pubsub.v1.AcknowledgeRequestgoogle.pubsub.v1.DeleteTopicRequestgoogle.pubsub.v1.GetSnapshotRequestgoogle.pubsub.v1.ListTopicsResponsegoogle.pubsub.v1.UpdateTopicRequestgreyobject: obj not pointer-alignedgrpc: failed IP parsing due to %v. gzip.Write: Extra data is too largegzip: invalid compression level: %dhandshake should have had a result.hash/crc32: invalid hash state sizehpack: invalid Huffman-encoded datahttp2: server processing setting %vhttp2: server: client %v said hellohttp: server closed idle connectioninternal error: unknown node kind: invalid argument %q for %q flag: %visReflexive called on non-key type item size exceeds bundle byte limitkms-fips.ca-central-1.amazonaws.comline %d: key %#v already set in mapmalformed change: empty from and tomemcache: compare-and-swap conflictmime: bogus characters after %%: %qmime: invalid RFC 2047 encoded-wordmust not contains consecutively "/"must set the input source only oncenegative timestamps are not allowednetwork dropped connection on resetno such multicast network interfacenon-positive interval for NewTickeronly PAX supports TypeXGlobalHeaderos/signal: Notify using nil channelpersistentalloc: align is too largepidleput: P has non-empty run queueproperties: invalid content type %sproto: internal error: bad wiretypeproto: message encodes to over 2 GBprotobuf tag field not an integer: redigo: unexpected value for Uint64reflect.MakeSlice of non-slice typeresolveTable item not yet handled: revision suffix brace component, %sruntime: close polldesc w/o unblockruntime: inconsistent read deadlines3-control.ap-south-1.amazonaws.coms3-control.eu-north-1.amazonaws.coms3-fips-us-gov-west-1.amazonaws.comserver does not support delete-refsssh: extended code %d unimplementedssh: invalid packet length multiplessh: junk character in version linessh: no key material for msgNewKeysssh: parse error in message type %dstring data too long for buffer: %dstrings.Reader.Seek: invalid whencesuperfluous leading zeros in lengthsymbolic reference target not foundtoo many Questions to pack (>65535)topology is connected or connectingtraceback did not unwind completelytransform: short destination buffertransport endpoint is not connectedunclosed right paren: unexpected %sunexpected deepen specification: %qunimplemented HCLToken for type: %sunsigned integer overflow on token unsupported cipher in private key: volume in use and cannot be removedx509: decryption password incorrectxml: comments must not contain "--"yaml_PARSE_FLOW_MAPPING_VALUE_STATEyield called with no layout definedzlib: invalid compression level: %d LastStreamID=%v ErrCode=%v Debug=%q%s is not a method but has arguments%s is not a valid character constant%s: cannot decode into interface: %T) inline map must have a string keys+refs/heads/%s:refs/remotes/%s/%[1]s0123456789abcdefghijklmnopqrstuvwxyz4440892098500626161694526672363281256ba7b810-9dad-11d1-80b4-00c04fd430c86ba7b811-9dad-11d1-80b4-00c04fd430c86ba7b812-9dad-11d1-80b4-00c04fd430c86ba7b814-9dad-11d1-80b4-00c04fd430c8Channel switches to new LB policy %qClient response count by status codeDEBUG: %s %s/%s failed, %s, error %vError SASLprepping password '%s': %vError SASLprepping username '%s': %vError on download data from storage Go pointer stored into non-Go memoryHeader called after Handler finishedHeartbeats should not have a payloadIA5String contains invalid characterJanFebMarAprMayJunJulAugSepOctNovDecMStats vs MemStatsType size mismatchMissing mandatory parameter passwordRemove a given path from a namespaceServer response count by status codeSpecify the storage path in the taskSubchannel Connectivity change to %vTLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHATLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHATLS_ECDHE_RSA_WITH_CHACHA20_POLY1305Time.UnmarshalBinary: invalid length configfile: %s %s %s %s %s %s ^@@ -(\d+),?(\d*) \+(\d+),?(\d*) @@$__%s_handle_filename_extension_flag a SubChannel's parent id cannot be 0accessing a corrupted shared libraryadding %s:%s to remote provider listall SubConns are in TransientFailureany: message type %q isn't linked inapi.ecr.ap-northeast-1.amazonaws.comapi.ecr.ap-northeast-2.amazonaws.comapi.ecr.ap-southeast-1.amazonaws.comapi.ecr.ap-southeast-2.amazonaws.comarchive/tar: missed writing %d bytesbad magic value in continuation filebad pointer or slice in map case in bytes.Reader.ReadAt: negative offsetbytes.Reader.Seek: negative positioncannot parse '%s', %d overflows uintcannot parse '%s', %f overflows uintcannot read hash, pkt-line too shortcannot unmarshal %s into a bsonx.Doccloud.google.com/go/pubsub/ack_countcompressed name in SRV resource datacross-signature has unexpected type crypto/cipher: input not full blockscrypto/rand: argument to Int is <= 0crypto/sha1: invalid hash state sizecrypto/sha512: invalid hash functiondid not find expected did not find expected version numberdownload [OPTIONS]dynamodb.us-gov-west-1.amazonaws.comexceeded maximum template depth (%v)expected MD5 checksum '%s', got '%s'expiration subpacket with bad lengthfilename may not have trailing slashglob pattern did not match any filesgoogle.protobuf.FieldDescriptorProtogoogle.protobuf.OneofDescriptorProtogrpc.io/client/sent_messages_per_rpcgrpc.io/server/sent_messages_per_rpchttp2: server rejecting conn: %v, %shttp: no Location header in responsehttp: unexpected EOF reading trailerhttp://www.w3.org/XML/1998/namespaceinternal error: associate not commoninvalid boolean value %q for -%s: %vinvalid characters in heredoc anchorkey size not a multiple of key alignkms-fips.us-gov-west-1.amazonaws.comknownhosts: missing key type patternmalformed MIME header initial line: malformed OP_REPLY: invalid documentmarkrootSpans during second markrootmime: SetBoundary called after writemultiplication of zero with infinitymust set the output target only oncenegative bucket bounds not supportednil receiver passed to UnmarshalJSONno acceptable authentication methodsopencensus.io/http/client/sent_bytesparallelism parameter (p) is missingpeer header list size exceeded limitproperties: %s returned %d. skippingproto: textWriter unindented too farreflect: IsVariadic of non-func typereflect: NumField of non-struct typereflect: funcLayout of non-func typeruntime: bad notifyList size - sync=runtime: inconsistent write deadlineruntime: invalid pc-encoded table f=runtime: invalid typeBitsBulkBarrierruntime: mcall called on m->g0 stackruntime: sudog with non-nil waitlinkruntime: unblock on closing polldescruntime: wrong goroutine in newstacksignal arrived during cgo execution ssh: StdinPipe after process startedssh: no authorities for hostname: %vssh: overflow reading version stringssh: tcpChan: deadline not supportedstdtime is not time.Duration, but %Tstrings.Builder.Grow: negative countsyntax error scanning complex numbertls: keys must have at least one keytoo few bytes to read next componenttransport: malformed grpc-status: %vtransport: malformed http-status: %vuids and gids must be in range %d-%dunable to cast %#v of type %T to intunable to unmarshal region regex, %vuncaching span but s.allocCount == 0unknown problem parsing YAML contentunsupported SSLv2 handshake receivedwrong number of args: got %d want %dx509: zero or negative DSA parameterxml: %s chain not valid with %s flagxml: end tag without start tagyaml_PARSE_BLOCK_MAPPING_VALUE_STATEyaml_PARSE_FLOW_SEQUENCE_ENTRY_STATE local_nonpersistent_flags+=("--%s%T is not a valid BSON type to encode%T.%s cannot be a direct struct value%q is an incomplete or empty template%v.%s cannot be a direct struct value) is smaller than minimum page size (/google.iam.v1.IAMPolicy/GetIamPolicy/google.iam.v1.IAMPolicy/SetIamPolicy2220446049250313080847263336181640625Error connecting to SSH_AUTH_SOCK: %vFailed processing task %s. Error = %vGem::Requirement::BadRequirementErrorLatency distribution of HTTP requestsNo commit message match regexp : "%s"Show artefacts belonging to a storageShow artefacts belonging to namespaceTLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384Task type ( default: docker_execute )The provided type is not an interfaceX-Amz-Copy-Source-If-Unmodified-Since_cgo_notify_runtime_init_done missingall goroutines are asleep - deadlock!autoscaling.{region}.amazonaws.com.cnawsdk.client.LogResponse.ResponseBodybad data: ignore can't handle type %sbad type for XXX_unrecognized field: binarylogging: failed to parse %q: %vbytes.Buffer: truncation out of rangecannot compute checksum. missing bodycannot decode %v into an integer typecannot exec a shared library directlycannot index slice/array with type %schacha20poly1305: plaintext too largecipher: message authentication failedcloud.google.com/go/pubsub/nack_countcloud.google.com/go/pubsub/pull_countcomment ends before closing delimiterconflicting rules for method %v foundcrypto/cipher: incorrect GCM tag sizecrypto/cipher: invalid buffer overlapcrypto/rsa: public exponent too largecrypto/rsa: public exponent too smallcrypto/rsa: unsupported hash functioncrypto: Size of unknown hash functiondereference of nil pointer of type %sexec: StdinPipe after process startedexpected DOCUMENT-START or STREAM-ENDexplicitly tagged member didn't matchfailed to parse binary log config: %vgob NewTypeObject can't handle type: google.protobuf.ExtensionRangeOptionsgoogle.protobuf.MethodDescriptorProtogoogle.pubsub.v1.ListSnapshotsRequestgoogle.pubsub.v1.MessageStoragePolicygoogle.pubsub.v1.PushConfig.OidcTokengoogle.pubsub.v1.Snapshot.LabelsEntrygoogle.pubsub.v1.StreamingPullRequestgrpc.binarylog.v1.GrpcLogEntry_Loggergrpc.io/client/received_bytes_per_rpcgrpc.io/server/received_bytes_per_rpcgzip.Write: non-Latin-1 header stringhash/adler32: invalid hash state sizehttp2: server encoding header %q = %qhttp: TLS handshake error from %s: %vincorrect header: opcode is not OpMsginfinite loop from %v to %v on %q..%qinvalid key found. remaining bytes=%vinvalid sequence nextpstrings: Repeat count causes overflowsubtle: slices have different lengthstoo many Additionals to pack (>65535)too many Authorities to pack (>65535)transport: missing content-type fieldtype not registered for interface: %sunable to cast %#v of type %T to Timeunable to cast %#v of type %T to boolunable to strip quotes from regex, %vunexpected CONTINUATION for stream %dunrecognized character in action: %#Uvalue too large for defined data typex509: RSA key missing NULL parametersx509: unsupported private key versionxml: bad type for comment field of %syaml_PARSE_BLOCK_SEQUENCE_ENTRY_STATE%s: not an object type for struct (%T)1110223024625156540423631668090820312555511151231257827021181583404541015625Branch and Hash are mutually exclusiveError on download artefacts from task Expected tColon or tNumber, received: Filename: %s requires valid extension.HTTP response body size (uncompressed)No such network (%s) or container (%s)ProvisionedThroughputExceededExceptionScan: unable to scan type %T into UUIDSize distribution of HTTP request bodySpecify the artefacts path in the taskTLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305"%s" found must be 0, 1 or 2 after "^"a NormalSocket's parent id cannot be 0after decimal point in numeric literalarg size to reflect.call more than 1GBbad number of `:` in symref value (%q)bundler: release: not an active ticketcan not access a needed shared librarycan't give argument to non-function %scancel-streamlocal-forward@openssh.comchacha20poly1305: ciphertext too largecodebuild-fips.us-east-1.amazonaws.comcodebuild-fips.us-east-2.amazonaws.comcodebuild-fips.us-west-1.amazonaws.comcodebuild-fips.us-west-2.amazonaws.comconcurrent map iteration and map writeconfig invalid key in remote or branchconflicting rules for service %v foundcould not find expected directive namecrypto/sha256: invalid hash state sizecrypto/sha512: invalid hash state sizedecode: corrupted data: negative deltadeprecated s2k function in private keydid not find expected does not appear to be a git repositoryempty name for remote field of type %sencoding alphabet is not 64-bytes longerror decoding json.Number into %s: %sevalEmptyInterface: nil (can't happen)exec: StderrPipe after process startedexec: StdoutPipe after process startedfailed to cleanup %q after destroy: %sfailed to parse Location header %q: %vfound an incorrect leading UTF-8 octetgcBgMarkWorker: blackening not enabledgob: DecodeValue of unassignable valuegob: unknown type id or corrupted datagoogle.protobuf.ServiceDescriptorProtogoogle.pubsub.v1.CreateSnapshotRequestgoogle.pubsub.v1.DeleteSnapshotRequestgoogle.pubsub.v1.ListSnapshotsResponsegoogle.pubsub.v1.StreamingPullResponsegoogle.pubsub.v1.UpdateSnapshotRequestgrpc: the client connection is closinghttp2: server connection from %v on %phttp: Accept error: %v; retrying in %vindirection through explicit nil in %sinline table cannot start with a commainsufficient data for base length typeinternal error: unknown string type %dinvalid hash size: expected %d, got %dinvalid type, must be number of stringline %d: cannot unmarshal %s%s into %sline %d: field %s not found in type %smakechan: invalid channel element typemalformed ref data: no space was foundmime: expected slash after first tokennested object expected: LBRACE got: %snet/http: invalid header field name %qnewline in format does not match inputnewline in input does not match formatno NT_GNU_BUILD_ID found in ELF binaryobject expected closing RBRACE got: %soptional.%s value should be %s, got %Tpartition: %q, service: %q, region: %qproto: can't skip unknown wire type %dproto: field %q contains invalid UTF-8proto: not an extendable proto.Messagereflect: Method on nil interface valuereflect: bad size computation in MapOfresult must be addressable (a pointer)route with given name already exists: runtime: blocked read on free polldescruntime: sudog with non-false isSelects3-control.cn-north-1.amazonaws.com.cns3-control.us-gov-east-1.amazonaws.coms3-control.us-gov-west-1.amazonaws.comscrypt: N must be > 1 and a power of 2session was not created by this clientsignature creation time not four bytessigning Entity must have a private keysigning key doesn't have a private keyspecification must be a struct pointerssh: first packet should be msgKexInitssh: first packet should be msgNewKeysssh: signature type %s for key type %sssh_config: max recurse depth exceededstrings.Reader.ReadAt: negative offsetstrings.Reader.Seek: negative positionsyscall: readInt with unsupported sizetemplate: %s: executing %q at <%s>: %stime: missing Location in call to Datetimed out waiting for server handshaketls: failed to sign ECDHE parameters: tls: invalid ClientKeyExchange messagetls: invalid ServerKeyExchange messagetls: missing ServerKeyExchange messagetls: server selected unsupported curvetls: unsupported signing key type (%T)translate-fips.us-east-1.amazonaws.comtranslate-fips.us-east-2.amazonaws.comtranslate-fips.us-west-2.amazonaws.comtransport: malformed grpc-tags-bin: %vunable to cast %#v of type %T to int32unable to cast %#v of type %T to int64unknown SymmetricallyEncrypted versionupload-pack-response should be decodeduser: Current not implemented on %s/%sx509: cannot validate certificate for x509: empty name constraints extensionx509: failed to parse EC private key: x509: trailing data after X.509 key-idxml: EncodeToken of invalid token type~/.ssh/known_hosts ~/.ssh/known_hosts2 because it doesn't contain any IP SANs%s can only encode valid %s, but got %s2006-01-02 15:04:05.999999999 -0700 MST277555756156289135105907917022705078125Branch is mandatory when Create is usedExpected object, got unknown token: %+vGobDecoder: length too large for bufferHttpRule.Pattern has unexpected type %TKind of Value for listener is not Func.MSpan_Sweep: bad span state after sweepMonitor tasks and propagate exit statusOnly string capabilities can be parsed.Percentile: percentile out of range: %fPerform pruning actions after executionSize distribution of HTTP response bodyTLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384Tar: Can't archive a file with includesThe following key was defined twice: %s\[(?:[0-9]{1,3}(?:;[0-9]{1,3})*)?[m|K]^[-+]?[0-9]*\.?[0-9]+([eE][-+][0-9]+)?$^[a-z][a-z][a-z]?(?:_[A-Z][A-Z])?\.(.+)api.ecr.cn-northwest-1.amazonaws.com.cnbad element kind in byte slice case in can't represent recursive pointer type cannot marshal invalid UTF-8 data as %scipher: incorrect tag size given to GCMcobra_annotation_bash_completion_customcodedeploy-fips.us-east-1.amazonaws.comcodedeploy-fips.us-east-2.amazonaws.comcodedeploy-fips.us-west-1.amazonaws.comcodedeploy-fips.us-west-2.amazonaws.comcould not create intermediate group: %scrypto/blake2b: invalid hash state sizecrypto/rsa: invalid options for Decryptcsv: invalid field or comment delimiterdid not find expected hexdecimal numberdocument invalid, last byte is not nulldownload [OPTIONS]duplicated ref found in packed-ref fileerror decoding upload-pack response: %serror while verifying cross-signature: expected space in input to match formatextraneous or missing " in quoted-fieldfound an incorrect trailing UTF-8 octetgo package net: using cgo DNS resolver gob: cannot encode nil pointer of type google.iam.v1.TestIamPermissionsRequestgoogle.protobuf.SourceCodeInfo.Locationgoogle.pubsub.v1.GetSubscriptionRequesthash cannot be represented in OpenPGP: http: putIdleConn: keep alives disabledinvalid header because []byte too smallinvalid indexed representation index %dmalformed refspec, separators are wrongmismatched count during itab table copymismatched message type: got %q want %qmissing argument to repetition operatormissing nul byte reading string sectionmissing verb: % at end of format stringmultipart: can't write to finished partnegative minwidth, tabwidth, or paddingnonce received did not match nonce sentopencensus.io/http/client/request_bytesopencensus.io/http/client/request_countopencensus.io/http/server/request_bytesopencensus.io/http/server/request_countout of memory allocating heap arena mappointer to unknown type in field %d: %Tproto: %s: illegal tag 0 (wire type %d)proto: duplicate extension registered: reflect.MakeMapWithSize of non-map typereflect: FieldByName of non-struct typereflect: unexpected GC program in MapOfresolver returned an empty address listroute with given name does not exists: runtime: blocked write on free polldescruntime: casfrom_Gscanstatus failed gp=runtime: function symbol table header: s3-control-fips.us-east-1.amazonaws.coms3-control-fips.us-east-2.amazonaws.coms3-control-fips.us-west-1.amazonaws.coms3-control-fips.us-west-2.amazonaws.coms3-control.ap-northeast-1.amazonaws.coms3-control.ap-northeast-2.amazonaws.coms3-control.ap-southeast-1.amazonaws.coms3-control.ap-southeast-2.amazonaws.comspan and treap node npages do not matchssh: invalid MaxPacketSize %d from peerssh: invalid window update for %d bytesssh: unsupported signature algorithm %sstack growth not allowed in system callstrings.NewReplacer: odd argument countsubkey packet not followed by signaturetags don't match (%d vs %+v) %+v %s @%dtemplate: pattern matches no files: %#qtoo few bytes to read next component: [trailing backslash at end of expressiontransport endpoint is already connectedtransport: malformed grpc-trace-bin: %vunable to cast %#v of type %T to stringunable to write wire message to networkunexpected token while parsing list: %sunknown problem generating YAML contentunknown type for path %s (%s): %T (%#v)username/password authentication failedwrite to hash function returned error: x509: failed to parse URI constraint %qx509: invalid NameConstraints extensionx509: only RSA and ECDSA keys supportedx509: trailing data after DSA signaturex509: trailing data after X.509 subjectx509: unknown EC private key version %dyaml_PARSE_FLOW_MAPPING_FIRST_KEY_STATE%s %q is not permitted by any constraint%s is not a valid static variables index%v(%T) is negative so does not fit in %v13877787807814456755295395851135253906256938893903907228377647697925567626953125Cannot have multiple embedded signaturesChangeMessageVisibilityBatchRequestEntryCouldn't read exec-path line all at onceExpected identifier, lbracket, or lbraceFailed pushing image to cache registry: Frame accessor called on non-owned FrameGlobalTableProvisionedWriteCapacityUnitsNumericString contains invalid characterReturned when a service is not availableTargetTrackingScalingPolicyConfigurationTask must return at least a single valueUnexpected error from context packet: %vUnsupported flag %q in tag %q of type %sVirtualBox is missing or not operational[Upload] Error while uploading artefact ^-?(?:\d{1,3}(?:,\d{3})*|\d+)(?:\.\d+)?$address family not supported by protocolan even number of tags must be specifiedblank output when reading home directorybulkBarrierPreWrite: unaligned argumentscannot decode %v into a primitive.Symbolcannot free workbufs when work.full != 0cannot perform a decoder lookup on cannot represent time as GeneralizedTimecloud.google.com/go/pubsub/mod_ack_countcouldn't parse data for vagrant type: %qcrypto/cipher: message too large for GCMcrypto/cipher: output smaller than inputcrypto/rsa: input must be hashed messagedeferproc: d.panic != nil after newdeferdownload [OPTIONS]ecdsa-sha2-nistp256-cert-v01@openssh.comecdsa-sha2-nistp384-cert-v01@openssh.comecdsa-sha2-nistp521-cert-v01@openssh.comelasticache-fips.us-west-1.amazonaws.comevictOldest(%v) on table with %v entriesgoogle.iam.v1.TestIamPermissionsResponsegoogle.protobuf.EnumValueDescriptorProtogoogle.protobuf.FileOptions_OptimizeModegoogle.pubsub.v1.ModifyPushConfigRequestgrpc.binarylog.v1.GrpcLogEntry_EventTypegrpc.io/client/received_messages_per_rpcgrpc.io/server/received_messages_per_rpcgrpc: TXT record %v missing %v attributehttp2: Transport encoding header %q = %qhttp2: invalid pseudo header in trailershttp2: timeout awaiting response headersincorrect header: op code is not OpQueryincorrect header: op code is not OpReplyinternal error: expecting non-nil streaminvalid field or value inside of a frameinvalid method name: should start with /key expiration subpacket with bad lengthline %d: field %s already set in type %smiddleware render hasn't been registeredmultipart: unexpected line in Next(): %qmust specify at least one name to exportnet/trace: Failed executing template: %vnet/trace: couldn't execute template: %vno error details for status with code OKopencensus.io/http/client/received_bytesopencensus.io/http/client/response_bytesopencensus.io/http/server/response_bytesoversized record received with length %dprovider %s does not support ExpiresAt()quotedprintable: invalid hex byte 0x%02xrefill of span with free space remainingreflect.Value.Call: call of nil functionreflect.Value.Call: wrong argument countreflect.Value.SetBytes of non-byte slicereflect.Value.setRunes of non-rune slicereflect: FieldByIndex of non-struct typereflect: bad layout computation in MapOfrequest header %q is not valid in HTTP/2runtime.SetFinalizer: first argument is runtime: out of memory: cannot allocate runtime: typeBitsBulkBarrier with type server nonce did not extend client nonceserver requested too few iterations (%d)ssh: can call Accept or Reject only oncessh: unexpected response to request: %#vthe index still hasn't finished buildingtime: Stop called on uninitialized Timertls: client didn't provide a certificatetransport: loopyWriter.run returning. %vunable to cast %#v of type %T to float64unexpected requesting %q status code: %dunsuported field type for default optionunsupported response wiremessage type %Tvalue size not a multiple of value alignwriteData(stream=%d, p=%d, endStream=%v)wrong type (%s) for received field %s.%sx509: cannot parse IP address of length x509: trailing data after DSA parametersx509: trailing data after DSA public keyx509: trailing data after RSA public keyx509: trailing data after X.509 KeyUsagexml: trailing '>' in field %s of type %syaml_PARSE_BLOCK_MAPPING_FIRST_KEY_STATEyaml_PARSE_IMPLICIT_DOCUMENT_START_STATE{service}.dualstack.{region}.{dnsSuffix} help [path to command] for full details. received on thread with no signal stack %(:[\ #\-\+]{0,4})?(\d+\.\d+|\d+)?[doxXs]%s is not a valid dynamic variables index%s slice too big: %d elements of %d bytes34694469519536141888238489627838134765625CloseNotify called after Handler finishedCopyFile: non-regular source file %s (%q)DEBUG: Retrying Request %s/%s, attempt %dInvalid diff operation in DiffFromDelta: Last return value of a task must be errorMHeap_FreeSpanLocked - invalid span stateMHeap_FreeSpanLocked - invalid stack freeOption ,inline needs a struct value fieldProfile %s with url %s added on file %s. ReplicaGlobalSecondaryIndexSettingsUpdateSeekRequest.Target has unexpected type %TTime.UnmarshalBinary: unsupported versionWriteHeader called after Handler finishedX-Amz-Server-Side-Encryption-Customer-KeyYou need to define a task id and a targetaddrConn: tryUpdateAddrs curAddrFound: %vagent: unsupported RSA key with %d primesanonymous remote name must be 'anonymous'asn1: internal error in parseTagAndLengthbinary: varint overflows a 64-bit integerboth pointer and slice for basic type in bytes.Buffer.WriteTo: invalid Write countbytes.Reader.WriteTo: invalid Write countcan't call pointer on a non-pointer Valuecannot handle non-pointer message type %vcannot match .dockerfile: '%s', error: %scould not parse forwarded-tcpip payload: crypto/md5: invalid hash state identifiererror while hashing for cross-signature: expected subsection name or right bracketfirst packet was not a public/private keyfound an indentation indicator equal to 0gcSweep being done but phase is not GCoffgiven identity string not found in Entitygob: attempt to decode into a non-pointergoogle.protobuf.FieldDescriptorProto_Typegoogle.pubsub.v1.ListSubscriptionsRequestgoogle.pubsub.v1.ModifyAckDeadlineRequestgoogle.pubsub.v1.Subscription.LabelsEntryhash/crc32: invalid hash state identifierhtml/template: cannot Parse after Executehttp2: invalid Upgrade request header: %qhttp2: no cached connection was availablehttp2: server ignoring unknown setting %vhttp: multiple response.WriteHeader callsid should be an int64 but it is a BSON %sidna: internal error in punycode encodinginvalid OP_REPLY: header length too smallinvalid target address %v, error info: %vinvariant; can't close stream in state %vjpeg: fill called when unread bytes existjson: error calling MarshalJSON for type knownhosts: got hash type %s, must be '1'listener already exists for docker eventsmap key needs to be a string, not %T (%v)message/group field %s:%s without pointernot enough fields in first server messageopencensus.io/http/client/completed_countopenpgp: signature made by unknown entityorganizations.us-gov-west-1.amazonaws.comprimary key cannot be used for signaturesprimary user id subpacket with bad lengthproperties: %s error reading response. %sproto: wrong wireType = %d for field Namereflect.Value.Addr of unaddressable valueruntime.SetFinalizer: second argument is runtime: blocked read on closing polldescruntime: typeBitsBulkBarrier without typesetCheckmarked and isCheckmarked disagreesigning subkey is missing cross-signaturessh: tcpip-forward request denied by peerssh: unexpected key exchange algorithm %vstopTheWorld: not stopped (stopwait != 0)strconv: illegal AppendInt/FormatInt basetime: Reset called on uninitialized Timertime: missing Location in call to Time.Intls: failed to parse client certificate #tls: failed to parse client certificate: tls: handshake has not yet been performedtls: no supported elliptic curves offeredtls: unsupported decryption key type (%T)trailing comma at the end of inline tabletransport got GOAWAY with error code = %vtransport: timeout string is too long: %qtrying to get %s value of flag of type %sunable to cast %#v of type %T to Durationunable to cast %#v of type %T to []stringunexpected token type in inline table: %sunmarshaler not found type:%s encoding:%swriteEndsStream called on nil writeFramerwrong type for value; expected %s; got %sx509: cannot parse URI %q: invalid domainx509: trailing data after ECDSA signaturex509: trailing data after X.509 extensionyaml_PARSE_FLOW_MAPPING_EMPTY_VALUE_STATE received but handler not on signal stack 173472347597680709441192448139190673828125867361737988403547205962240695953369140625Attempting to write configuration to file.Failed to parse goroutine ID out of %q: %vInvalid response from server, no 'n' fieldNo certs appended, using system certs onlyPRIORITY frame payload size was %d; want 5PrintableString contains invalid characterSCRAM message extensions are not supportedTime.MarshalBinary: unexpected zone offset^(\d+(\.\d+)*) ?([kKmMgGtTpP])?[iI]?[bB]?$acquireSudog: found s.elem != nil in cacheaddition of infinities with opposite signsapi-fips.sagemaker.us-east-1.amazonaws.comapi-fips.sagemaker.us-east-2.amazonaws.comapi-fips.sagemaker.us-west-1.amazonaws.comapi-fips.sagemaker.us-west-2.amazonaws.comarray out of bounds reading string sectionbad pointer or slice in interface case in cloudfront.cn-northwest-1.amazonaws.com.cncodecommit-fips.ca-central-1.amazonaws.comcould not grab NIC capabilities for %s: %scrypto/sha1: invalid hash state identifierdeprecated message for flag %q must be setfile size (%d) does not match src len (%d)function name %s is not a valid identifiergob: bad data: field numbers out of boundsgob: encoded unsigned integer out of rangegoogle.protobuf.FieldDescriptorProto_Labelgoogle.pubsub.v1.DeleteSubscriptionRequestgoogle.pubsub.v1.ListSubscriptionsResponsegoogle.pubsub.v1.ListTopicSnapshotsRequestgoogle.pubsub.v1.UpdateSubscriptionRequestheredoc expected second '<', didn't see ithttp2: server connection error from %v: %vhttp: ContentLength=%d with Body length %dhttp: multipart handled by MultipartReaderincorrect header: op code is not OpGetMoreinsufficient data for resource body lengthinternal error: no fields in evalChainNodeinvalid HTTP header value %q for header %qinvalid array: want %d elements but got %dinvalid key character after whitespace: %cinvalid response from server, no 'n' fieldlooking for beginning of object key stringmix of request and response pseudo headersno codec registered for content-subtype %son a locked thread with no template threadpersistentalloc: align is not a power of 2platform and architecture is not supportedpositioned on %s, but attempted to read %spromised request headers cannot include %qproto: duplicate proto type registered: %sproto: invalid google.protobuf.Any messageproto: wrong wireType = %d for field Valuequotedprintable: invalid bytes after =: %qread on body has reached the timeout limitreflect: Call with too few input argumentsrequested access to the resource is deniedruntime: blocked write on closing polldescs3-control.cn-northwest-1.amazonaws.com.cnsignature creation time in non-hashed areassh: certificate signature does not verifysubtraction of infinities with equal signssync/atomic: store of nil value into Valuetag --from [OPTIONS]timestamp: %v: nanos not in range [0, 1e9)tls: RSA signing requires a RSA public keytls: private key does not match public keytranslate-fips.us-gov-west-1.amazonaws.comtransport: timeout string is too short: %qtransport: unknown control message type %Tunexpected signal during runtime executionunknown critical signature subpacket type update (task|pipeline) [OPTIONS]was expecting token %s, but got %s insteadx509: %q cannot be encoded as an IA5Stringx509: RSA modulus is not a positive numberx509: trailing data after ECDSA parametersyaml_PARSE_FLOW_SEQUENCE_FIRST_ENTRY_STATEyaml_PARSE_INDENTLESS_SEQUENCE_ENTRY_STATE looking for beginning of object key string!!binary value contains invalid base64 data%s is an unexported field of struct type %s%v not available (make sure it is imported)'/' could start a division or regexp: %.32q/google.iam.v1.IAMPolicy/TestIamPermissionsAnagent handler must be a callable functionAppend artefacts from a task to a namespaceError enabling Transport HTTP/2 support: %vFlag shorthand -%s has been deprecated, %s GrpcLogEntry.Payload has unexpected type %TImage pushed to cache registry successfullyMacaron handler must be a callable functionSASL could not negotiate a shared mechanismTransport: unhandled response frame type %TX-Amz-Server-Side-Encryption-Aws-Kms-Key-IdYou need to define a namespace and a target[Download] Failed getting storage file listbad type for XXX_InternalExtensions field: base.baseBalancer: got new resolver state: bufio: tried to rewind past start of buffercannot convert stat value to syscall.Stat_tccResolverWrapper: sending update to cc: %vchannel binding requested but not supportedcodedeploy-fips.us-gov-east-1.amazonaws.comcodedeploy-fips.us-gov-west-1.amazonaws.comdid not find expected comment or line breakexpected public or private key block, got: explicit time type given to non-time memberfound character that cannot start any tokenfound invalid Unicode character escape codefound unexpected non-alphabetical charactergcBgMarkWorker: unexpected gcMarkWorkerModegoogle.pubsub.v1.ListTopicSnapshotsResponsegoogle.pubsub.v1.PushConfig.AttributesEntrygrpc: received unexpected payload format %dhash/adler32: invalid hash state identifierheapBitsSetTypeGCProg: unexpected bit counthtml/template: %q is an incomplete templatehttp2: server closing client connection: %vhttp2: too many 1xx informational responseshttp2: unexpected ALPN protocol %q; want %qhttp: response.Write on hijacked connectioninterrupted system call should be restartedinvalid string being converted to IPNet: %sknownhosts: hashed host must start with '|'multiple Read calls return no data or errornet/http: timeout awaiting response headersno multipart boundary param in Content-Typenon executable command in pipeline stage %dopencensus.io/http/client/roundtrip_latencyopentracing: Invalid Inject/Extract carrierpickfirstBalancer: failed to NewSubConn: %vproto: wrong wireType = %d for field Remotepubsub: Stop has been called for this topicreflect: Call with too many input argumentsreflect: CallSlice of non-variadic functionreflect: FieldByNameFunc of non-struct typereflect: nil type passed to Type.Implementsruntime.SetFinalizer: finalizer already setruntime.SetFinalizer: first argument is nilruntime: casfrom_Gscanstatus bad oldval gp=runtime: heapBitsSetTypeGCProg: total bits runtime: releaseSudog with non-nil gp.params3-control-fips.us-gov-east-1.amazonaws.coms3-control-fips.us-gov-west-1.amazonaws.comsecretsmanager-fips.us-east-1.amazonaws.comsecretsmanager-fips.us-east-2.amazonaws.comsecretsmanager-fips.us-west-1.amazonaws.comsecretsmanager-fips.us-west-2.amazonaws.comservicecatalog-fips.us-east-1.amazonaws.comservicecatalog-fips.us-east-2.amazonaws.comservicecatalog-fips.us-west-1.amazonaws.comservicecatalog-fips.us-west-2.amazonaws.comtar: cannot use whiteout for non-empty filetimeout waiting for SETTINGS frames from %vtimestamp: %#v: nanos not in range [0, 1e9)tls: client's Finished message is incorrecttls: unsupported signature algorithm: %#04xtransform: inconsistent byte count returnedunable to authenticate using mechanism "%s"unfinished escape sequence in JS string: %qunknown runnable goroutine during bootstrapworktree not available in a bare repositorywrong number of args for %s: want %d got %dx509: Common Name is not a valid hostname: x509: failed to parse dnsName constraint %qxml: invalid tag in field %s of type %s: %qyaml_PARSE_BLOCK_SEQUENCE_FIRST_ENTRY_STATE using value obtained using unexported fieldBiDi string can't have runes from category LNumber of calls opening a new streaming pullSubchannel picks a new address %q to connectSymmetricallyEncrypted: incorrect key lengthYou need to define a storage id and a targetcannot decode %v into a primitive.Decimal128cannot decode %v into a primitive.JavaScriptcannot have multiple equals for the same keycannot verify checksum. missing response MD5cipher: NewGCM requires 128-bit block cipherclone --from [OPTIONS]cloud.google.com/go/pubsub/stream_open_countconnection exceeded flow control window sizecould not be accessed in the remote catalog.crypto/sha256: invalid hash state identifiercrypto/sha512: invalid hash state identifierdid not find expected digit or '.' characterdocument size is larger than available byteselasticache-fips.us-gov-west-1.amazonaws.comencoding alphabet contains newline characterfailed to read authentication from dockercfgfailed waiting for successful resource stategcmarknewobject called while doing checkmarkgoogle.protobuf.GeneratedCodeInfo.Annotationgoogle.protobuf.UninterpretedOption.NamePartgrpc: ClientConn balancer wrapper was closedgrpc: failed dns A record lookup due to %v. html/template: pattern matches no files: %#qhttp2: could not negotiate protocol mutuallyhttp2: invalid Connection request header: %qhttp: Request.ContentLength=%d with nil Bodyhttp: putIdleConn: too many idle connectionsincorrect header: opcode is not OpCompressedinsufficient data for calculated length typeinvalid DocumentSequence: corrupted documentinvalid header/message length config: %q, %vinvalid response from server, no value fieldmapping keys are not allowed in this contextmemcache: no servers configured or availablemime: unexpected content after media subtypemultipart: expecting a new Part; got line %qneither tag nor implicit flags are specifiedout of memory allocating heap arena metadatapasslib.ctx.successfulVerifyCallsWithUpgradepredefined escaper %q disallowed in templatereflect: funcLayout with interface receiver reflect: slice length out of range in SetLenremove [OPTIONS]remove [OPTIONS]revocation signature signed by alternate keyssh: duplicate response received for channelssh: invalid packet length, packet too largessh: invalid packet length, packet too smalltemplate: multiple definition of template %qtls: failed to verify client's certificate: tls: server's Finished message was incorrecttransport: failed to write window update: %vunfinished escape sequence in CSS string: %quse of WriteTo with pre-connected connectionx509: internal error: cannot parse domain %q{"$binary":{"base64":"%s","subType":"%02x"}} (Client.Timeout exceeded while reading body)!! There was an error running virsh command: %q shorthand is more than one ASCII characterContainer ID %d cannot be mapped to a host IDExpected object value, got unknown token: %+vFailed to decode metadata header (%q, %q): %vGlobalTableGlobalSecondaryIndexSettingsUpdateHost ID %d cannot be mapped to a container IDNumber of retries of a stream send or receiveOnly a struct or map can be marshaled to TOMLProfile %s with master %s removed correctly. Task %s failed. Going to retry in %d seconds.X-Amz-Server-Side-Encryption-Customer-Key-Md5You need to define akey and a value to create[Download] Failed getting task artefacts list[a-z0-9]+(?:[.+_-][a-z0-9]+)*:[a-zA-Z0-9=_-]+accepts between %d and %d arg(s), received %dappend --from [OPTIONS]can't call method/function %q with %d resultscannot compute output context for template %scannot send after transport endpoint shutdowncapabilities %s and %s are mutually exclusiveccResolverWrapper: got new service config: %vcharacter string exceeds maximum length (255)cloud.google.com/go/pubsub/stream_retry_countcomma expected between fields in inline tablecontext: internal error: missing cancel errorcrypto/blake2b: invalid hash state identifierexitsyscall: syscall frame is no longer validfailed to parse %q as %v: extra characters %qgoogle.protobuf.DescriptorProto.ReservedRangeheapBitsSetType: called with non-pointer typehttp: multipart handled by ParseMultipartFormhttp: no Client.Transport or DefaultTransporthttp: putIdleConn: connection is in bad stateignore decode: corrupted data: negative deltainvalid request :path %q from URL.Opaque = %qinvalid sequence "--" not allowed in commentsjson.RawMessage: UnmarshalJSON on nil pointermalformed ref data: more than one space foundmalformed shallow prefix, found %q... insteadmath/big: cannot unmarshal %q into a *big.Intmath/big: cannot unmarshal %q into a *big.Ratneed field between two commas in inline tableparsing/packing of this section has completedprocessing key=%s, st=%v, tt=%v, sv=%v, tv=%vproto: internal error: bad wiretype for oneofproto: wrong wireType = %d for field Disabledreflect: internal error: invalid method indexreflect: nil type passed to Type.AssignableToruntime: failed MSpanList_Remove span.npages=ssh: only handshakeTransport can send kexInitssh: only handshakeTransport can send newKeysssh: unexpected message type %d (expected %d)tls: failed to find any PEM data in key inputtransform: input and output are not identicaltransport: failed to set TCP_USER_TIMEOUT: %vtransport: failed to write client preface: %vtransport: loopyWriter.run returning. Err: %vtransport: timeout unit is not recognized: %qunbuffered done channel passed in for type %Tunexpected payload while expecting a want: %qwrong number of args: got %d want at least %dx509: IP constraint contained invalid mask %xx509: certificate signed by unknown authorityzero length explicit tag was not an asn1.Flag(?i)[A-Z0-9._%+-]+@(?:[A-Z0-9-]+\.)+[A-Z]{2,6}>> No image could be fetched by cache registryCan't have quoted identifier as function name.Channel could not be put into confirm mode: %sCopyFile: non-regular destination file %s (%q)Directory inside repository url ( e.g. /test )Distribution of bytes sent per RPC, by method.Distribution of round-trip latency, by method.File: %s exists. Use WriteConfig to overwrite.GOAWAY close timer fired; closing conn from %vHTTP/1.1 204 No Content Connection: close HealthCheckFunc exits with unexpected error %vNo profile with name %s. I use default value. Server retry pushback specified to abort (%q).You need to define a webhook type, e.g. github"@" statement is not valid, could be : @{-}archive/tar: write non-NUL byte in sparse holebytes.Reader.UnreadByte: at beginning of slicecan't try ciphers with different block lengthscipher.NewCTR: IV length must equal block sizecipher.newCFB: IV length must equal block sizecould not resolve endpoint for unknown servicecredentials: rawConn is dispatched out of gRPCdid not find expected whitespace or line breakduration: %v is out of range for time.Durationexpected XXX_unrecognized to be of type []bytefirst path segment in URL cannot contain colonfunction called with %d args; should be 1 or 2google.protobuf.DescriptorProto.ExtensionRangegoogle.protobuf.MethodOptions_IdempotencyLevelgoogle.pubsub.v1.ListTopicSubscriptionsRequestgoogle.pubsub.v1.PubsubMessage.AttributesEntrygrpc: failed dns SRV record lookup due to %v. grpc: failed dns TXT record lookup due to %v. http2: Transport creating client conn %p to %vinternal error: cannot create stream with id 0invalid method name: suffix /method is missinginvalid reference, should be a tag or a branchinvalid slice length %d: exceeds input size %dinvalid string being converted to Bytes: %s %slength of string exceeds input size (%d bytes)mapping values are not allowed in this contextmath/big: mismatched montgomery number lengthsmemory reservation exceeds address space limitnet/http: too many 1xx informational responsespanicwrap: unexpected string after type name: proto: can't get size for unknown wire type %dreflect.Value.Slice: slice index out of boundsreflect: nil type passed to Type.ConvertibleToreflect: slice capacity out of range in SetCaprequest Content-Type isn't multipart/form-dataruntime: debugCallV1 called by unknown caller runtime: failed to create new OS thread (have runtime: name offset base pointer out of rangeruntime: panic before malloc heap initialized runtime: text offset base pointer out of rangeruntime: type offset base pointer out of rangesigning Entity's private key must be decryptedssh: unmarshal error for field %s of type %s%sstopTheWorld: not stopped (status != _Pgcstop)template: no files named in call to ParseFilestls: ECDSA signing requires a ECDSA public keytls: failed to parse certificate from server: tls: server chose an unconfigured cipher suitetransport: authentication handshake failed: %vunexpected token %s, was expecting a table keyunquoted or missing attribute value in elementupdate document must have at least one elementversion section has wrong number of parametersx509: cannot sign with hash function requestedx509: failed to parse rfc822Name constraint %qx509: failed to unmarshal elliptic curve pointx509: invalid elliptic curve private key value{"$dbPointer":{"$ref":%s,"$id":{"$oid":"%s"}}}%s appears in an ambiguous context within a URL) image from defined registry or from dockerhubCompleted check for group %s returned error: %sInvalid response from server, no 'cursor' fieldLaunching a worker with the following settings:Number gRPC StreamingPull request messages sentNumber of ModifyAckDeadline RPCs that timed outOnly pointer to struct can be marshaled to TOMLP has cached GC work at end of mark terminationSpecify a namespace the task will be started onTask %s failed. Going to retry in %.0f seconds.X-Amz-Server-Side-Encryption-Customer-Algorithm[FrameWriteRequest stream=%d, ch=%v, writer=%v]a write concern cannot have both w=0 and j=trueaddrConn: tryUpdateAddrs curAddr: %v, addrs: %vattempted to read bytes of unknown BSON type %vattempting to link in too many shared librariesbufio: reader returned negative count from Readcan't remove non-existent inotify watch for: %scannot decode %v into a float32 or float64 typecannot decode %v into a primitive.CodeWithScopecannot transform type %s to a BSON Document: %vchacha20poly1305: message authentication failedcloud.google.com/go/pubsub/stream_request_countcobra_annotation_bash_completion_subdirs_in_dirdocument size (%d) is larger than the max int32don't know how to serialize encrypted key type duration: %#v is out of range for time.Durationexpected section header or variable declarationexplicit string type given to non-string memberfailed to create empty dir %q after destroy: %sfirst record does not look like a TLS handshakefound a tab character that violates indentationgoogle.pubsub.v1.ListTopicSubscriptionsResponsegrpc: failed to get client hostname due to %v. http: server gave HTTP response to HTTPS clientincorrect header: message length is not correctinvalid header because OpCode is improperly setinvalid string length %d: exceeds input size %dinvalid type name length %d: exceeds input sizeknownhosts: negation without following hostnamemturk-requester-sandbox.us-east-1.amazonaws.comnet/http: Transport.DialTLS returned (nil, nil)object type not valid: %s. Object reference: %sproto: bad extended type; %v does not extend %vproto: wrong wireType = %d for field Privilegesprotocol error: received DATA on a HEAD requestpubsub: UpdateTopic call with nothing to updatereference must be defined once at the beginningreflect.Value.Slice3: slice index out of boundsreflect.Value.UnsafeAddr of unaddressable valuereflect: CallSlice with too few input argumentsserver selection error: %v current topology: %sstring does not end with null byte, but with %vtemplate: %q is an incomplete or empty templatethe provided hex string is not a valid ObjectIDtls: handshake did not verify certificate chaintls: incorrect renegotiation extension contentstls: preferredCurves includes unsupported curvewas a primary, but a new primary was discoveredwr.done != nil for write100ContinueHeadersFramex509: internal error: IP SAN %x failed to parse'%s' needs a map with string keys, has '%s' keysBad method frame, unknown method %d for class %dBiDi string last rune must have category R or ALCharsetReader returned a nil Reader for charset Int.GobDecode: encoding version %d not supportedP has unflushed stats at end of mark terminationProvisionedReadCapacityAutoScalingSettingsUpdateRat.GobDecode: encoding version %d not supportedRepository storer is not a storer.PackfileWriterThe box you're attempting to add already exists.Time.MarshalJSON: year outside of range [0,9999]Time.MarshalText: year outside of range [0,9999]Triggering chord for group %s returned error: %sa write concern must have at least one field setagent: signer and cert have different public keyambiguous integer value; must include '0' prefixbufio: writer returned negative count from Writecan not specify tags or max staleness on primarycan't install method/function %q with %d resultscannot call deleteSelfIfReady on a listen socketcannot call deleteSelfIfReady on a normal socketcannot create a ValueWriter from a nil io.Writercloud.google.com/go/pubsub/mod_ack_timeout_countcloud.google.com/go/pubsub/stream_response_countcrypto/rsa: key size too small for PSS signaturediscord: failed to send message after %d retriesdivision of zero by zero or infinity by infinityerror while trying to parse list within list: %sgrpc/binarylog/grpc_binarylog_v1/binarylog.protointernal error: should have a body in this stateinvalid HEAD target should be a branch, found %sinvalid shallow line length: expected %d, got %dinvalid string being converted to IP address: %smust provide at least one element in input slicenamespace should be a string but it is a BSON %snet/http: Hijack called after ServeHTTP finishedout points to big.Int, but defaultValue does notparsing/packing of this type isn't available yetproto: PluginSpec: illegal tag %d (wire type %d)proto: negative length found during unmarshalingproto: wrong wireType = %d for field Descriptionread preference in a transaction must be primaryreflect: CallSlice with too many input argumentsruntime: cannot map pages in arena address spacessh: unexpected response to channel request: %#vstrconv: illegal AppendFloat/FormatFloat bitSizethe provided transport is no longer valid to usetls: CloseWrite called before handshake completetls: server advertised unrequested NPN extensiontrailer header without chunked transfer encodingtransport: malformed grpc-status-details-bin: %vunable to parse version %q: %q is not an integerunexpected payload while expecting a shallow: %qx509: IP constraint contained value of length %dx509: internal error: URI SAN %q failed to parsex509: internal error: cannot parse constraint %qx509: trailing data after X.509 BasicConstraintsx509: trailing data after X.509 ExtendedKeyUsagex509: trailing data after X.509 authority key-idxml: EncodeToken of ProcInst with invalid Targetxml: end tag does not match start tag <%s>yaml_PARSE_FLOW_SEQUENCE_ENTRY_MAPPING_END_STATEyaml_PARSE_FLOW_SEQUENCE_ENTRY_MAPPING_KEY_STATE (Client.Timeout exceeded while awaiting headers)# bash completion for %-36s -*- shell-script -*- /etc/pki/ca-trust/extracted/pem/tls-ca-bundle.pemBiDi string first rune must have category R or ALExpected tQuotedIdentifier or tUnquotedIdentifierProvisionedWriteCapacityAutoScalingSettingsUpdateSOS length inconsistent with number of componentsTotal bytes received across all messages per RPC.[Download] Failed getting namespace artefact list":" statement is not valid, could be : :/bad interface encoding: name too large for bufferbinarylogging: failed to marshal status proto: %vbytes,1049,opt,name=default_host,json=defaultHostbytes,1050,opt,name=oauth_scopes,json=oauthScopescasgstatus: waiting for Gwaiting but is Grunnablechacha20poly1305: bad nonce length passed to Openchacha20poly1305: bad nonce length passed to Sealcollation cannot be set for server versions < 3.4crypto/tls: ExportKeyingMaterial context too longfirstBatch should be an array but it is a BSON %sgob: registering duplicate names for %s: %q != %qgob: registering duplicate types for %q: %s != %sgrpc: failed to unmarshal the received message %vhttp2: request body closed due to handler exitinghttp: response.WriteHeader on hijacked connectionhttp: wrote more than the declared Content-Lengthinternal error: fillWindow called with stale datainvalid memory address or nil pointer dereferenceinvalid or incomplete multibyte or wide charactermalformed refspec, mismatched number of wildcardsnet/http: Transport.Dial hook returned (nil, nil)newMTFDecoderWithRange: cannot have > 256 symbolsobjfile: declared data length exceeded (overflow)opencensus.io/http/client/request_count_by_methodopencensus.io/http/server/request_count_by_methodpanicwrap: unexpected string after package name: passlib.ctx.successfulVerifyCallsDeferringUpgradeproto: bad wiretype for map field: got %d want %dpublic key and signature use different algorithmsreflect.Value.Slice: slice of unaddressable arrayruntime.reflect_makemap: unsupported map key types.allocCount != s.nelems && freeIndex == s.nelemsserver closed the stream without sending trailersssh: certificate options are not in lexical orderssh: certificate signed by unrecognized authorityssh: incoming packet exceeds maximum payload sizestrconv: internal error, rest != 0 but needed > 0strconv: num > den< markerxml: EncodeToken of ProcInst containing ?> markerxml: cannot use RawToken from UnmarshalXML method{{%s}} branches end in different contexts: %v, %v%s has arguments but cannot be invoked as function/etc/ssh/ssh_known_hosts /etc/ssh/ssh_known_hosts2A measurable with the same name already exists: %sAMQP scheme must be either 'amqp://' or 'amqps://'DecodeJSONValue called with unknown EscapeMode, %vDistribution of bytes received per RPC, by method.Distribution of received bytes per RPC, by method.Float.GobDecode: encoding version %d not supportedNo such file or directory - getcwd (Errno::ENOENT)Unexpected token at the end of the expresssion: %sUnsupported public key algorithm used in signatureValueMarshaler returned a %v, but was expecting %v":" statement is not valid, could be : ::^[-+]?[0-9][0-9_]*(?::[0-5]?[0-9])+(?:\.[0-9_]*)?$attempt to execute system stack code on user stackbinarylogging: failed to marshal proto message: %vcannot subscribe to Topology that is not connectedccResolverWrapper: sending new addresses to cc: %vcobra_annotation_bash_completion_one_required_flagcrypto/cipher: incorrect nonce length given to GCMerror discarding object, discarded %d, expected %derror while trying to parse object within list: %sexpected: IDENT | STRING | ASSIGN | LBRACE got: %sgo package net: dynamic selection of DNS resolver google.pubsub.v1.CreateSnapshotRequest.LabelsEntrygot CONTINUATION for stream %d; expected stream %dgrpc: failed to decompress the received message %vgrpc: received message larger than max (%d vs. %d)hash config section has wrong number of parametershttp: not caching alternate protocol's connectionshttp: putIdleConn: CloseIdleConnections was calledhttp: suspiciously long trailer after chunked bodyinvalid uint data length %d: exceeds input size %dmallocgc called with gcphase == _GCmarkterminationmulti_ack and multi_ack_detailed are not supportednet/http: HTTP/1.x transport connection broken: %vnet/http: Transport failed to read from server: %vnet/http: invalid header field value %q for key %vrecursive call during initialization - linker skewredis: connection does not support ConnWithTimeoutreflect.Value.Slice3: slice of unaddressable arrayssh: cancel-streamlocal-forward@openssh.com failedssh: unsupported critical option %q in certificatessh_config: Match directive parsing is unsupportedtls: received unexpected CertificateStatus messagetransport: received the unexpected content-type %qtrying to send message larger than max (%d vs. %d)unable to cast %#v of type %T to map[string]stringunexpected payload while expecting a flush-pkt: %qupload [OPTIONS]x509: RSA public exponent is not a positive numberx509: missing ASN.1 contents; use ParseCertificateyaml_PARSE_BLOCK_NODE_OR_INDENTLESS_SEQUENCE_STATEyaml_PARSE_FLOW_SEQUENCE_ENTRY_MAPPING_VALUE_STATE'%s': source data must be an array or slice, got %sAutomatically to the specified namespace on successDelete a task or a pipeline associated to a webhookInvalid response from server, no 'firstBatch' fieldJSON decoder out of sync - data changing underfoot?SSH agent requested but SSH_AUTH_SOCK not-specifiedScanState's Read should not be called. Use ReadRuneSet state to 'retry' for task %s returned error: %sWARNING: Waiter %s encountered unexpected state: %sYou need to define a namespace and a path to delete"%s" is not a valid revision suffix brace componentarchive/tar: sparse file contains unreferenced dataargument to RegisterDefaultDecoders must not be nilargument to RegisterDefaultEncoders must not be nilargument to RegisterPrimitiveCodecs must not be nilbase.baseBalancer: failed to create new SubConn: %vcannot add a child (id = %d) of type %T to a servercreate [api-key] [OPTIONS]crypto/tls: reserved ExportKeyingMaterial label: %sethtool not installed. Cannot grab NIC capabilitiesfatal: systemstack called from unexpected goroutinegrpc: cannot create SubConn with empty address listhtml/template: no files named in call to ParseFileshttp2: invalid Transfer-Encoding request header: %qinsufficient selector indices for number of symbolsiterator: Next and NextPage called on same iteratoronly PAXRecords should be set for TypeXGlobalHeaderpickfirstBalancer: HandleSubConnStateChange: %p, %vproto: PluginSpec: wiretype end group for non-groupproto: bad extension number; not in declared rangesprotocol error: received %T before a SETTINGS framereceived %d-bytes data exceeding the limit %d bytesssh: peer's curve25519 public value has wrong orderstream terminated by RST_STREAM with error code: %vtls: VerifyHostname called on TLS server connectiontls: server advertised both NPN and ALPN extensionstls: server selected unsupported compression formattls: server's identity changed during renegotiationunicode code point U+E123 reserved for internal useunknown or mismatched type: type: %v, wire type: %vupdate document must contain key beginning with '$'upload [OPTIONS]write concern `w` field cannot be a negative number%s can only decode valid and settable %s, but got %s'%s' expected type '%s', got unconvertible type '%s'An error occurred while downloading the remote file.Distribution of total sent bytes per RPC, by method.Not using previously cached image - deleting image: You need to define a storage id and a path to deletecannot add a child (id = %d) of type %T to a channelcannot delete a child (id = %d) from a listen socketcannot delete a child (id = %d) from a normal socketcasfrom_Gscanstatus: gp->status is not in scan statecobra_annotation_bash_completion_filename_extensionscrypto/rsa: message too long for RSA public key sizedecode: corrupted data: non-zero delta for singletondriver: skip fast-path; continue as if unimplementedduration: %v: seconds and nanos have different signsexpected space, attr name, or end of tag, but got %qheader/message limit not allowed in blacklist confightml/template: cannot Clone %q after it has executedhttp2: Transport readFrame error on conn %p: (%T) %vhttp: method cannot contain a Content-Length; got %qmath/big: cannot unmarshal %q into a *big.Float (%v)protocol error: received DATA before a HEADERS framerequest header "TE" may only be "trailers" in HTTP/2roundrobinPicker: newPicker called with readySCs: %vruntime.SetFinalizer: pointer not in allocated blockruntime: use of FixAlloc_Alloc before FixAlloc_Init ssh: certificate presented as a host key has type %dssh: listen on random port failed after %d tries: %vssh: peer's curve25519 public value has wrong lengthssh: unexpected message type %d (expected one of %v)subconn returned from pick is not *acBalancerWrappersvType != tvType; key=%s, st=%v, tt=%v, sv=%v, tv=%vtemplate: no template %q associated with template %qtls: private key type does not match public key typetls: server selected unsupported protocol version %xtransport: preface mismatch, wrote %d bytes; want %dunable to cast %#v of type %T to map[string][]stringunexpected token %s, was expecting a table array keywrong number of args for %s: want at least %d got %dx509: cannot verify signature: insecure algorithm %vx509: trailing data after X.509 certificate policiesxml: EncodeElement of StartElement with missing name{"$regularExpression":{"pattern":%s,"options":"%s"}}'Endpoint' configuration is required for this serviceDownloading failed during retrieveing storage data : No cache registry set - only local cache is availablePlan task creation with cron syntax ( e.g @every 1m )Set state to 'failure' for task %s returned error: %sSet state to 'started' for task %s returned error: %sSet state to 'success' for task %s returned error: %sTime.MarshalBinary: zone offset has fractional minuteTotal bytes sent across all request messages per RPC.UnknownNotCreatedRunningSavedPowerOffAbortedPreparingWARNING: Waiter %s encountered unexpected matcher: %sX-Amz-Copy-Source-Server-Side-Encryption-Customer-Key^\s*([[:ascii:]]{1,256}?)=("[[:ascii:]]{0,256}?")\s*,archive/tar: sparse file references non-existent dataarray filters cannot be set for server versions < 3.6binarylogging: error in trailer is not a status errorbufio.Scan: too many empty tokens without progressingdid not find expected alphabetic or numeric characterdns resolver: missing port after port-separator colonduration: %#v: seconds and nanos have different signsfunction symbol table not sorted by program counter: google.protobuf.EnumDescriptorProto.EnumReservedRangehttp2: Framer %p: failed to decode just-written framehttp2: Transport failed to get client conn for %s: %vhttp: putIdleConn: too many idle connections for hostillegal use of AllowIllegalReads with ReadMetaHeadersmath/big: internal error: cannot find (D/n) = -1 for missing remote repository e.g. 'github.com/user/repo'net/http: CloseNotify called after ServeHTTP finishedopentracing: SpanContext not found in Extract carrierpem: cannot encode a header key that contains a colonproto: PluginPrivilege: illegal tag %d (wire type %d)reflect.Value.Slice: string slice index out of boundsreflect: non-interface type passed to Type.Implementstls: client does not support uncompressed connectionstls: failed to find any PEM data in certificate inputtransport: failed to write initial settings frame: %vx509: DSA signature contained zero or negative valuesx509: certificate specifies an incompatible key usagex509: failed to parse ECDSA parameters as named curvex509: trailing data after X.509 authority informationxml: %s.MarshalXML wrote invalid XML: <%s> not closed%T.%s cannot be a slice of pointers to primitive types%v.%s cannot be a slice of pointers to primitive typesEnd-to-end latency, by HTTP method and response statusGSSAPI support not enabled during build (-tags gssapi)Image used from the task ( e.g. my/docker-image:latestOption ,inline needs a map with string keys in struct PushConfig.AuthenticationMethod has unexpected type %TRepository url ( e.g. https://github.com/foo/bar.git )SCRAM-SHA-1 is only supported for servers 3.0 or newerSet state to 'received' for task %s returned error: %sURI with IP (%q) cannot be matched against constraints goroutine running on other thread; stack unavailable a message with extensions, but no extensions field in base.baseBalancer: handle SubConn state change: %p, %vblock sequence entries are not allowed in this contextbytes.Buffer: reader returned negative count from Readexplicitly tagged !!binary data must be base64-encodedfmt: scanning called UnreadRune with no rune availablegcControllerState.findRunnable: blackening not enabledhttp2: handler wrote more than declared Content-Lengthhttp2: received GOAWAY %+v, starting graceful shutdownhttp: Request.Write on Request with no Host or URL setinternal error: expected to be already writing a frameinvalid header because MessageLength is imporperly setkey %s is already assigned and not of type table arraymore elements returned in array than can fit inside %sname is not in canonical format (it must end with a .)no goroutines (main called runtime.Goexit) - deadlock!not enough bytes available after index to write lengthopentracing: SpanContext type incompatible with tracerpubsub: UpdateSubscription call with nothing to updatequotedprintable: invalid unescaped byte 0x%02x in bodyreflect.FuncOf does not support more than 50 argumentsssh: only P-256, P-384 and P-521 EC keys are supportedssh: unexpected packet in response to channel open: %Ttag handle must contain alphanumerical characters onlytarget must be an absolute URL or an absolute path: %qtls: ECDSA signature contained zero or negative valuestls: failed to create cipher while encrypting ticket: tls: found unknown private key type in PKCS#8 wrappingtls: server resumed a session with a different versiontls: unsupported signature type for client certificatex509: cannot verify signature: algorithm unimplementedx509: trailing data after X.509 CRL distribution pointxml: namespace without name in field %s of type %s: %q&{hash: %#v, salt: %#v, cost: %d, major: %c, minor: %c}Distribution of messages sent count per RPC, by method.Distribution of sent messages count per RPC, by method.Number of gRPC StreamingPull response messages receivedReplicaProvisionedReadCapacityAutoScalingSettingsUpdateUnsupported map key of type: %s, key: %+#v, value: %+#va HEADERS frame cannot appear in the middle of a streamalias value must contain alphanumerical characters onlybufio.Scanner: SplitFunc returns negative advance countcannot add a child (id = %d) of type %T to a subChannelcannot assign type '%s' to map value field of type '%s'casfrom_Gscanstatus:top gp->status is not in scan statecipher.NewCBCDecrypter: IV length must equal block sizecipher.NewCBCEncrypter: IV length must equal block sizecrypto/bcrypt: cost %d is outside allowed range (%d,%d)error parsing list, expected comma or list end, got: %sgentraceback callback cannot be used with non-zero skiphttp2: server: error reading preface from client %v: %vinternal error: can only be writing one frame at a timemap merge requires map or sequence of maps as the valuemax staleness (%s) must be greater than or equal to 90snet/http: invalid byte %q in %s; dropping invalid bytesnet/http: request canceled while waiting for connectionnewproc: function arguments too large for new goroutineopencensus.io/http/client/response_count_by_status_codeopencensus.io/http/server/response_count_by_status_codeprogressive AC coefficients for more than one componentreflect.FuncOf: last arg of variadic func must be slicereflect: internal error: invalid use of makeMethodValuethe message length is too small, it must be at least 16unable to cast %#v of type %T to map[string]interface{}x509: ECDSA signature contained zero or negative valuesx509: failed to load system roots and no roots providedx509: too many intermediates for path length constraintKey %s of inlined map conflicts with a struct field nameTotal bytes sent in request body (not including headers)Waiting for running tasks to finish before shutting down":" statement is not valid, could be : :ack deadline must be between 10 and 600 seconds; got: %vanchor value must contain alphanumerical characters onlyattempted to go past the end of stream; corrupted value?b4050a850c04b3abf54132565044b0b7d7bfd8ba270b39432355ffb4b70e0cbd6bb4bf7f321390b94a03c1d356c21122343280d6115c1d21bad interface encoding: data length too large for bufferbd376388b5f723fb4c22dfe6cd4375a05a07476444d5819985007e34config object is not an instance of %s, instead got '%T'empty string is not a valid method binary logging configgrpc: Decompressor is not installed for grpc-encoding %qgrpc: parseServiceConfig error unmarshaling %s due to %vhttp2: response header list larger than advertised limitin gcMark expecting to see gcphase as _GCmarkterminationincorrect header: collection name does not contain a dotinvalid interface value length %d: exceeds input size %dmalformed client for scheme %q, client is defined as nilmax staleness is only supported for servers 3.4 or newerpresigned URL requires an expire duration greater than 0promised request headers cannot include pseudo header %qproto: PluginPrivilege: wiretype end group for non-grouprecord on line %d; parse error on line %d, column %d: %vserver connection cancelled/timeout during TLS handshakestrings: illegal use of non-zero Builder copied by valuetimeseries: resolutions must be monotonically increasingtls: could not validate signature of connection nonces: tls: no cipher suite supported by both client and serverviolation of WriteScheduler interface: unknown stream %dx509: internal error: empty chain when appending CA certxml: %s.UnmarshalXML did not consume entire <%s> elementAutoScalingTargetTrackingScalingPolicyConfigurationUpdateClient received GoAway with http2.ErrCodeEnhanceYourCalm.GobDecoder: invalid data length %d: exceeds input size %dGogs: Repository does not exist or you do not have accessInvalid response from server, value field is not a numberTotal bytes sent in across all response messages per RPC.X-Amz-Copy-Source-Server-Side-Encryption-Customer-Key-Md5bytes,1051,rep,name=method_signature,json=methodSignaturecan't handle assignment of %s to empty interface argumentcannot register Codec with empty string result for Name()channel binding received '%s' doesn't match expected '%s'cursor should be an embedded document but it is a BSON %sgentraceback cannot trace user goroutine on its own stackgrpc: compressed flag set with identity or empty encodinggrpc: failed load balancer address dns lookup due to %v. http: Request.RequestURI can't be set in client requests.invalid command line length: expected at least %d, got %dinvalid response from server, value field is not a numbermalformed: key is too long or contains invalid charactersnon-Go code set up signal handler without SA_ONSTACK flagnot enough bytes available to read type. bytes=%d type=%sopentracing: Unknown or unsupported Inject/Extract formatpubsub: Receive already in progress for this subscriptionreceived record with version %x when expecting version %xruntime:stoplockedm: g is not Grunnable or Gscanrunnable ssh: channel response message received on inbound channelsync: WaitGroup misuse: Add called concurrently with Waitthe ResponseWriter doesn't support the Hijacker interfacetls: application data record requested while in handshaketls: peer doesn't support any common signature algorithmstransactions do not support unacknowledged write concernstype mismatch: no fields matched compiling decoder for %sx509: failed to parse EC private key embedded in PKCS#8: (struct %s) inline fields must be either a struct or a mapDistribution of server latency in milliseconds, by method.Number of footer colors must be equal to number of footer.There was an error with the scanner in attached container There was an error with the scanner in attached container:Total bytes received across all response messages per RPC."help" flag declared as non-bool. Please correct your codeargument to Decode must be a pointer to a type, but got %vattrNoneattrScriptattrScriptTypeattrStyleattrURLattrSrcsetcannot add a child (id = %d) of type %T to a listen socketcannot add a child (id = %d) of type %T to a normal socketcannot push URL with scheme %q from request with scheme %qcouldn't read length from src, not enough bytes. length=%dgob: cannot encode nil pointer of type %s inside interfacehttp2: client connection force closed via ClientConn.Closejson: cannot set embedded pointer to unexported struct: %vopentracing: SpanContext data corrupted in Extract carrierparser source is not seekable and storage was not providedredigo.ScanSlice: dest must be non-nil pointer to a structsha256-crypt rounds must be in 1000 <= rounds <= 999999999ssh_config: value for key %q must be 'yes' or 'no', got %qtransport: http2Client.reader got unhandled frame type %v.urlPartNoneurlPartPreQueryurlPartQueryOrFragurlPartUnknownwas a primary, but its set version or election id is stalex509: failed to parse RSA private key embedded in PKCS#8: xml: encoding %q declared but Decoder.CharsetReader is nilxml: unsupported version %q; only version 1.0 is supported%T.%s cannot be a pointer to a map or a slice of map values%s field %q with tag %q conflicts with field %q with tag %q%v.%s cannot be a pointer to a map or a slice of map valuesDelta length (%v) is different from source text length (%v)Distribution of messages received count per RPC, by method.Distribution of received messages count per RPC, by method.Number of column colors must be equal to number of headers.Number of header colors must be equal to number of headers.RoundTripper returned a response & error; ignoring responseX-Amz-Copy-Source-Server-Side-Encryption-Customer-AlgorithmYou can delete a task or a pipeline associated to a webhookbufio.Scanner: SplitFunc returns advance count beyond inputcould not parse forwarded-streamlocal@openssh.com payload: delimNonedelimDoubleQuotedelimSingleQuotedelimSpaceOrTagEndepoll_wait returned more events than I know what to do withexplicit sessions cannot be used with unacknowledged writesgrpc: ignoring retry policy %v due to illegal configurationhtml/template internal error: template escaping out of synchttp2: Transport received Server's graceful shutdown GOAWAYkey '%s' expected start of object ('{') or assignment ('=')number of digits and symbols must be less than total lengthpickfirstBalancer: HandleResolvedAddrs called with error %vreflect: indirection through nil pointer to embedded structreplacement document cannot contains keys beginning with '$runtime: mmap: too much locked memory (check 'ulimit -l'). ssh: streamlocal-forward@openssh.com request denied by peersync/atomic: store of inconsistently typed value into Valuesync: WaitGroup is reused before previous Wait has returnedtls: server resumed a session with a different cipher suitetoken.Pos offset overflow (> 2G of source code in file set)AWS_ACCESS_KEY_ID or AWS_ACCESS_KEY not found in environmentCache image after execution inside the host for later reuse.GlobalTableProvisionedWriteCapacityAutoScalingSettingsUpdatebytes.Reader.UnreadRune: previous operation was not ReadRunecannot call abortTransaction after calling commitTransactioncannot call commitTransaction after calling abortTransactioncannot decode element '%s' into field %v; it is not settablefound a tab character where an indentation space is expectedgrpc: failed to parse service config json string due to %v. input level is not one of: TRACE, INFO, WARN, ERROR or FATALinternal error: attempt to send frame on a closed stream: %vmalformed response from server: missing status pseudo headernet/http: server response headers exceeded %d bytes; abortedonly a pointer to struct or map can be unmarshaled from TOMLredigo.ScanStruct: value must be non-nil pointer to a structssh: unexpected trailing data after certificate option valuetls: initial handshake had non-empty renegotiation extensionviolation of WriteScheduler interface: cannot close stream 0x509: encrypted PEM data is not a multiple of the block sizeCan't have key %q in inlined map; conflicts with struct fieldHTTP request body size if set as ContentLength (uncompressed)"version" flag declared as non-bool. Please correct your codeacBalancerWrapper: UpdateAddresses: failed to newAddrConn: %vbytes,1055,opt,name=resource_reference,json=resourceReferencego package net: GODEBUG setting forcing use of Go's resolver ignoring balancer switching: Balancer DialOption used insteadinvalid response from server, 'value' field is not a documentkey "%s" was found but was not valid to traverse BSON type %snet/http: invalid Cookie.Domain %q; dropping domain attributeruntime: may need to increase max user processes (ulimit -u) tls: certificate private key does not implement crypto.Signertype mismatch in decoder: want struct type %s; got non-structx509: failed to parse URI constraint %q: cannot be IP addressxml: EncodeToken of Directive containing wrong < or > markers0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZDecode parameters from a JSON file ( e.g. /path/to/file.json )Decode parameters from a YAML file ( e.g. /path/to/file.yaml )Distribution of server latency as viewed by client, by method.Monitor task after creation (returns same exit status as task)URI with empty host (%q) cannot be matched against constraintsVirtualBox is complaining that the kernel module is not loaded"@" statement is not valid, could be : @{}, @{}argument to Unmarshal* must be a pointer to a type, but got %vcannot initialize objectid package with crypto.rand.Reader: %vexec configuration Env is only supported in API#1.25 and abovefound bad pointer in Go heap (incorrect use of unsafe or cgo?)http2: ConfigureTransport is only supported starting at Go 1.6http2: request header list larger than peer's advertised limitproto: deterministic not supported by the Marshal method of %Treflect.ArrayOf: array size would exceed virtual address spaceruntime: internal error: misuse of lockOSThread/unlockOSThreadstrings.Reader.UnreadRune: previous operation was not ReadRunetls: certificate cannot be used with the selected cipher suitewait: remote command exited without exit status or exit signalx509: certificate is not authorized to sign other certificatesx509: certificate private key does not implement crypto.Signer

HTTP Error 431

Request Header Field(s) Too Large

A Vagrant environment or target machine is required to run thisCount of completed requests, by HTTP method and response statusOP_MSG{MsgHeader: %v, FlagBits: %d, Sections: %v, Checksum: %d}Set the user id permission to the type ( e.g 'user' or 'admin')You need to define a webhook id and a key and a value to update^(([0-9a-f]{0,4}):)?([0-9a-f]{2}):([0-9a-f]{2})\.([0-9a-f]{1})$attempt to delete an entry (id=%d) that doesn't currently existattempt to traverse into %s, but it's type is %s, not %s nor %sbytes,1053,rep,name=resource_definition,json=resourceDefinitioncrypto/bcrypt: hashedSecret too short to be a bcrypted passwordelementNoneelementScriptelementStyleelementTextareaelementTitlehttp2: push would exceed peer's SETTINGS_MAX_CONCURRENT_STREAMSinternal error: exactly one of res or err should be set; nil=%vnet/trace: trace used after finish: Finished at: %s Used at: %srequest declared a Content-Length of %d but only wrote %d bytestls: supported signature algorithm has an unknown hash functiontransport: the stream is done or WriteHeader was already calledviolation of WriteScheduler interface: stream %d already closedwrong date "%s" must fit ISO-8601 format : 2006-01-02T15:04:05Z. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567894fe342e2fe1a7f9b8ee7eb4a7c0f9e162bce33576b315ececbb6406837bf51f55ac635d8aa3a93e7b3ebbd55769886bc651d06b0cc53b0f63bce3c3e27d2604b6b17d1f2e12c4247f8bce6e563a440f277037d812deb33a0f4a13945d898c2967fffffff00000001fffffffe8000000100000000ffffffff0000000180000000ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_AWS_SECRET_ACCESS_KEY or AWS_SECRET_KEY not found in environmentReceived invalid type for upserted, should be Array, received %s"@" statement is not valid, could be : @{push}, @{push} Content-Type: text/plain; charset=utf-8 Connection: close cannot decrypted encrypted session key with private key of type decoding array or slice: length exceeds input size (%d elements)empty digest algorithm, validate before calling Algorithm.Hash()failed to get balancer builder for: %v, using pick_first insteadflate: invalid compression level %d: want value in range [-2, 9]grpc: Compressor is not installed for requested grpc-encoding %qgrpc: client streaming protocol violation: get , want http: request method or response status code does not allow bodyinternal error; sent too many window updates without decrements?json: invalid number literal, trying to unmarshal %q into Numberthe stream is rejected because server is draining the connectiontls: certificate private key does not implement crypto.DecrypterRegex match pattern for nodes, it will create a task for each onebinarylogging: message to log is neither proto.message nor []bytedocument is invalid, end byte is at %d, but null byte found at %dgssapi-with-mic,hostbased,publickey,keyboard-interactive,passwordimage build may not be provided BOTH context dir and input streamlength read exceeds number of bytes available. length=%d bytes=%druntime.SetFinalizer: pointer not at beginning of allocated blockstrconv: internal error: extFloat.FixedDecimal called with n == 0x509: issuer name does not match subject from issuing certificatexml: name %q in tag of %s.%s conflicts with name %q in %s.XMLNameReceived invalid type for n, should be Int32 or Int64, received %sYou need to define a storage id, a file and a target storage path.document end byte found before end of document. remaining bytes=%vmetadata: Pairs got the odd number of input pairs for metadata: %dsender tried to send more than declared Content-Length of %d bytesthe client side LB channel health check function has not been set.tls: client offered an unsupported, maximum protocol version of %xx509: certificate is not valid for any names, but wanted to match x509: requested SignatureAlgorithm does not match private key typeHelp provides help for any command in the application. Simply type Server retry pushback specified multiple values (%q); not retrying."~" or "^" statement must have a reference defined at the beginningbase.baseBalancer: got state changes for an unknown SubConn: %p, %vcrypto/bcrypt: hashedPassword is not the hash of the given passwordonly source profile or credential source can be specified, not bothtls: handshake or ChangeCipherSpec requested while not in handshaketransport: cannot send secure credentials on an insecure connection2695994666715063979466701508701962594045780771442439172168272236806126959946667150639794667015087019630673557916260026308143510066298881Header{MessageLength: %d, RequestID: %d, ResponseTo: %d, OpCode: %v}Signature: need to call Sign, SignUserId or SignKey before Serializebig: invalid 2nd argument to Int.Jacobi: need odd integer but got %scan not look up shorthand which is more than one ASCII character: %qcannot provide resume functionality when the resume token is missingcreate --name [user] --email [email] --password [password] [OPTIONS]custom type: type: %v, does not implement the proto.custom interfacedecoding int array or slice: length exceeds input size (%d elements)document length exceeds available bytes. length=%d remainingBytes=%dexpected SCALAR, SEQUENCE-START, MAPPING-START, or ALIAS, but got %vgo package net: built with netgo build tag; using Go's DNS resolver http2: Transport conn %p received error from processing frame %v: %vhttp2: Transport received unsolicited DATA frame; closing connectionhttp: message cannot contain multiple Content-Length headers; got %qinvalid DocumentSequence: a non-document value was found in sequencepadding bytes must all be zeros unless AllowIllegalWrites is enabledpickfirstBalancer: ignored state change because sc is not recognizedruntime:greyobject: checkmarks finds unexpected unmarked object obj=user lookup: operating system does not provide passwd-formatted data'%s': expected source data to have length less or equal to %d, got %d.pem file must have both a CERTIFICATE and an RSA PRIVATE KEY sectionNumber of messages sent in the RPC (always 1 for non-streaming RPCs).Returned when a client attempts to contact a service too many times^([\x20-\x2b\x2d-\x3c\x3e-\x7e]{0,255}[\x21-\x2b\x2d-\x3c\x3e-\x7e])$^\d{1,4}-\d{2}-\d{2}T\d{2}:\d{2}:\d{2}(\.\d{1,9})?(Z|[+-]\d{2}:\d{2})cannot unmarshal into an ObjectID, the length must be 12 but it is %ddecoding bool array or slice: length exceeds input size (%d elements)decoding int8 array or slice: length exceeds input size (%d elements)decoding uint array or slice: length exceeds input size (%d elements)exec configuration WorkingDir is only supported in API#1.35 and abovehttp2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)number of digits exceeds available digits and repeats are not allowedtls: handshake message of length %d bytes exceeds maximum of %d bytes if [[ -z "${BASH_VERSION}" || "${BASH_VERSINFO[0]}" -gt 3 ]]; thenThe access controller denied access for the operation on a resource.ToNearestEvenToNearestAwayToZeroAwayFromZeroToNegativeInfToPositiveInfblockingPicker: the picked transport is not ready, loop back to repickbytes.Buffer: UnreadByte: previous operation was not a successful readdecoding int16 array or slice: length exceeds input size (%d elements)decoding int32 array or slice: length exceeds input size (%d elements)decoding int64 array or slice: length exceeds input size (%d elements)got %s for stream %d; expected CONTINUATION following %s for stream %dmalformed shallow hash: wrong length, expected 40 bytes, read %d bytespubsub: cannot decode the retrieved message at index: %d, message: %+vx509: PKCS#8 wrapping contained private key with unknown algorithm: %v%T.%s cannot be a pointer to a interface or a slice of interface values%v.%s cannot be a pointer to a interface or a slice of interface valuesdecoding string array or slice: length exceeds input size (%d elements)decoding uint16 array or slice: length exceeds input size (%d elements)decoding uint32 array or slice: length exceeds input size (%d elements)decoding uint64 array or slice: length exceeds input size (%d elements)dynamic table size update MUST occur at the beginning of a header blockinternal error: attempt to send frame on a half-closed-local stream: %vjson: invalid use of ,string struct tag, trying to unmarshal %q into %vnumber of letters exceeds available letters and repeats are not allowednumber of symbols exceeds available symbols and repeats are not allowedssh: no common algorithm for %s; client offered: %v, server offered: %vtls: client's certificate contains an unsupported public key of type %Ttoo many concurrent operations on a single file or socket (max 1048575)unknown color model: 4-component JPEG doesn't have Adobe APP14 metadatax509: issuer has name constraints but leaf doesn't have a SAN extension can only be decoded from remote interface type; received concrete type Number of messages sent in each RPC. Has value 1 for non-streaming RPCs.Warning: event `%v` has exceeded the maximum number of listeners of %d. ambiguous options, only one of CommitHash or ReferenceName can be passeddecoding float32 array or slice: length exceeds input size (%d elements)decoding float64 array or slice: length exceeds input size (%d elements)decoding uintptr array or slice: length exceeds input size (%d elements)tls: server's certificate contains an unsupported type of public key: %T{{with .Name}}{{printf "%s " .}}{{end}}{{printf "version %s" .Version}} incorrect header: original opcode does not match opcode in message headerreceived unexpected status %d while trying to retrieve the server versiontls: found a certificate rather than a key in the PEM for the private keytls: received unexpected handshake message of type %T when waiting for %TReceived invalid type for nModified, should be Int32 or Int64, received %sbytes.Buffer: UnreadRune: previous operation was not a successful ReadRunedecoding complex64 array or slice: length exceeds input size (%d elements)invalid command and capabilities line length: expected at least %d, got %dmalformed response from server: malformed non-numeric status pseudo headernet/http: server replied with more than declared Content-Length; truncatedunknown number base: %s. possible options are x (hex) o (octal) b (binary)ByteSliceDecodeValue can only be used to decode subtype 0x00 for %s, got %vUnsolicited response received on idle HTTP channel starting with %q; err=%vcan only transform slices and arrays into aggregation pipelines, but got %vdecoding complex128 array or slice: length exceeds input size (%d elements)header list size to send violates the maximum size (%d bytes) set by serverunable to find any valid known_hosts file, set SSH_KNOWN_HOSTS env variableNumber of messages received in each RPC. Has value 1 for non-streaming RPCs.transport: loopyWriter.writeHeader encountered error while encoding headers:transport: trying to send header list size larger than the limit set by peerunable to redefine %q shorthand in %q flagset: it's already used for %q flagcrypto/tls: ExportKeyingMaterial is unavailable when renegotiation is enabledgrpc: credentials.Bundle may not be used with individual TransportCredentialsinvalid Body.Read call. After hijacked, the original Request must not be used115792089210356248762697446949407573529996955224135760342422259061068512044369115792089210356248762697446949407573530086143415290314195533631308867097853951malformed OP_REPLY: NumberReturned does not match number of documents returnedmalformed OP_REPLY: NumberReturned does not match number of returned documentsssh: principal %q not in the set of valid principals for given certificate: %qssh: unable to authenticate, attempted methods %v, no supported methods remainx509: signature check attempts limit reached while verifying certificate chainChannel switches to new LB policy %q due to fallback from invalid balancer nameFloatDecodeValue can only convert float64 to float32 when truncation is allowedNumber of response messages received per RPC (always 1 for non-streaming RPCs).cannot manually encode TypeXHeader, TypeGNULongName, or TypeGNULongLink headershttp2: server closing client connection; error reading frame from client %s: %vtls: client certificate private key of type %T does not implement crypto.Signergrpc: addrConn.createTransport failed to connect to %v. Err :%v. Reconnecting...invalid value: only ASCII characters accepted; max length must be 255 characterstls: either ServerName or InsecureSkipVerify must be specified in the tls.Configx509: invalid signature: parent certificate cannot sign this kind of certificatexml: end tag in namespace %s does not match start tag <%s> in namespace %s(ftp|http|https):\/\/(\w+:{0,1}\w*@)?(\S+)(:[0-9]+)?(\/|\/([\w#!:.?+=&%@!\-\/]))? storage: type: %s artefact_path: %s namespace_path: %s storage_path: %s OP_KILL_CURSORS{MsgHeader: %s, Zero: %d, Number of Cursor IDS: %d, Cursor IDs: %v}credential source values must be EcsContainer, Ec2InstanceMetadata, or Environmentrefusing to use HTTP_PROXY value in CGI environment; see golang.org/s/cgihttpproxyx509: a root or intermediate certificate is not authorized to sign for this name: (possibly because of %q while trying to verify candidate authority certificate %q)invalid key name: only ASCII characters accepted; max length must be 255 charactersjson: invalid use of ,string struct tag, trying to unmarshal unquoted value into %vx509: issuer has name constraints but leaf contains unknown or unconstrained name: ^(?:(?P[^@]+)@)?(?P[^:\s]+):(?:(?P[0-9]{1,5})/)?(?P[^\\].*)$crypto/bcrypt: bcrypt hashes must start with '$', but hashedSecret started with '%c'grpc: received message larger than max length allowed on current machine (%d vs. %d)varint,1052,rep,name=field_behavior,json=fieldBehavior,enum=google.api.FieldBehaviorx509: signature algorithm specifies an %s public key, but have public key of type %Tattempt to delete child with id %d from a parent (id=%d) that doesn't currently existhttp: WriteHeader called with both Transfer-Encoding of %q and a Content-Length of %dreflect.Value.Interface: cannot return value obtained from unexported field or methodIntDecodeValue can only truncate float64 to an integer type when truncation is enabledPropagated from the server and should have the same value as "grpc.io/server/latency".Subchannel health check is unimplemented at server side, thus health check is disabledWARN: SQS.ReceiveMessage failed checksum request id: %s, message %d has no message ID."@" statement is not valid, could be : @{}, @{}http2: TLSConfig.CipherSuites is missing an HTTP/2-required AES_128_GCM_SHA256 cipher.x509: a root or intermediate certificate is not authorized for an extended key usage: UintDecodeValue can only truncate float64 to an integer type when truncation is enabledgrpc: no transport security set (use grpc.WithInsecure() explicitly or set credentials)length of CodeWithScope does not match lengths of components; total: %d; components: %dcrypto/bcrypt: bcrypt algorithm version '%c' requested is newer than current version '%c'^(([a-z][_0-9a-z\-\*\/]{0,255})|([a-z][_0-9a-z\-\*\/]{0,240}@[a-z][_0-9a-z\-\*\/]{0,13}))$http2: server sent GOAWAY and closed the connection; LastStreamID=%v, ErrCode=%v, debug=%qattempt to add child of type %T with id %d to a parent (id=%d) that doesn't currently existxml: EncodeToken of ProcInst xml target only valid for xml declaration, first token encoded--system --shell /bin/false --no-create-home --disabled-login --disabled-password --group %sTotal bytes sent in request body (not including headers), by HTTP method and response statusOP_COMPRESSED{MsgHeader: %s, Uncompressed Size: %d, CompressorId: %d, Compressed message: %s}The operation was unsupported due to a missing implementation or invalid set of parameters.Time between first byte of request received to last byte of response sent, or terminal error.Time between first byte of request sent to last byte of response received, or terminal error."@" statement is not valid, could be : @{upstream}, @{upstream}, @{u}, @{u}a handshake hash for a client-certificate was requested after discarding the handshake bufferMottainai CLI Copyright (c) 2017-2018 Mottainai Command line interface for Mottainai clustersOP_GET_MORE{MsgHeader: %s, Zero: %d, FullCollectionName: %s, NumberToReturn: %d, CursorID: %d}Request.EachPage deprecated. Use Pagination type for configurable pagination of API operationsRequest.NextPage deprecated. Use Pagination type for configurable pagination of API operationsserver at %s requires wire version %d, but this version of the Go driver only supports up to %d3617de4a96262c6f5d9e98bf9292dc29f8f41dbd289a147ce9da3113b5f0b8c00a60b1ce1d7e819d7a431d7c90ea0e5faa87ca22be8b05378eb1c71ef320ad746e1d3b628ba79b9859f741e082542a385502f25dbf55296c3a545e3872760ab7b3312fa7e23ee7e4988e056be3f82d19181d9c6efe8141120314088f5013875ac656398d8a2ed19d2a85c8edd3ec2aefCalled inject.InterfaceOf with a value that is not a pointer to an interface. (*MyInterface)(nil)Request.HasNextPage deprecated. Use Pagination type for configurable pagination of API operations end config.vm.provider "virtualbox" do |vb| vb.customize ["modifyvm", :id, "--memory", "transport: http2Client.handleRSTStream found no mapped gRPC status for the received http2 error %v EOF SCRIPT VAGRANTFILE_API_VERSION = "2" Vagrant.configure(VAGRANTFILE_API_VERSION) do |config| grpc: the credentials require transport level security (use grpc.WithTransportCredentials() to set)revision suffix brace component sequences starting with "/!" others than those defined are reservedTime between first byte of request headers sent to last byte of response received, or terminal errorTotal bytes received in response bodies (not including headers but including error responses with bodies)server at %s reports wire version %d, but this version of the Go driver requires at least %d (MongoDB %s)asn1: time did not serialize back to the original value and may be invalid: given %q, but serialized as %q if redis.call("GET", KEYS[1]) == ARGV[1] then return redis.call("DEL", KEYS[1]) else return 0 end max staleness (%s) must be greater than or equal to the heartbeat interval (%s) plus idle write period (%s)no valid providers in chain. Deprecated. For verbose messaging see aws.Config.CredentialsChainVerboseErrorsEcsContainer was specified as the credential_source, but 'AWS_CONTAINER_CREDENTIALS_RELATIVE_URI' was not setOP_REPLY{MsgHeader: %s, ResponseFlags: %s, CursorID: %d, StartingFrom: %d, NumberReturned: %d, Documents: %v}go-dockerclient: CopyFromContainer is no longer available in Docker >= 1.12, use DownloadFromContainer insteadgrpc: addrConn.createTransport failed to connect to %v: didn't receive server preface in time. Reconnecting...Enable the remote features by doing a blank import of the viper/remote package: '_ github.com/spf13/viper/remote'http2: Transport: cannot retry err [%v] after Request.Body was written; define Request.GetBody to avoid this error3940200619639447921227904010014361380507973927046544666794829340424572177149687032904726608825893800186160697311231939402006196394479212279040100143613805079739270465446667946905279627659399113263569398956308152294913554433653942643tls: failed to find "CERTIFICATE" PEM block in certificate input after skipping PEM blocks of the following types: %v general: debug: %t logfile: %s loglevel: %s tls_cert: %s tls_key: *********************** client_timeout: %d Generic error returned when the error does not have an API classification. flags=() two_word_flags=() local_nonpersistent_flags=() flags_with_completion=() flags_completion=() tls: failed to find certificate PEM data in certificate input, but did find a private key; PEM inputs may have been switched{{with (or .Long .Short)}}{{. | trimTrailingWhitespaces}} {{end}}{{if or .Runnable .HasSubCommands}}{{.UsageString}}{{end}} db: engine: %s db_path: %s endpoints: %s db_name: %s db_password: **** db_certpath: %s db_keypath: %s db_user: %s TypeGaugeInt64TypeGaugeFloat64TypeGaugeDistributionTypeCumulativeInt64TypeCumulativeFloat64TypeCumulativeDistributionTypeSummary$> mottainai-cli -m http://127.0.0.1:8080 task create --json task.json $> mottainai-cli -m http://127.0.0.1:8080 namespace list tls: failed to find PEM block with type ending in "PRIVATE KEY" in key input after skipping PEM blocks of the following types: %vc6858e06b70404e9cd9e3ecb662395b4429c648139053fb521f828af606b4d3dbaa14b5e77efe75928fe1dc127a2ffa8de3348b3c1856a429bf97e7e31c2e5bd66# -*- mode: ruby -*- # vi: set ft=ruby : $set_environment_variables = <